F367772

General Info

Members Datasets Scaffolds Average Seq Length
258 164 516 230

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10113083|rootH2_101130831
Length 270
Sequence VRLRSLLLGLGGLWLSACGPTVAPATGTGGGAARPPDFELPRLDGARILIVDDEPPIRRFLRTALTAQDYRIEEAGDGEAALEFLKRNPVDLVVLDLGLPGIDGLEVVRRLRAAGKTVPIIILSSRDDEAGKVAALDLGADDYVSKPFGMEELAARIRAALRHRLQQEGEKPIFRSADLSMDLVRRIVMVRGAEVKLTPREYDLLRMLVQHAGKVLTHKHILKEVWGGETDVQYLRIYIRTLRQKLEADPEQPGLILTEQGVGYRLRVTE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 0.39
Rhizoplane 1.16
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10113083 3300003320 Bacteria 1443
2 JGI25165J46597_1000209 3300003214 Bacteria 83865
3 JGI25153J46596_10002424 3300003215 Bacteria 10754
4 rootH1_10087280 3300003323 Bacteria 1024
5 Ga0070658_10172334 3300005327 Bacteria 1818
6 Ga0070683_100202906 3300005329 Bacteria 1883
7 Ga0070683_100298015 3300005329 Bacteria 1534
8 Ga0070683_100791723 3300005329 Bacteria 909
9 Ga0070690_100055135 3300005330 Bacteria 2545
10 Ga0070666_10002059 3300005335 Bacteria 12202
11 Ga0070680_100013731 3300005336 Bacteria 6317
12 Ga0068868_100344564 3300005338 Bacteria 1275
13 Ga0070660_100074522 3300005339 Bacteria 2656
14 Ga0070660_100244172 3300005339 Bacteria 1463
15 Ga0070660_100335238 3300005339 Bacteria 1244
16 Ga0070689_100270351 3300005340 Bacteria 1407
17 Ga0070661_100181478 3300005344 Bacteria 1601
18 Ga0070674_100248975 3300005356 Bacteria 1395
19 Ga0070659_100122900 3300005366 Bacteria 2104
20 Ga0070659_100139486 3300005366 Bacteria 1973
21 Ga0070667_100027948 3300005367 Bacteria 4694
22 Ga0070714_100086019 3300005435 Bacteria 2747
23 Ga0070714_100293432 3300005435 Bacteria 1514
24 Ga0070713_100270487 3300005436 Bacteria 1556
25 Ga0070711_100076940 3300005439 Bacteria 2367
26 Ga0070678_100024362 3300005456 Bacteria 4051
27 Ga0070662_100163745 3300005457 Bacteria 1741
28 Ga0070662_100671757 3300005457 Bacteria 875
29 Ga0070681_10058917 3300005458 Bacteria 3820
30 Ga0068867_100073123 3300005459 Bacteria 2567
31 Ga0070685_10088269 3300005466 Bacteria 1872
32 Ga0070679_100018334 3300005530 Bacteria 6790
33 Ga0070679_100033940 3300005530 Bacteria 5055
34 Ga0070679_100158991 3300005530 Bacteria 2234
35 Ga0070684_100053242 3300005535 Bacteria 3522
36 Ga0070684_100318794 3300005535 Bacteria 1428
37 Ga0068853_100409682 3300005539 Bacteria 1270
38 Ga0070686_100029072 3300005544 Bacteria 3358
39 Ga0070665_100000639 3300005548 Bacteria 47531
40 Ga0070665_100007969 3300005548 Bacteria 10736
41 Ga0070665_100073366 3300005548 Bacteria 3428
42 Ga0070665_100112976 3300005548 Bacteria 2719
43 Ga0070665_100113598 3300005548 Bacteria 2711
44 Ga0070665_100231304 3300005548 Bacteria 1848
45 Ga0068855_100011896 3300005563 Bacteria 10520
46 Ga0068855_100129671 3300005563 Bacteria 2881
47 Ga0068855_100145391 3300005563 Bacteria 2699
48 Ga0068855_100153421 3300005563 Bacteria 2618
49 Ga0068855_100302311 3300005563 Bacteria 1772
50 Ga0068857_100145661 3300005577 Bacteria 2143
51 Ga0068852_100177840 3300005616 Bacteria 1999
52 Ga0068859_100102395 3300005617 Bacteria 2921
