F368006

General Info

Members Datasets Scaffolds Average Seq Length
258 144 516 324

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10219149|Ga0075433_102191492
Length 344
Sequence MLRCPWPGRWWSLWRSARLPGSMRRIGLAVVLTLSXXXALFAAEGQQTGKRVPRIGFLASFSAEVIKSRVAAFQQALRELGYVDGESIIIEYRYAEGKFERLPDLAAELVRLRVDLLVVAGAPAAHAAKNATSVIPIVIGNAADPVGTGLVASLARPGGNITGLSDFNTGVVTKRLELLKQVVPTASRVAVLLNPAQLKEIQAAAPALGVTLLALEAKRPDDIDRAFAVMRTERPGALIVLGDPAFVTHQRRIAELAVKSRLPAIWAVRENVNAGGLMSYGTDFDGLYRRAAYFVDKILKGAKPADLPVEQPTKFEFVINLKTAKALGLTIPPSVLGRADQVIQ

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.55
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 20.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10219149 3300006852 Bacteria 1690
2 Ga0065712_10000663 3300005290 Bacteria 9864
3 Ga0065715_10123803 3300005293 Bacteria 2169
4 Ga0070676_10011368 3300005328 Bacteria 4840
5 Ga0070690_100073879 3300005330 Bacteria 2219
6 Ga0070670_100079260 3300005331 Bacteria 2822
7 Ga0070670_100131053 3300005331 Unclassified 2165
8 Ga0068869_100002559 3300005334 Bacteria 10978
9 Ga0070666_10053040 3300005335 Bacteria 2734
10 Ga0070660_100017438 3300005339 Bacteria 5234
11 Ga0070689_100251056 3300005340 Bacteria 1459
12 Ga0070668_100071908 3300005347 Unclassified 2694
13 Ga0070669_100014694 3300005353 Bacteria 5573
14 Ga0070669_100059880 3300005353 Bacteria 2796
15 Ga0070669_100415095 3300005353 Bacteria 1104
16 Ga0070675_100105077 3300005354 Bacteria 2383
17 Ga0070675_100252498 3300005354 Bacteria 1544
18 Ga0070674_100012614 3300005356 Bacteria 5194
19 Ga0070667_100000996 3300005367 Bacteria 26008
20 Ga0070708_100064009 3300005445 Bacteria 3293
21 Ga0070678_100038364 3300005456 Bacteria 3372
22 Ga0070662_100020618 3300005457 Bacteria 4493
23 Ga0070662_100090680 3300005457 Bacteria 2295
24 Ga0068867_100021213 3300005459 Bacteria 4634
25 Ga0070706_100081148 3300005467 Bacteria 3003
26 Ga0070706_100301559 3300005467 Archaea 1495
27 Ga0070707_100026853 3300005468 Bacteria 5470
28 Ga0070707_100051525 3300005468 Bacteria 3946
29 Ga0070698_100400043 3300005471 Bacteria 1307
30 Ga0070699_100083153 3300005518 Bacteria 2792
31 Ga0070699_100128175 3300005518 Bacteria 2236
32 Ga0070699_100165580 3300005518 Archaea 1958
33 Ga0070699_100408376 3300005518 Bacteria 1228
34 Ga0070697_100128513 3300005536 Unclassified 2123
35 Ga0070697_100386628 3300005536 Bacteria 1212
36 Ga0070672_100197120 3300005543 Bacteria 1683
37 Ga0070696_100202123 3300005546 Bacteria 1484
38 Ga0070665_100162971 3300005548 Unclassified 2232
39 Ga0070665_100355512 3300005548 Unclassified 1470
40 Ga0068855_100181720 3300005563 Unclassified 2377
41 Ga0070664_100064103 3300005564 Bacteria 3134
42 Ga0068857_100024263 3300005577 Bacteria 5337
43 Ga0068856_100019737 3300005614 Bacteria 6541
44 Ga0068859_100004308 3300005617 Bacteria 14509
45 Ga0068859_100052417 3300005617 Bacteria 4102
46 Ga0068864_100031285 3300005618 Unclassified 4515
47 Ga0068864_100047522 3300005618 Unclassified 3686
