F368073

General Info

Members Datasets Scaffolds Average Seq Length
258 153 516 187

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10010052|Ga0105239_100100525
Length 195
Sequence MSVMEAAPAQRPLHLPVILGTPRQGRSSEFVARFVHEQVAARAGVTTELIDIRTLRFSIEDAGETIKDPEFSAAMDRADGLIVIAPEYNHGYPGLLKHALDTNLKEYIHKPVGICGVSAGGFGGTRVIQNLLPVMRELGLVTIFWDGNFSGAQNLFDETGTLKEAVYIGRIEKFLNELIWMATVLRYGRENITIA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
140 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
141 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
142 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
143 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
144 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
145 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.26
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 25.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10010052 3300010375 Bacteria 10608
2 Ga0065712_10079128 3300005290 Unclassified 3256
3 Ga0065715_10187005 3300005293 Unclassified 1439
4 Ga0070670_100030865 3300005331 Bacteria 4616
5 Ga0070670_100136232 3300005331 Bacteria 2122
6 Ga0070670_100182340 3300005331 Bacteria 1823
7 Ga0070670_100588288 3300005331 Unclassified 995
8 Ga0070670_100596174 3300005331 Bacteria 988
9 Ga0068869_100028850 3300005334 Plasmid 3881
10 Ga0070666_10026839 3300005335 Unclassified 3767
11 Ga0070680_100012225 3300005336 Bacteria 6667
12 Ga0070680_100017203 3300005336 Bacteria 5697
13 Ga0070682_100850945 3300005337 Unclassified 745
14 Ga0068868_100016455 3300005338 Bacteria 5492
15 Ga0070689_100436357 3300005340 Bacteria 1112
16 Ga0070687_100055177 3300005343 Bacteria 2074
17 Ga0070692_10208591 3300005345 Unclassified 1148
18 Ga0070669_100346847 3300005353 Bacteria 1204
19 Ga0070675_100201225 3300005354 Unclassified 1729
20 Ga0070671_100026361 3300005355 Plasmid 4776
21 Ga0070673_100067145 3300005364 Bacteria 2867
22 Ga0070659_100221401 3300005366 Unclassified 1562
23 Ga0070705_100111124 3300005440 Bacteria 1751
24 Ga0070700_100092585 3300005441 Bacteria 1975
25 Ga0070708_100000311 3300005445 Bacteria 36596
26 Ga0070681_10003300 3300005458 Bacteria 15066
27 Ga0068867_100148344 3300005459 Unclassified 1840
28 Ga0070685_10051876 3300005466 Unclassified 2372
29 Ga0070706_100018035 3300005467 Bacteria 6511
30 Ga0070706_100663393 3300005467 Bacteria 968
31 Ga0070707_100033490 3300005468 Bacteria 4900
32 Ga0070707_100061717 3300005468 Bacteria 3595
33 Ga0070707_100344994 3300005468 Bacteria 1446
34 Ga0070698_100003912 3300005471 Bacteria 16380
35 Ga0070698_100155572 3300005471 Bacteria 2231
36 Ga0070699_100006602 3300005518 Bacteria 10086
37 Ga0070699_100205116 3300005518 Bacteria 1754
38 Ga0070699_100310711 3300005518 Bacteria 1415
39 Ga0070679_100000052 3300005530 Bacteria 85455
40 Ga0070697_100015332 3300005536 Bacteria 6015
41 Ga0070697_101321969 3300005536 Unclassified 643
42 Ga0068853_100235009 3300005539 Unclassified 1678
43 Ga0070672_100856546 3300005543 Bacteria 801