53 Ga0068864_100642057 3300005618 Bacteria 1033
54 Ga0068866_10192250 3300005718 Bacteria 1213
55 Ga0068861_100210524 3300005719 Bacteria 1637
56 Ga0068863_100077396 3300005841 Bacteria 3148
57 Ga0068863_100160634 3300005841 Bacteria 2153
58 Ga0068858_100008601 3300005842 Bacteria 9805
59 Ga0068858_100019455 3300005842 Bacteria 6350
60 Ga0097621_100000295 3300006237 Bacteria 33699
61 Ga0068871_100000019 3300006358 Bacteria 86487
62 Ga0068871_100219970 3300006358 Bacteria 1645
63 Ga0075433_10005055 3300006852 Bacteria 10339
64 Ga0068865_100163649 3300006881 Bacteria 1699
65 Ga0068865_100266629 3300006881 Bacteria 1358
66 Ga0097620_100102389 3300006931 Bacteria 2921
67 Ga0105240_10018973 3300009093 Bacteria 9210
68 Ga0105240_10044743 3300009093 Bacteria 5621
69 Ga0105240_10056492 3300009093 Bacteria 4911
70 Ga0105240_10091341 3300009093 Bacteria 3720
71 Ga0105240_10124085 3300009093 Bacteria 3106
72 Ga0111539_10678487 3300009094 Bacteria 1200
73 Ga0105245_10295680 3300009098 Bacteria 1587
74 Ga0105247_10580911 3300009101 Bacteria 828
75 Ga0114129_10168089 3300009147 Bacteria 2991
76 Ga0114129_11687093 3300009147 Bacteria 773
77 Ga0105243_10289287 3300009148 Bacteria 1480
78 Ga0105241_10064505 3300009174 Bacteria 2828
79 Ga0105242_10040150 3300009176 Bacteria 3770
80 Ga0105242_10070228 3300009176 Bacteria 2903
81 Ga0105242_10083807 3300009176 Bacteria 2670
82 Ga0105242_10254811 3300009176 Bacteria 1583
83 Ga0105248_10000001 3300009177 Bacteria 1881304
84 Ga0105248_10063521 3300009177 Bacteria 4145
85 Ga0105248_10141447 3300009177 Bacteria 2715
86 Ga0105248_10745239 3300009177 Bacteria 1105
87 Ga0105237_10040548 3300009545 Bacteria 4695
88 Ga0105237_10041614 3300009545 Bacteria 4633
89 Ga0105238_10064355 3300009551 Bacteria 3667
90 Ga0105238_10070968 3300009551 Bacteria 3481
91 Ga0105238_10076677 3300009551 Bacteria 3334
92 Ga0105238_10731123 3300009551 Bacteria 1003
93 Ga0105249_10014490 3300009553 Bacteria 6970
94 Ga0105249_10764484 3300009553 Bacteria 1029
95 Ga0105239_10048302 3300010375 Bacteria 4667
96 Ga0105239_10519739 3300010375 Bacteria 1354
97 Ga0105239_11682090 3300010375 Bacteria 734
98 Ga0157370_10067373 3300013104 Bacteria 3384
99 Ga0157374_10211488 3300013296 Bacteria 1902
100 Ga0157378_10382361 3300013297 Bacteria 1383
101 Ga0163162_10309538 3300013306 Bacteria 1712
102 Ga0157372_10010242 3300013307 Bacteria 9955
103 Ga0157372_10680637 3300013307 Bacteria 1197
104 Ga0157375_10150906 3300013308 Bacteria 2459
105 Ga0157375_10214488 3300013308 Bacteria 2083
106 Ga0157375_10231540 3300013308 Bacteria 2007
107 Ga0157375_10851714 3300013308 Bacteria 1058
108 Ga0163163_10000002 3300014325 Bacteria 609846
109 Ga0163163_10276309 3300014325 Bacteria 1731
110 Ga0157379_10001446 3300014968 Bacteria 19506
111 Ga0163161_10015812 3300017792 Bacteria 5262
112 Ga0207427_107340 3300025231 Bacteria 1301
113 Ga0209233_1000013 3300025261 Bacteria 1013785
114 Ga0209233_1023972 3300025261 Bacteria 1534
115 Ga0209455_1025859 3300025272 Bacteria 1061
116 Ga0209758_1000032 3300025297 Bacteria 481623
117 Ga0207680_10002352 3300025903 Bacteria 8792