48 Ga0068864_100076171 3300005618 Bacteria 2930
49 Ga0068861_100022054 3300005719 Unclassified 4583
50 Ga0068858_100041650 3300005842 Unclassified 4258
51 Ga0068860_100002975 3300005843 Bacteria 17502
52 Ga0068860_100126410 3300005843 Bacteria 2450
53 Ga0068862_100011414 3300005844 Bacteria 7333
54 Ga0068862_100389335 3300005844 Bacteria 1302
55 Ga0081455_10000509 3300005937 Bacteria 50414
56 Ga0081455_10016147 3300005937 Bacteria 7219
57 Ga0081455_10057274 3300005937 Bacteria 3303
58 Ga0081538_10039735 3300005981 Unclassified 3012
59 Ga0081540_1008554 3300005983 Bacteria 7140
60 Ga0075432_10098130 3300006058 Bacteria 1080
61 Ga0075428_100025613 3300006844 Bacteria 6532
62 Ga0075428_100027570 3300006844 Bacteria 6284
63 Ga0075428_100037628 3300006844 Bacteria 5325
64 Ga0075428_100112342 3300006844 Bacteria 2967
65 Ga0075430_100148175 3300006846 Unclassified 1954
66 Ga0075431_100078027 3300006847 Bacteria 3419
67 Ga0075431_100096250 3300006847 Bacteria 3056
68 Ga0075431_100143137 3300006847 Unclassified 2464
69 Ga0075431_100380625 3300006847 Unclassified 1415
70 Ga0075433_10023114 3300006852 Bacteria 5229
71 Ga0075433_10055590 3300006852 Bacteria 3455
72 Ga0075433_10076920 3300006852 Unclassified 2939
73 Ga0075433_10085455 3300006852 Bacteria 2785
74 Ga0075433_10299286 3300006852 Unclassified 1424
75 Ga0075434_100037331 3300006871 Bacteria 4810
76 Ga0075434_100054113 3300006871 Bacteria 3987
77 Ga0075434_100085442 3300006871 Bacteria 3154
78 Ga0075434_100112589 3300006871 Bacteria 2733
79 Ga0075429_100017512 3300006880 Bacteria 6195
80 Ga0075429_100078418 3300006880 Bacteria 2879
81 Ga0075436_100028701 3300006914 Bacteria 3827
82 Ga0075436_100214811 3300006914 Bacteria 1364
83 Ga0097620_100004308 3300006931 Bacteria 14509
84 Ga0097620_100052417 3300006931 Bacteria 4102
85 Ga0075435_100036777 3300007076 Bacteria 3893
86 Ga0075435_100037033 3300007076 Bacteria 3882
87 Ga0075435_100051369 3300007076 Unclassified 3321
88 Ga0075435_100167864 3300007076 Bacteria 1851
89 Ga0075435_100264002 3300007076 Bacteria 1467
90 Ga0075435_100280510 3300007076 Bacteria 1422
91 Ga0075435_100284574 3300007076 Unclassified 1412
92 Ga0105240_10148071 3300009093 Bacteria 2799
93 Ga0111539_10116059 3300009094 Bacteria 3139
94 Ga0111539_10167438 3300009094 Unclassified 2568
95 Ga0111539_10331913 3300009094 Bacteria 1770
96 Ga0111539_10414403 3300009094 Bacteria 1569
97 Ga0111539_10439739 3300009094 Bacteria 1519
98 Ga0111539_10499272 3300009094 Unclassified 1417
99 Ga0105245_10043591 3300009098 Unclassified 4002
100 Ga0105245_10138303 3300009098 Unclassified 2291
101 Ga0105247_10082599 3300009101 Unclassified 2028
102 Ga0105247_10111680 3300009101 Bacteria 1760
103 Ga0114129_10018134 3300009147 Bacteria 10024
104 Ga0114129_10039417 3300009147 Bacteria 6660
105 Ga0114129_10069930 3300009147 Bacteria 4894
106 Ga0114129_10250204 3300009147 Bacteria 2379
107 Ga0114129_10296040 3300009147 Bacteria 2158
108 Ga0114129_10664461 3300009147 Unclassified 1343