44 Ga0070695_100199821 3300005545 Bacteria 1428
45 Ga0070695_100212441 3300005545 Unclassified 1390
46 Ga0070695_100260976 3300005545 Bacteria 1265
47 Ga0070696_100026232 3300005546 Bacteria 3963
48 Ga0070696_100141181 3300005546 Bacteria 1761
49 Ga0070696_100282839 3300005546 Unclassified 1265
50 Ga0070696_100287763 3300005546 Unclassified 1254
51 Ga0070693_100008696 3300005547 Bacteria 5024
52 Ga0070704_100059259 3300005549 Bacteria 2730
53 Ga0070704_100362891 3300005549 Unclassified 1226
54 Ga0068855_101535329 3300005563 Unclassified 683
55 Ga0068857_100275229 3300005577 Bacteria 1548
56 Ga0068856_100026049 3300005614 Bacteria 5703
57 Ga0068852_100472827 3300005616 Unclassified 1244
58 Ga0068859_100057173 3300005617 Unclassified 3929
59 Ga0068859_100099465 3300005617 Bacteria 2964
60 Ga0068859_100586204 3300005617 Unclassified 1208
61 Ga0068864_100001404 3300005618 Bacteria 19927
62 Ga0068864_100009292 3300005618 Bacteria 8108
63 Ga0068866_10249837 3300005718 Bacteria 1084
64 Ga0068861_100118492 3300005719 Bacteria 2132
65 Ga0068851_10396258 3300005834 Bacteria 811
66 Ga0068870_10262626 3300005840 Unclassified 1075
67 Ga0068863_100510280 3300005841 Unclassified 1185
68 Ga0068858_100107620 3300005842 Unclassified 2603
69 Ga0068860_100129916 3300005843 Unclassified 2417
70 Ga0068860_100355161 3300005843 Unclassified 1443
71 Ga0068862_100160128 3300005844 Bacteria 2009
72 Ga0068862_100272567 3300005844 Unclassified 1548
73 Ga0097621_100020584 3300006237 Bacteria 5084
74 Ga0068871_100021066 3300006358 Bacteria 5004
75 Ga0068871_100574745 3300006358 Bacteria 1023
76 Ga0075433_10042300 3300006852 Unclassified 3952
77 Ga0075433_10098849 3300006852 Archaea 2583
78 Ga0075433_10267811 3300006852 Bacteria 1514
79 Ga0075434_100121621 3300006871 Bacteria 2626
80 Ga0075434_100157647 3300006871 Bacteria 2289
81 Ga0075434_100986593 3300006871 Archaea 856
82 Ga0075434_100986674 3300006871 Bacteria 856
83 Ga0068865_100145318 3300006881 Unclassified 1793
84 Ga0075436_100000006 3300006914 Bacteria 306066
85 Ga0097620_100057171 3300006931 Unclassified 3929
86 Ga0097620_100099165 3300006931 Bacteria 2968
87 Ga0097620_100099466 3300006931 Bacteria 2964
88 Ga0097620_100586205 3300006931 Unclassified 1208
89 Ga0075435_100005201 3300007076 Bacteria 9051
90 Ga0075435_100102805 3300007076 Bacteria 2369
91 Ga0111539_10118971 3300009094 Bacteria 3096
92 Ga0105245_10889808 3300009098 Bacteria 932
93 Ga0105245_11538822 3300009098 Archaea 716
94 Ga0105247_10035610 3300009101 Bacteria 3035
95 Ga0105247_10788525 3300009101 Bacteria 724
96 Ga0114129_10002714 3300009147 Bacteria 24652
97 Ga0114129_10011614 3300009147 Bacteria 12538
98 Ga0114129_10017313 3300009147 Bacteria 10260
99 Ga0114129_10094952 3300009147 Bacteria 4130
100 Ga0114129_10484076 3300009147 Bacteria 1619
101 Ga0114129_10507890 3300009147 Bacteria 1573
102 Ga0114129_10717708 3300009147 Bacteria 1283
103 Ga0114129_11155209 3300009147 Bacteria 967
104 Ga0105243_10000997 3300009148 Bacteria 26208