118 Ga0207680_10153442 3300025903 Unclassified 1537
119 Ga0207705_10004268 3300025909 Bacteria 10825
120 Ga0207684_10192194 3300025910 Bacteria 1761
121 Ga0207654_10018424 3300025911 Bacteria 3663
122 Ga0207654_10131754 3300025911 Bacteria 1583
123 Ga0207707_10064364 3300025912 Bacteria 3192
124 Ga0207695_10004959 3300025913 Bacteria 17922
125 Ga0207695_10005042 3300025913 Bacteria 17733
126 Ga0207695_10043746 3300025913 Bacteria 4770
127 Ga0207695_10118057 3300025913 Bacteria 2624
128 Ga0207671_10011224 3300025914 Bacteria 7309
129 Ga0207671_10465117 3300025914 Bacteria 1008
130 Ga0207663_10151224 3300025916 Bacteria 1629
131 Ga0207663_10173919 3300025916 Bacteria 1532
132 Ga0207660_10071622 3300025917 Bacteria 2522
133 Ga0207660_10428560 3300025917 Bacteria 1068
134 Ga0207662_10295847 3300025918 Bacteria 1075
135 Ga0207657_10082535 3300025919 Bacteria 2698
136 Ga0207657_10217714 3300025919 Bacteria 1531
137 Ga0207657_10320873 3300025919 Bacteria 1225
138 Ga0207652_10531085 3300025921 Bacteria 1058
139 Ga0207694_10104140 3300025924 Bacteria 2251
140 Ga0207694_10580818 3300025924 Bacteria 942
141 Ga0207700_10138454 3300025928 Bacteria 1997
142 Ga0207664_10160514 3300025929 Bacteria 1917
143 Ga0207664_10526155 3300025929 Bacteria 1060
144 Ga0207690_10103607 3300025932 Bacteria 2037
145 Ga0207686_10026664 3300025934 Bacteria 3374
146 Ga0207686_10057369 3300025934 Bacteria 2451
147 Ga0207709_10134942 3300025935 Bacteria 1688
148 Ga0207670_10253673 3300025936 Bacteria 1361
149 Ga0207704_10012291 3300025938 Bacteria 4247
150 Ga0207711_10000001 3300025941 Bacteria 1325674
151 Ga0207711_10008673 3300025941 Bacteria 8506
152 Ga0207711_10064797 3300025941 Bacteria 3157
153 Ga0207661_10238784 3300025944 Bacteria 1612
154 Ga0207661_10736579 3300025944 Bacteria 907
155 Ga0207667_10007777 3300025949 Bacteria 12815
156 Ga0207667_10136753 3300025949 Bacteria 2523
157 Ga0207667_10207689 3300025949 Bacteria 2008
158 Ga0207667_10517598 3300025949 Bacteria 1209
159 Ga0207712_10462979 3300025961 Bacteria 1077
160 Ga0207668_10128295 3300025972 Bacteria 1933
161 Ga0207658_10035542 3300025986 Bacteria 3569
162 Ga0207677_10735558 3300026023 Bacteria 878
163 Ga0207639_10176012 3300026041 Bacteria 1816
164 Ga0207678_10517663 3300026067 Bacteria 1041
165 Ga0207708_10061893 3300026075 Bacteria 2858
166 Ga0207641_10210847 3300026088 Bacteria 1796
167 Ga0207641_10621318 3300026088 Bacteria 1059
168 Ga0207648_10058684 3300026089 Bacteria 3356
169 Ga0207648_10131210 3300026089 Bacteria 2206
170 Ga0207676_10236570 3300026095 Bacteria 1636
171 Ga0207674_10165846 3300026116 Bacteria 2163
172 Ga0207675_100186778 3300026118 Bacteria 1987
173 Ga0207675_100255043 3300026118 Bacteria 1699
174 Ga0207675_100772285 3300026118 Bacteria 973
175 Ga0207683_10045534 3300026121 Bacteria 3837
176 Ga0207698_10148804 3300026142 Bacteria 2029
177 Ga0268266_10000829 3300028379 Bacteria 40407
178 Ga0268266_10014227 3300028379 Bacteria 6845
179 Ga0268266_10069808 3300028379 Bacteria 3045
180 Ga0268266_10132832 3300028379 Bacteria 2227
181 Ga0268264_10877234 3300028381 Bacteria 900