109 Ga0114129_10712182 3300009147 Bacteria 1289
110 Ga0105248_10067917 3300009177 Bacteria 4003
111 Ga0105237_10052541 3300009545 Bacteria 4090
112 Ga0105238_10017302 3300009551 Bacteria 7324
113 Ga0105238_10097007 3300009551 Bacteria 2934
114 Ga0105246_10439030 3300011119 Unclassified 1094
115 Ga0157378_10144628 3300013297 Bacteria 2211
116 Ga0157378_10329916 3300013297 Unclassified 1485
117 Ga0163162_10044181 3300013306 Bacteria 4462
118 Ga0163162_10219411 3300013306 Bacteria 2032
119 Ga0163162_10408357 3300013306 Bacteria 1491
120 Ga0163162_10537026 3300013306 Bacteria 1298
121 Ga0157372_10427407 3300013307 Unclassified 1544
122 Ga0157377_10191129 3300014745 Unclassified 1294
123 Ga0157379_10000592 3300014968 Bacteria 29338
124 Ga0163161_10252541 3300017792 Bacteria 1375
125 Ga0207688_10115160 3300025901 Unclassified 1564
126 Ga0207645_10017615 3300025907 Bacteria 4711
127 Ga0207643_10012334 3300025908 Unclassified 4620
128 Ga0207684_10008130 3300025910 Bacteria 9352
129 Ga0207657_10042854 3300025919 Bacteria 3990
130 Ga0207657_10311924 3300025919 Bacteria 1245
131 Ga0207646_10016690 3300025922 Bacteria 6887
132 Ga0207646_10045274 3300025922 Bacteria 3950
133 Ga0207646_10227069 3300025922 Bacteria 1687
134 Ga0207694_10065632 3300025924 Bacteria 2830
135 Ga0207650_10029967 3300025925 Unclassified 3916
136 Ga0207659_10025084 3300025926 Bacteria 4001
137 Ga0207659_10248486 3300025926 Bacteria 1442
138 Ga0207687_10035119 3300025927 Bacteria 3409
139 Ga0207644_10142485 3300025931 Bacteria 1847
140 Ga0207706_10004434 3300025933 Bacteria 13192
141 Ga0207706_10030474 3300025933 Bacteria 4811
142 Ga0207706_10285272 3300025933 Bacteria 1440
143 Ga0207686_10063634 3300025934 Bacteria 2346
144 Ga0207709_10205612 3300025935 Unclassified 1409
145 Ga0207669_10008988 3300025937 Bacteria 4726
146 Ga0207711_10061668 3300025941 Bacteria 3234
147 Ga0207689_10000316 3300025942 Bacteria 44720
148 Ga0207679_10408101 3300025945 Bacteria 1196
149 Ga0207651_10159224 3300025960 Bacteria 1768
150 Ga0207712_10180291 3300025961 Unclassified 1658
151 Ga0207668_10111172 3300025972 Unclassified 2056
152 Ga0207677_10031786 3300026023 Unclassified 3384
153 Ga0207703_10002646 3300026035 Bacteria 15431
154 Ga0207703_10059049 3300026035 Unclassified 3133
155 Ga0207708_10250442 3300026075 Unclassified 1427
156 Ga0207702_10281489 3300026078 Bacteria 1572
157 Ga0207641_10253071 3300026088 Bacteria 1646
158 Ga0207648_10005094 3300026089 Bacteria 13316
159 Ga0207648_10156936 3300026089 Bacteria 2009
160 Ga0207648_10243086 3300026089 Unclassified 1603
161 Ga0207676_10038406 3300026095 Bacteria 3654
162 Ga0207676_10044142 3300026095 Bacteria 3437
163 Ga0207674_10011528 3300026116 Bacteria 9930
164 Ga0207675_100000936 3300026118 Bacteria 29197
165 Ga0207683_10062486 3300026121 Bacteria 3279
166 Ga0207428_10020337 3300027907 Bacteria 5640
167 Ga0207428_10081025 3300027907 Bacteria 2535
168 Ga0207428_10082969 3300027907 Bacteria 2500
169 Ga0207428_10213719 3300027907 Unclassified 1448