105 Ga0105241_10409594 3300009174 Bacteria 1191
106 Ga0105242_10003233 3300009176 Bacteria 12700
107 Ga0105242_10084747 3300009176 Unclassified 2656
108 Ga0105248_10012449 3300009177 Bacteria 9383
109 Ga0105248_10306432 3300009177 Bacteria 1789
110 Ga0105237_10185646 3300009545 Bacteria 2079
111 Ga0105237_10372999 3300009545 Bacteria 1432
112 Ga0105237_10939684 3300009545 Bacteria 872
113 Ga0105246_10186091 3300011119 Bacteria 1603
114 Ga0157373_10019599 3300013100 Bacteria 4920
115 Ga0157374_10855013 3300013296 Bacteria 927
116 Ga0157378_10000105 3300013297 Bacteria 79945
117 Ga0157378_10000878 3300013297 Bacteria 27758
118 Ga0157378_10391501 3300013297 Bacteria 1367
119 Ga0157378_10839408 3300013297 Bacteria 946
120 Ga0157378_11349161 3300013297 Unclassified 755
121 Ga0163162_10000838 3300013306 Bacteria 28591
122 Ga0157372_10341156 3300013307 Unclassified 1745
123 Ga0157372_10955845 3300013307 Bacteria 993
124 Ga0157375_10005309 3300013308 Bacteria 11193
125 Ga0157375_10019783 3300013308 Bacteria 6134
126 Ga0157375_10021009 3300013308 Bacteria 5977
127 Ga0157375_10069988 3300013308 Bacteria 3517
128 Ga0157375_10271643 3300013308 Bacteria 1858
129 Ga0157375_10452653 3300013308 Unclassified 1449
130 Ga0163163_10004068 3300014325 Bacteria 12470
131 Ga0163163_10025901 3300014325 Bacteria 5597
132 Ga0163163_10058369 3300014325 Unclassified 3815
133 Ga0157380_10362692 3300014326 Unclassified 1360
134 Ga0213876_10043588 3300021384 Bacteria 2371
135 Ga0207642_10595741 3300025899 Bacteria 687
136 Ga0207710_10043414 3300025900 Bacteria 2000
137 Ga0207647_10010740 3300025904 Bacteria 6449
138 Ga0207647_10236761 3300025904 Unclassified 1049
139 Ga0207699_10737400 3300025906 Unclassified 722
140 Ga0207645_10843063 3300025907 Bacteria 623
141 Ga0207643_10004165 3300025908 Bacteria 7796
142 Ga0207643_10423944 3300025908 Bacteria 844
143 Ga0207684_10027888 3300025910 Bacteria 4809
144 Ga0207684_10044076 3300025910 Bacteria 3783
145 Ga0207654_10608713 3300025911 Unclassified 780
146 Ga0207707_10000014 3300025912 Bacteria 261972
147 Ga0207707_10009199 3300025912 Bacteria 8578
148 Ga0207671_10144269 3300025914 Bacteria 1836
149 Ga0207671_10699786 3300025914 Unclassified 806
150 Ga0207660_10002404 3300025917 Bacteria 12302
151 Ga0207660_10817850 3300025917 Bacteria 760
152 Ga0207662_10093307 3300025918 Bacteria 1855
153 Ga0207652_10000031 3300025921 Bacteria 143723
154 Ga0207652_10126032 3300025921 Bacteria 2281
155 Ga0207652_11131000 3300025921 Unclassified 684
156 Ga0207646_10001642 3300025922 Bacteria 27334
157 Ga0207646_10037916 3300025922 Bacteria 4344
158 Ga0207681_10225764 3300025923 Bacteria 1451
159 Ga0207681_10364014 3300025923 Bacteria 1160
160 Ga0207650_10034185 3300025925 Bacteria 3686
161 Ga0207650_10054143 3300025925 Bacteria 2975
162 Ga0207650_10085556 3300025925 Bacteria 2399
163 Ga0207650_10231119 3300025925 Bacteria 1492
164 Ga0207687_10590510 3300025927 Bacteria 935
165 Ga0207706_10268770 3300025933 Bacteria 1488
166 Ga0207686_10003572 3300025934 Bacteria 8344