182 Ga0265318_10149038 3300028577 Bacteria 858
183 Ga0265336_10069518 3300028666 Bacteria 1053
184 Ga0307517_10221365 3300028786 Bacteria 1150
185 Ga0265338_10010938 3300028800 Bacteria 10547
186 Ga0265338_10012397 3300028800 Bacteria 9719
187 Ga0265338_10288017 3300028800 Bacteria 1198
188 Ga0265332_10011365 3300031238 Bacteria 3957
189 Ga0265325_10025807 3300031241 Bacteria 3188
190 Ga0265340_10008751 3300031247 Bacteria 5459
191 Ga0265339_10037444 3300031249 Bacteria 2711
192 Ga0265339_10039050 3300031249 Bacteria 2645
193 Ga0265331_10016667 3300031250 Bacteria 3851
194 Ga0265331_10017976 3300031250 Bacteria 3676
195 Ga0265316_10098246 3300031344 Bacteria 2228
196 Ga0265316_10101024 3300031344 Bacteria 2192
197 Ga0265316_10231085 3300031344 Bacteria 1362
198 Ga0265313_10000916 3300031595 Bacteria 29471
199 Ga0265314_10036738 3300031711 Bacteria 3556
200 Ga0265342_10019575 3300031712 Bacteria 4360
201 Ga0307516_10034398 3300031730 Bacteria 5092
202 Ga0307409_100080864 3300031995 Bacteria 2624
203 Ga0307409_100456706 3300031995 Bacteria 1234
204 Ga0307416_101680445 3300032002 Bacteria 740
205 Ga0373946_0002289 3300035171 Bacteria 6771
206 Ga0373947_0000851 3300035725 Bacteria 18416
207 Ga0373937_0134074 3300036401 Bacteria 2315
208 Ga0373925_0003294 3300037068 Bacteria 12555
209 Ga0451802_1040971 3300041460 Bacteria 1102
210 Ga0495629_0200067 3300046459 Bacteria 1381
211 Ga0495580_0011116 3300046472 Bacteria 6976
212 Ga0495582_0036944 3300046473 Bacteria 2687
213 Ga0495606_0347030 3300046507 Bacteria 789
214 Ga0495667_0505484 3300046559 Bacteria 757
215 Ga0496108_0000090 3300048911 Bacteria 95201
216 Ga0496110_0008679 3300048913 Bacteria 8187
217 Ga0496121_0491883 3300048924 Bacteria 781
218 Ga0501033_0014196 3300049570 Bacteria 6055
219 Ga0501033_0029504 3300049570 Bacteria 4122
220 Ga0501034_0006568 3300049571 Bacteria 12489
221 Ga0501034_0402341 3300049571 Bacteria 1292
222 Ga0501036_0120101 3300049572 Bacteria 2220
223 Ga0501038_0060092 3300049574 Bacteria 3254
224 Ga0501038_0134439 3300049574 Bacteria 2027
225 Ga0501039_0345454 3300049575 Bacteria 1169
226 Ga0501043_0054892 3300049579 Bacteria 3130
227 Ga0501043_0363843 3300049579 Bacteria 1097
228 Ga0501047_0408554 3300049581 Bacteria 1190
229 Ga0501047_0540885 3300049581 Bacteria 990
230 Ga0501068_0000850 3300049584 Bacteria 15906
231 Ga0501070_0309411 3300049586 Bacteria 1286
232 Ga0501073_0000784 3300049589 Bacteria 22567
233 Ga0501074_0000010 3300049590 Bacteria 99952
234 Ga0501249_010920 3300049679 Bacteria 1903
235 Ga0501080_0060244 3300049742 Bacteria 3533
236 Ga0501080_0081649 3300049742 Bacteria 3003
237 Ga0501080_0100462 3300049742 Bacteria 2684
238 Ga0501080_0109037 3300049742 Bacteria 2566
239 Ga0501083_0011729 3300049744 Bacteria 6145
240 Ga0501035_0022236 3300049822 Bacteria 5824
241 Ga0501035_0044363 3300049822 Bacteria 4004
242 Ga0501035_0197602 3300049822 Bacteria 1726
243 Ga0501044_0042763 3300049823 Bacteria 4711
244 Ga0501044_0059862 3300049823 Bacteria 3901
245 Ga0501044_0328097 3300049823 Bacteria 1453