170 Ga0268265_10087757 3300028380 Bacteria 2476
171 Ga0268265_10122735 3300028380 Unclassified 2143
172 Ga0268264_10000595 3300028381 Bacteria 43795
173 Ga0268264_10409900 3300028381 Bacteria 1304
174 Ga0265325_10002573 3300031241 Bacteria 12169
175 Ga0307409_100150793 3300031995 Bacteria 2018
176 Ga0373929_0017497 3300035085 Bacteria 1416
177 Ga0373953_0047103 3300035117 Bacteria 1734
178 Ga0373931_0044480 3300035691 Bacteria 2342
179 Ga0451577_0122430 3300042876 Unclassified 2330
180 Ga0453684_0065198 3300044712 Unclassified 4646
181 Ga0495598_0063890 3300046537 Bacteria 1142
182 Ga0495634_0107702 3300046642 Bacteria 1795
183 Ga0495635_0021839 3300046663 Bacteria 4461
184 Ga0495670_0054174 3300046691 Bacteria 2009
185 Ga0495602_0088765 3300048088 Bacteria 2573
186 Ga0496106_0085416 3300048909 Unclassified 2430
187 Ga0496109_0515226 3300048912 Bacteria 1129
188 Ga0496112_0543569 3300048915 Unclassified 1096
189 Ga0496115_0222938 3300048918 Bacteria 1556
190 Ga0501038_0008432 3300049574 Bacteria 9481
191 Ga0501040_0022107 3300049576 Bacteria 4254
192 Ga0501041_0001280 3300049577 Bacteria 13834
193 Ga0501042_0016776 3300049578 Bacteria 5036
194 Ga0501043_0061971 3300049579 Bacteria 2937
195 Ga0501048_0039331 3300049582 Bacteria 3393
196 Ga0501068_0045100 3300049584 Bacteria 2656
197 Ga0501071_0161441 3300049587 Bacteria 1675
198 Ga0501072_0003171 3300049588 Bacteria 12370
199 Ga0501074_0071849 3300049590 Bacteria 2487
200 Ga0501075_0043906 3300049591 Bacteria 3352
201 Ga0501076_0000236 3300049592 Bacteria 33820
202 Ga0501076_0083509 3300049592 Bacteria 2565
203 Ga0501077_0009244 3300049593 Bacteria 6119
204 Ga0501079_0001897 3300049741 Bacteria 14979
205 Ga0501080_0002195 3300049742 Bacteria 16955
206 Ga0501081_0000229 3300049743 Bacteria 28210
207 Ga0501083_0036102 3300049744 Bacteria 3373
208 Ga0501045_0073292 3300049824 Bacteria 2521
209 nmdc:mga05p37_150978_c1 3300050507 Bacteria 2842
210 nmdc:mga05p37_200457_c1 3300050507 Bacteria 2418
211 nmdc:mga05p37_217583_c1 3300050507 Bacteria 2307
212 nmdc:mga05p37_271708_c1 3300050507 Bacteria 2025
213 nmdc:mga05p37_42406_c1 3300050507 Bacteria 5591
214 nmdc:mga05p37_48202_c1 3300050507 Bacteria 5241
215 nmdc:mga05p37_604934_c1 3300050507 Bacteria 1237
216 nmdc:mga05p37_68710_c1 3300050507 Bacteria 4357
217 nmdc:mga09592_14698_c1 3300050508 Bacteria 6388
218 nmdc:mga09592_357216_c1 3300050508 Unclassified 1264
219 nmdc:mga09592_98357_c1 3300050508 Bacteria 2505
220 nmdc:mga0qj67_170537_c1 3300050509 Unclassified 1767
221 nmdc:mga0qj67_199455_c1 3300050509 Bacteria 1626
222 nmdc:mga06r32_124724_c1 3300050510 Unclassified 2543
223 nmdc:mga06r32_23678_c1 3300050510 Bacteria 5686
224 nmdc:mga06r32_50621_c1 3300050510 Bacteria 3973
225 nmdc:mga06r32_591043_c1 3300050510 Bacteria 1081
226 nmdc:mga06r32_77282_c1 3300050510 Bacteria 3233
227 nmdc:mga06r32_78616_c1 3300050510 Unclassified 3207
228 nmdc:mga08y16_178580_c1 3300050511 Unclassified 2205