167 Ga0207709_10012776 3300025935 Bacteria 4630
168 Ga0207704_10085407 3300025938 Unclassified 2054
169 Ga0207691_10577067 3300025940 Bacteria 953
170 Ga0207691_10687721 3300025940 Bacteria 863
171 Ga0207711_10228101 3300025941 Bacteria 1705
172 Ga0207689_10024503 3300025942 Bacteria 5063
173 Ga0207689_10139146 3300025942 Bacteria 2000
174 Ga0207689_10282378 3300025942 Bacteria 1375
175 Ga0207667_11279251 3300025949 Unclassified 711
176 Ga0207651_10045057 3300025960 Bacteria 2956
177 Ga0207651_10171464 3300025960 Bacteria 1712
178 Ga0207640_10436334 3300025981 Unclassified 1076
179 Ga0207640_10540390 3300025981 Bacteria 977
180 Ga0207677_10068686 3300026023 Unclassified 2489
181 Ga0207639_10217148 3300026041 Unclassified 1649
182 Ga0207708_11097126 3300026075 Unclassified 694
183 Ga0207702_10017043 3300026078 Bacteria 6010
184 Ga0207641_10131192 3300026088 Archaea 2251
185 Ga0207641_10236628 3300026088 Bacteria 1700
186 Ga0207648_10120261 3300026089 Unclassified 2309
187 Ga0207676_10005219 3300026095 Bacteria 9196
188 Ga0207676_10006622 3300026095 Bacteria 8191
189 Ga0207676_10039859 3300026095 Bacteria 3596
190 Ga0207676_10119980 3300026095 Bacteria 2216
191 Ga0207674_10344524 3300026116 Bacteria 1441
192 Ga0207675_100234543 3300026118 Bacteria 1771
193 Ga0207675_100304452 3300026118 Unclassified 1553
194 Ga0207698_10175384 3300026142 Bacteria 1892
195 Ga0268266_10510244 3300028379 Bacteria 1149
196 Ga0268265_10257056 3300028380 Unclassified 1551
197 Ga0268264_10092190 3300028381 Unclassified 2614
198 Ga0268264_10123778 3300028381 Bacteria 2283
199 Ga0268264_10390641 3300028381 Unclassified 1335
200 Ga0316178_1045225 3300030735 Unclassified 845
201 Ga0307513_10004237 3300031456 Bacteria 19182
202 Ga0307405_10250049 3300031731 Bacteria 1319
203 Ga0307406_10135204 3300031901 Bacteria 1737
204 Ga0307412_10119542 3300031911 Bacteria 1895
205 Ga0307409_101283416 3300031995 Bacteria 757
206 Ga0307415_100304014 3300032126 Bacteria 1323
207 Ga0373937_0266130 3300036401 Bacteria 1617
208 Ga0436365_0375454 3300039437 Bacteria 5051
209 Ga0436365_1645286 3300039437 Bacteria 2462
210 Ga0436362_0305560 3300039453 Bacteria 1507
211 Ga0451835_1008308 3300041492 Bacteria 955
212 Ga0451576_0206760 3300045051 Unclassified 2050
213 Ga0451576_2099824 3300045051 Bacteria 581
214 Ga0495580_0381488 3300046472 Unclassified 952
215 Ga0495580_0496916 3300046472 Unclassified 815
216 Ga0495582_0377794 3300046473 Unclassified 817
217 Ga0496102_0040918 3300048905 Bacteria 4195
218 Ga0496104_0249605 3300048907 Bacteria 1687
219 Ga0496106_0032364 3300048909 Bacteria 3899
220 Ga0496106_0032790 3300048909 Bacteria 3874
221 Ga0496107_0331605 3300048910 Bacteria 1132
222 Ga0496112_0428275 3300048915 Bacteria 1262
223 Ga0496112_0457462 3300048915 Bacteria 1214
224 Ga0496112_0815499 3300048915 Unclassified 857
225 Ga0496112_0958972 3300048915 Bacteria 776
226 Ga0496113_0251265 3300048916 Unclassified 1412
227 Ga0496113_0277893 3300048916 Bacteria 1339