246 Ga0501044_0571313 3300049823 Bacteria 1026
247 nmdc:mga05p37_161402_c1 3300050507 Bacteria 2435
248 nmdc:mga08y16_512488_c1 3300050511 Bacteria 1217
249 nmdc:mga0a205_345_c2 3300050515 Bacteria 30689
250 nmdc:mga0a205_634080_c1 3300050515 Bacteria 920
251 Ga0500646_0018589 3300053090 Bacteria 1832
252 Ga0500595_001830 3300053119 Bacteria 11001
253 Ga0500568_0080692 3300053139 Bacteria 1235
254 Ga0500573_0000002 3300053140 Bacteria 407088
255 Ga0500619_039804 3300053154 Bacteria 1479
256 Ga0501084_0129411 3300054114 Bacteria 2125
257 Ga0501082_0044638 3300060353 Bacteria 3822
258 2894235028 2894232714 Bacteria 8834183
259 rootH2_10113083
260 JGI25165J46597_1000209
261 JGI25153J46596_10002424
262 rootH1_10087280
263 Ga0070658_10172334
264 Ga0070683_100202906
265 Ga0070683_100298015
266 Ga0070683_100791723
267 Ga0070690_100055135
268 Ga0070666_10002059
269 Ga0070680_100013731
270 Ga0068868_100344564
271 Ga0070660_100074522
272 Ga0070660_100244172
273 Ga0070660_100335238
274 Ga0070689_100270351
275 Ga0070661_100181478
276 Ga0070674_100248975
277 Ga0070659_100122900
278 Ga0070659_100139486
279 Ga0070667_100027948
280 Ga0070714_100086019
281 Ga0070714_100293432
282 Ga0070713_100270487
283 Ga0070711_100076940
284 Ga0070678_100024362
285 Ga0070662_100163745
286 Ga0070662_100671757
287 Ga0070681_10058917
288 Ga0068867_100073123
289 Ga0070685_10088269
290 Ga0070679_100018334
291 Ga0070679_100033940
292 Ga0070679_100158991
293 Ga0070684_100053242
294 Ga0070684_100318794
295 Ga0068853_100409682
296 Ga0070686_100029072
297 Ga0070665_100000639
298 Ga0070665_100007969
299 Ga0070665_100073366
300 Ga0070665_100112976
301 Ga0070665_100113598
302 Ga0070665_100231304
303 Ga0068855_100011896
304 Ga0068855_100129671
305 Ga0068855_100145391
306 Ga0068855_100153421
307 Ga0068855_100302311
308 Ga0068857_100145661
309 Ga0068852_100177840
310 Ga0068859_100102395
311 Ga0068864_100642057
312 Ga0068866_10192250
313 Ga0068861_100210524
314 Ga0068863_100077396
315 Ga0068863_100160634
316 Ga0068858_100008601
317 Ga0068858_100019455
318 Ga0097621_100000295
319 Ga0068871_100000019
320 Ga0068871_100219970
321 Ga0075433_10005055
322 Ga0068865_100163649
323 Ga0068865_100266629
324 Ga0097620_100102389
325 Ga0105240_10018973
326 Ga0105240_10044743
327 Ga0105240_10056492
328 Ga0105240_10091341
329 Ga0105240_10124085
330 Ga0111539_10678487
331 Ga0105245_10295680
332 Ga0105247_10580911
333 Ga0114129_10168089
334 Ga0114129_11687093
335 Ga0105243_10289287
336 Ga0105241_10064505
337 Ga0105242_10040150
338 Ga0105242_10070228
339 Ga0105242_10083807
340 Ga0105242_10254811
341 Ga0105248_10000001
342 Ga0105248_10063521
343 Ga0105248_10141447
344 Ga0105248_10745239
345 Ga0105237_10040548
346 Ga0105237_10041614
347 Ga0105238_10064355
348 Ga0105238_10070968
349 Ga0105238_10076677
350 Ga0105238_10731123
351 Ga0105249_10014490
352 Ga0105249_10764484
353 Ga0105239_10048302
354 Ga0105239_10519739
355 Ga0105239_11682090
356 Ga0157370_10067373
357 Ga0157374_10211488
358 Ga0157378_10382361
359 Ga0163162_10309538
360 Ga0157372_10010242
361 Ga0157372_10680637
362 Ga0157375_10150906