229 nmdc:mga08y16_326533_c1 3300050511 Bacteria 1579
230 nmdc:mga08y16_37069_c1 3300050511 Bacteria 5120
231 nmdc:mga0n895_122984_c1 3300050512 Bacteria 2617
232 nmdc:mga0n895_143283_c1 3300050512 Bacteria 2419
233 nmdc:mga0n895_156727_c1 3300050512 Bacteria 2308
234 nmdc:mga0n895_16664_c1 3300050512 Bacteria 6749
235 nmdc:mga0n895_17696_c1 3300050512 Bacteria 6576
236 nmdc:mga0n895_413560_c1 3300050512 Bacteria 1364
237 nmdc:mga0n895_70032_c1 3300050512 Bacteria 3476
238 nmdc:mga0rr50_122573_c1 3300050513 Bacteria 2071
239 nmdc:mga0rr50_211537_c1 3300050513 Unclassified 1598
240 nmdc:mga0rr50_332418_c1 3300050513 Bacteria 1276
241 nmdc:mga0rr50_349393_c1 3300050513 Unclassified 1243
242 nmdc:mga0rr50_59224_c1 3300050513 Bacteria 2874
243 nmdc:mga08x19_148154_c1 3300050514 Bacteria 1588
244 nmdc:mga08x19_33437_c1 3300050514 Bacteria 3245
245 nmdc:mga08x19_58239_c1 3300050514 Bacteria 2498
246 nmdc:mga08x19_67882_c1 3300050514 Bacteria 2320
247 nmdc:mga08x19_98729_c1 3300050514 Bacteria 1935
248 nmdc:mga0a205_158630_c1 3300050515 Bacteria 2160
249 nmdc:mga0a205_18729_c1 3300050515 Bacteria 6516
250 nmdc:mga0a205_202321_c1 3300050515 Bacteria 1876
251 nmdc:mga0a205_247214_c1 3300050515 Bacteria 1664
252 nmdc:mga0a205_28683_c1 3300050515 Bacteria 5323
253 nmdc:mga0a205_43123_c1 3300050515 Unclassified 4350
254 nmdc:mga0a205_55878_c1 3300050515 Bacteria 3812
255 nmdc:mga0a205_93912_c1 3300050515 Unclassified 2898
256 Ga0495595_0195043 3300053084 Bacteria 1007
257 Ga0501082_0052935 3300060353 Bacteria 3499
258 Ga0530510_0002534 3300061734 Bacteria 12552
259 Ga0075433_10219149
260 Ga0065712_10000663
261 Ga0065715_10123803
262 Ga0070676_10011368
263 Ga0070690_100073879
264 Ga0070670_100079260
265 Ga0070670_100131053
266 Ga0068869_100002559
267 Ga0070666_10053040
268 Ga0070660_100017438
269 Ga0070689_100251056
270 Ga0070668_100071908
271 Ga0070669_100014694
272 Ga0070669_100059880
273 Ga0070669_100415095
274 Ga0070675_100105077
275 Ga0070675_100252498
276 Ga0070674_100012614
277 Ga0070667_100000996
278 Ga0070708_100064009
279 Ga0070678_100038364
280 Ga0070662_100020618
281 Ga0070662_100090680
282 Ga0068867_100021213
283 Ga0070706_100081148
284 Ga0070706_100301559
285 Ga0070707_100026853
286 Ga0070707_100051525
287 Ga0070698_100400043
288 Ga0070699_100083153
289 Ga0070699_100128175
290 Ga0070699_100165580
291 Ga0070699_100408376
292 Ga0070697_100128513
293 Ga0070697_100386628
294 Ga0070672_100197120
295 Ga0070696_100202123
296 Ga0070665_100162971
297 Ga0070665_100355512
298 Ga0068855_100181720
299 Ga0070664_100064103
300 Ga0068857_100024263
301 Ga0068856_100019737
302 Ga0068859_100004308
303 Ga0068859_100052417
304 Ga0068864_100031285
305 Ga0068864_100047522
306 Ga0068864_100076171
307 Ga0068861_100022054
308 Ga0068858_100041650
309 Ga0068860_100002975
310 Ga0068860_100126410
311 Ga0068862_100011414
312 Ga0068862_100389335
313 Ga0081455_10000509
314 Ga0081455_10016147
315 Ga0081455_10057274
316 Ga0081538_10039735
317 Ga0081540_1008554
318 Ga0075432_10098130