228 Ga0501296_023196 3300049519 Unclassified 803
229 Ga0501048_0287137 3300049582 Bacteria 1170
230 Ga0501209_108718 3300049656 Unclassified 817
231 Ga0501214_025585 3300049659 Unclassified 780
232 Ga0501223_017180 3300049663 Bacteria 1428
233 Ga0501224_005840 3300049664 Bacteria 1774
234 Ga0501228_011151 3300049666 Unclassified 906
235 Ga0501250_016215 3300049680 Unclassified 924
236 Ga0501257_044025 3300049686 Unclassified 1101
237 Ga0501225_0064042 3300049705 Bacteria 1037
238 Ga0501045_0552524 3300049824 Bacteria 854
239 nmdc:mga05p37_201857_c1 3300050507 Bacteria 2407
240 nmdc:mga05p37_237469_c1 3300050507 Bacteria 2193
241 nmdc:mga05p37_4872_c1 3300050507 Bacteria 15708
242 nmdc:mga05p37_510645_c1 3300050507 Bacteria 1377
243 nmdc:mga05p37_752834_c1 3300050507 Bacteria 1073
244 nmdc:mga05p37_801945_c1 3300050507 Bacteria 1030
245 nmdc:mga05p37_819284_c1 3300050507 Bacteria 1015
246 nmdc:mga05p37_9410_c1 3300050507 Bacteria 11566
247 nmdc:mga08y16_270996_c1 3300050511 Bacteria 1752
248 nmdc:mga0n895_137420_c1 3300050512 Bacteria 2471
249 nmdc:mga0n895_193287_c1 3300050512 Unclassified 2066
250 nmdc:mga0n895_30647_c1 3300050512 Bacteria 5142
251 nmdc:mga0n895_720005_c1 3300050512 Bacteria 993
252 nmdc:mga0rr50_1165557_c1 3300050513 Unclassified 655
253 nmdc:mga0rr50_2698_c1 3300050513 Bacteria 10067
254 nmdc:mga0rr50_6344_c2 3300050513 Bacteria 2750
255 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
256 nmdc:mga0a205_281429_c1 3300050515 Bacteria 1538
257 nmdc:mga0a205_398192_c1 3300050515 Archaea 1241
258 nmdc:mga0a205_88976_c1 3300050515 Bacteria 2278
259 Ga0105239_10010052
260 Ga0065712_10079128
261 Ga0065715_10187005
262 Ga0070670_100030865
263 Ga0070670_100136232
264 Ga0070670_100182340
265 Ga0070670_100588288
266 Ga0070670_100596174
267 Ga0068869_100028850
268 Ga0070666_10026839
269 Ga0070680_100012225
270 Ga0070680_100017203
271 Ga0070682_100850945
272 Ga0068868_100016455
273 Ga0070689_100436357
274 Ga0070687_100055177
275 Ga0070692_10208591
276 Ga0070669_100346847
277 Ga0070675_100201225
278 Ga0070671_100026361
279 Ga0070673_100067145
280 Ga0070659_100221401
281 Ga0070705_100111124
282 Ga0070700_100092585
283 Ga0070708_100000311
284 Ga0070681_10003300
285 Ga0068867_100148344
286 Ga0070685_10051876
287 Ga0070706_100018035
288 Ga0070706_100663393
289 Ga0070707_100033490
290 Ga0070707_100061717
291 Ga0070707_100344994
292 Ga0070698_100003912
293 Ga0070698_100155572
294 Ga0070699_100006602
295 Ga0070699_100205116
296 Ga0070699_100310711
297 Ga0070679_100000052
298 Ga0070697_100015332
299 Ga0070697_101321969
300 Ga0068853_100235009
301 Ga0070672_100856546
302 Ga0070695_100199821
303 Ga0070695_100212441
304 Ga0070695_100260976
305 Ga0070696_100026232
306 Ga0070696_100141181
307 Ga0070696_100282839
308 Ga0070696_100287763
309 Ga0070693_100008696
310 Ga0070704_100059259
311 Ga0070704_100362891
312 Ga0068855_101535329
313 Ga0068857_100275229
314 Ga0068856_100026049
315 Ga0068852_100472827
316 Ga0068859_100057173
317 Ga0068859_100099465