319 Ga0075428_100025613
320 Ga0075428_100027570
321 Ga0075428_100037628
322 Ga0075428_100112342
323 Ga0075430_100148175
324 Ga0075431_100078027
325 Ga0075431_100096250
326 Ga0075431_100143137
327 Ga0075431_100380625
328 Ga0075433_10023114
329 Ga0075433_10055590
330 Ga0075433_10076920
331 Ga0075433_10085455
332 Ga0075433_10299286
333 Ga0075434_100037331
334 Ga0075434_100054113
335 Ga0075434_100085442
336 Ga0075434_100112589
337 Ga0075429_100017512
338 Ga0075429_100078418
339 Ga0075436_100028701
340 Ga0075436_100214811
341 Ga0097620_100004308
342 Ga0097620_100052417
343 Ga0075435_100036777
344 Ga0075435_100037033
345 Ga0075435_100051369
346 Ga0075435_100167864
347 Ga0075435_100264002
348 Ga0075435_100280510
349 Ga0075435_100284574
350 Ga0105240_10148071
351 Ga0111539_10116059
352 Ga0111539_10167438
353 Ga0111539_10331913
354 Ga0111539_10414403
355 Ga0111539_10439739
356 Ga0111539_10499272
357 Ga0105245_10043591
358 Ga0105245_10138303
359 Ga0105247_10082599
360 Ga0105247_10111680
361 Ga0114129_10018134
362 Ga0114129_10039417
363 Ga0114129_10069930
364 Ga0114129_10250204
365 Ga0114129_10296040
366 Ga0114129_10664461
367 Ga0114129_10712182
368 Ga0105248_10067917
369 Ga0105237_10052541
370 Ga0105238_10017302
371 Ga0105238_10097007
372 Ga0105246_10439030
373 Ga0157378_10144628
374 Ga0157378_10329916
375 Ga0163162_10044181
376 Ga0163162_10219411
377 Ga0163162_10408357
378 Ga0163162_10537026
379 Ga0157372_10427407
380 Ga0157377_10191129
381 Ga0157379_10000592
382 Ga0163161_10252541
383 Ga0207688_10115160
384 Ga0207645_10017615
385 Ga0207643_10012334
386 Ga0207684_10008130
387 Ga0207657_10042854
388 Ga0207657_10311924
389 Ga0207646_10016690
390 Ga0207646_10045274
391 Ga0207646_10227069
392 Ga0207694_10065632
393 Ga0207650_10029967
394 Ga0207659_10025084
395 Ga0207659_10248486
396 Ga0207687_10035119
397 Ga0207644_10142485
398 Ga0207706_10004434
399 Ga0207706_10030474
400 Ga0207706_10285272
401 Ga0207686_10063634
402 Ga0207709_10205612
403 Ga0207669_10008988
404 Ga0207711_10061668
405 Ga0207689_10000316
406 Ga0207679_10408101
407 Ga0207651_10159224
408 Ga0207712_10180291
409 Ga0207668_10111172
410 Ga0207677_10031786
411 Ga0207703_10002646
412 Ga0207703_10059049
413 Ga0207708_10250442
414 Ga0207702_10281489
415 Ga0207641_10253071
416 Ga0207648_10005094
417 Ga0207648_10156936
418 Ga0207648_10243086
419 Ga0207676_10038406
420 Ga0207676_10044142
421 Ga0207674_10011528
422 Ga0207675_100000936
423 Ga0207683_10062486
424 Ga0207428_10020337
425 Ga0207428_10081025
426 Ga0207428_10082969
427 Ga0207428_10213719
428 Ga0268265_10087757
429 Ga0268265_10122735
430 Ga0268264_10000595
431 Ga0268264_10409900
432 Ga0265325_10002573
433 Ga0307409_100150793
434 Ga0373929_0017497
435 Ga0373953_0047103
436 Ga0373931_0044480
437 Ga0451577_0122430
438 Ga0453684_0065198
439 Ga0495598_0063890
440 Ga0495634_0107702
441 Ga0495635_0021839
442 Ga0495670_0054174
443 Ga0495602_0088765
444 Ga0496106_0085416
445 Ga0496109_0515226
446 Ga0496112_0543569