318 Ga0068859_100586204
319 Ga0068864_100001404
320 Ga0068864_100009292
321 Ga0068866_10249837
322 Ga0068861_100118492
323 Ga0068851_10396258
324 Ga0068870_10262626
325 Ga0068863_100510280
326 Ga0068858_100107620
327 Ga0068860_100129916
328 Ga0068860_100355161
329 Ga0068862_100160128
330 Ga0068862_100272567
331 Ga0097621_100020584
332 Ga0068871_100021066
333 Ga0068871_100574745
334 Ga0075433_10042300
335 Ga0075433_10098849
336 Ga0075433_10267811
337 Ga0075434_100121621
338 Ga0075434_100157647
339 Ga0075434_100986593
340 Ga0075434_100986674
341 Ga0068865_100145318
342 Ga0075436_100000006
343 Ga0097620_100057171
344 Ga0097620_100099165
345 Ga0097620_100099466
346 Ga0097620_100586205
347 Ga0075435_100005201
348 Ga0075435_100102805
349 Ga0111539_10118971
350 Ga0105245_10889808
351 Ga0105245_11538822
352 Ga0105247_10035610
353 Ga0105247_10788525
354 Ga0114129_10002714
355 Ga0114129_10011614
356 Ga0114129_10017313
357 Ga0114129_10094952
358 Ga0114129_10484076
359 Ga0114129_10507890
360 Ga0114129_10717708
361 Ga0114129_11155209
362 Ga0105243_10000997
363 Ga0105241_10409594
364 Ga0105242_10003233
365 Ga0105242_10084747
366 Ga0105248_10012449
367 Ga0105248_10306432
368 Ga0105237_10185646
369 Ga0105237_10372999
370 Ga0105237_10939684
371 Ga0105246_10186091
372 Ga0157373_10019599
373 Ga0157374_10855013
374 Ga0157378_10000105
375 Ga0157378_10000878
376 Ga0157378_10391501
377 Ga0157378_10839408
378 Ga0157378_11349161
379 Ga0163162_10000838
380 Ga0157372_10341156
381 Ga0157372_10955845
382 Ga0157375_10005309
383 Ga0157375_10019783
384 Ga0157375_10021009
385 Ga0157375_10069988
386 Ga0157375_10271643
387 Ga0157375_10452653
388 Ga0163163_10004068
389 Ga0163163_10025901
390 Ga0163163_10058369
391 Ga0157380_10362692
392 Ga0213876_10043588
393 Ga0207642_10595741
394 Ga0207710_10043414
395 Ga0207647_10010740
396 Ga0207647_10236761
397 Ga0207699_10737400
398 Ga0207645_10843063
399 Ga0207643_10004165
400 Ga0207643_10423944
401 Ga0207684_10027888
402 Ga0207684_10044076
403 Ga0207654_10608713
404 Ga0207707_10000014
405 Ga0207707_10009199
406 Ga0207671_10144269
407 Ga0207671_10699786
408 Ga0207660_10002404
409 Ga0207660_10817850
410 Ga0207662_10093307
411 Ga0207652_10000031
412 Ga0207652_10126032
413 Ga0207652_11131000
414 Ga0207646_10001642
415 Ga0207646_10037916
416 Ga0207681_10225764
417 Ga0207681_10364014
418 Ga0207650_10034185
419 Ga0207650_10054143
420 Ga0207650_10085556
421 Ga0207650_10231119
422 Ga0207687_10590510
423 Ga0207706_10268770
424 Ga0207686_10003572
425 Ga0207709_10012776
426 Ga0207704_10085407
427 Ga0207691_10577067
428 Ga0207691_10687721
429 Ga0207711_10228101
430 Ga0207689_10024503
431 Ga0207689_10139146
432 Ga0207689_10282378
433 Ga0207667_11279251
434 Ga0207651_10045057
435 Ga0207651_10171464
436 Ga0207640_10436334
437 Ga0207640_10540390
438 Ga0207677_10068686
439 Ga0207639_10217148
440 Ga0207708_11097126
441 Ga0207702_10017043
442 Ga0207641_10131192
443 Ga0207641_10236628
444 Ga0207648_10120261
445 Ga0207676_10005219
446 Ga0207676_10006622
447 Ga0207676_10039859
448 Ga0207676_10119980
449 Ga0207674_10344524
450 Ga0207675_100234543
451 Ga0207675_100304452
452 Ga0207698_10175384
453 Ga0268266_10510244
454 Ga0268265_10257056
455 Ga0268264_10092190
456 Ga0268264_10123778
457 Ga0268264_10390641
458 Ga0316178_1045225
459 Ga0307513_10004237
460 Ga0307405_10250049
461 Ga0307406_10135204
462 Ga0307412_10119542
463 Ga0307409_101283416
464 Ga0307415_100304014
465 Ga0373937_0266130
466 Ga0436365_0375454
467 Ga0436365_1645286
468 Ga0436362_0305560
469 Ga0451835_1008308
470 Ga0451576_0206760
471 Ga0451576_2099824
472 Ga0495580_0381488
473 Ga0495580_0496916
474 Ga0495582_0377794
475 Ga0496102_0040918
476 Ga0496104_0249605
477 Ga0496106_0032364
478 Ga0496106_0032790
479 Ga0496107_0331605
480 Ga0496112_0428275
481 Ga0496112_0457462
482 Ga0496112_0815499
483 Ga0496112_0958972
484 Ga0496113_0251265
485 Ga0496113_0277893
486 Ga0501296_023196
487 Ga0501048_0287137
488 Ga0501209_108718
489 Ga0501214_025585
490 Ga0501223_017180
491 Ga0501224_005840
492 Ga0501228_011151
493 Ga0501250_016215
494 Ga0501257_044025
495 Ga0501225_0064042
496 Ga0501045_0552524
497 nmdc:mga05p37_201857_c1
498 nmdc:mga05p37_237469_c1
499 nmdc:mga05p37_4872_c1
500 nmdc:mga05p37_510645_c1
501 nmdc:mga05p37_752834_c1
502 nmdc:mga05p37_801945_c1
503 nmdc:mga05p37_819284_c1
504 nmdc:mga05p37_9410_c1
505 nmdc:mga08y16_270996_c1
506 nmdc:mga0n895_137420_c1
507 nmdc:mga0n895_193287_c1
508 nmdc:mga0n895_30647_c1
509 nmdc:mga0n895_720005_c1
510 nmdc:mga0rr50_1165557_c1
511 nmdc:mga0rr50_2698_c1
512 nmdc:mga0rr50_6344_c2
513 nmdc:mga08x19_13_c1
514 nmdc:mga0a205_281429_c1
515 nmdc:mga0a205_398192_c1
516 nmdc:mga0a205_88976_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

14

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.8025 5 179
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.7947 2 180
2fzv-assembly1.cif.gz_B crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.7816 1 187
2fzv-assembly1.cif.gz_A crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.7773 1 187
2fzv-assembly1.cif.gz_B crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.7744 1 187
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7768 8 136 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7528 1 187 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7471 8 180 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.746 1 187 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7384 2 187 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2V6J946-F1-model_v4 NADPH-dependent FMN reductase 0.9469 5 76
AF-A0A3B9LZE1-F1-model_v4 NADPH-dependent FMN reductase 0.9411 4 91 GO:0005829
GO:0010181
GO:0016491
AF-A0A1Y0RH12-F1-model_v4 NADPH-dependent FMN reductase 0.8864 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A534QA18-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.8858 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A3B9LZE1-F1-model_v4 NADPH-dependent FMN reductase 0.8834 4 91 GO:0005829
GO:0010181
GO:0016491

Map