447 Ga0496115_0222938
448 Ga0501038_0008432
449 Ga0501040_0022107
450 Ga0501041_0001280
451 Ga0501042_0016776
452 Ga0501043_0061971
453 Ga0501048_0039331
454 Ga0501068_0045100
455 Ga0501071_0161441
456 Ga0501072_0003171
457 Ga0501074_0071849
458 Ga0501075_0043906
459 Ga0501076_0000236
460 Ga0501076_0083509
461 Ga0501077_0009244
462 Ga0501079_0001897
463 Ga0501080_0002195
464 Ga0501081_0000229
465 Ga0501083_0036102
466 Ga0501045_0073292
467 nmdc:mga05p37_150978_c1
468 nmdc:mga05p37_200457_c1
469 nmdc:mga05p37_217583_c1
470 nmdc:mga05p37_271708_c1
471 nmdc:mga05p37_42406_c1
472 nmdc:mga05p37_48202_c1
473 nmdc:mga05p37_604934_c1
474 nmdc:mga05p37_68710_c1
475 nmdc:mga09592_14698_c1
476 nmdc:mga09592_357216_c1
477 nmdc:mga09592_98357_c1
478 nmdc:mga0qj67_170537_c1
479 nmdc:mga0qj67_199455_c1
480 nmdc:mga06r32_124724_c1
481 nmdc:mga06r32_23678_c1
482 nmdc:mga06r32_50621_c1
483 nmdc:mga06r32_591043_c1
484 nmdc:mga06r32_77282_c1
485 nmdc:mga06r32_78616_c1
486 nmdc:mga08y16_178580_c1
487 nmdc:mga08y16_326533_c1
488 nmdc:mga08y16_37069_c1
489 nmdc:mga0n895_122984_c1
490 nmdc:mga0n895_143283_c1
491 nmdc:mga0n895_156727_c1
492 nmdc:mga0n895_16664_c1
493 nmdc:mga0n895_17696_c1
494 nmdc:mga0n895_413560_c1
495 nmdc:mga0n895_70032_c1
496 nmdc:mga0rr50_122573_c1
497 nmdc:mga0rr50_211537_c1
498 nmdc:mga0rr50_332418_c1
499 nmdc:mga0rr50_349393_c1
500 nmdc:mga0rr50_59224_c1
501 nmdc:mga08x19_148154_c1
502 nmdc:mga08x19_33437_c1
503 nmdc:mga08x19_58239_c1
504 nmdc:mga08x19_67882_c1
505 nmdc:mga08x19_98729_c1
506 nmdc:mga0a205_158630_c1
507 nmdc:mga0a205_18729_c1
508 nmdc:mga0a205_202321_c1
509 nmdc:mga0a205_247214_c1
510 nmdc:mga0a205_28683_c1
511 nmdc:mga0a205_43123_c1
512 nmdc:mga0a205_55878_c1
513 nmdc:mga0a205_93912_c1
514 Ga0495595_0195043
515 Ga0501082_0052935
516 Ga0530510_0002534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

54

343

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9532 27 323
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.947 27 323
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9396 29 324
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9368 31 324
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9306 31 324
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9426 27 295 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9365 27 295 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9052 147 324 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8876 147 324 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.885 31 295 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A521SLV5-F1-model_v4 ABC transporter substrate-binding protein 0.9765 57 325
AF-A0A1F3YG64-F1-model_v4 ABC transporter substrate-binding protein 0.9764 29 325
AF-A0A7C3JLF2-F1-model_v4 ABC transporter substrate-binding protein 0.9731 178 325
AF-A0A537TLH0-F1-model_v4 ABC transporter substrate-binding protein 0.9725 67 325
AF-A0A537VET5-F1-model_v4 ABC transporter substrate-binding protein 0.9704 31 325

Map