363 Ga0157375_10214488
364 Ga0157375_10231540
365 Ga0157375_10851714
366 Ga0163163_10000002
367 Ga0163163_10276309
368 Ga0157379_10001446
369 Ga0163161_10015812
370 Ga0207427_107340
371 Ga0209233_1000013
372 Ga0209233_1023972
373 Ga0209455_1025859
374 Ga0209758_1000032
375 Ga0207680_10002352
376 Ga0207680_10153442
377 Ga0207705_10004268
378 Ga0207684_10192194
379 Ga0207654_10018424
380 Ga0207654_10131754
381 Ga0207707_10064364
382 Ga0207695_10004959
383 Ga0207695_10005042
384 Ga0207695_10043746
385 Ga0207695_10118057
386 Ga0207671_10011224
387 Ga0207671_10465117
388 Ga0207663_10151224
389 Ga0207663_10173919
390 Ga0207660_10071622
391 Ga0207660_10428560
392 Ga0207662_10295847
393 Ga0207657_10082535
394 Ga0207657_10217714
395 Ga0207657_10320873
396 Ga0207652_10531085
397 Ga0207694_10104140
398 Ga0207694_10580818
399 Ga0207700_10138454
400 Ga0207664_10160514
401 Ga0207664_10526155
402 Ga0207690_10103607
403 Ga0207686_10026664
404 Ga0207686_10057369
405 Ga0207709_10134942
406 Ga0207670_10253673
407 Ga0207704_10012291
408 Ga0207711_10000001
409 Ga0207711_10008673
410 Ga0207711_10064797
411 Ga0207661_10238784
412 Ga0207661_10736579
413 Ga0207667_10007777
414 Ga0207667_10136753
415 Ga0207667_10207689
416 Ga0207667_10517598
417 Ga0207712_10462979
418 Ga0207668_10128295
419 Ga0207658_10035542
420 Ga0207677_10735558
421 Ga0207639_10176012
422 Ga0207678_10517663
423 Ga0207708_10061893
424 Ga0207641_10210847
425 Ga0207641_10621318
426 Ga0207648_10058684
427 Ga0207648_10131210
428 Ga0207676_10236570
429 Ga0207674_10165846
430 Ga0207675_100186778
431 Ga0207675_100255043
432 Ga0207675_100772285
433 Ga0207683_10045534
434 Ga0207698_10148804
435 Ga0268266_10000829
436 Ga0268266_10014227
437 Ga0268266_10069808
438 Ga0268266_10132832
439 Ga0268264_10877234
440 Ga0265318_10149038
441 Ga0265336_10069518
442 Ga0307517_10221365
443 Ga0265338_10010938
444 Ga0265338_10012397
445 Ga0265338_10288017
446 Ga0265332_10011365
447 Ga0265325_10025807
448 Ga0265340_10008751
449 Ga0265339_10037444
450 Ga0265339_10039050
451 Ga0265331_10016667
452 Ga0265331_10017976
453 Ga0265316_10098246
454 Ga0265316_10101024
455 Ga0265316_10231085
456 Ga0265313_10000916
457 Ga0265314_10036738
458 Ga0265342_10019575
459 Ga0307516_10034398
460 Ga0307409_100080864
461 Ga0307409_100456706
462 Ga0307416_101680445
463 Ga0373946_0002289
464 Ga0373947_0000851
465 Ga0373937_0134074
466 Ga0373925_0003294
467 Ga0451802_1040971
468 Ga0495629_0200067
469 Ga0495580_0011116
470 Ga0495582_0036944
471 Ga0495606_0347030
472 Ga0495667_0505484
473 Ga0496108_0000090
474 Ga0496110_0008679
475 Ga0496121_0491883
476 Ga0501033_0014196
477 Ga0501033_0029504
478 Ga0501034_0006568
479 Ga0501034_0402341
480 Ga0501036_0120101
481 Ga0501038_0060092
482 Ga0501038_0134439
483 Ga0501039_0345454
484 Ga0501043_0054892
485 Ga0501043_0363843
486 Ga0501047_0408554
487 Ga0501047_0540885
488 Ga0501068_0000850
489 Ga0501070_0309411
490 Ga0501073_0000784
491 Ga0501074_0000010
492 Ga0501249_010920
493 Ga0501080_0060244
494 Ga0501080_0081649
495 Ga0501080_0100462
496 Ga0501080_0109037
497 Ga0501083_0011729
498 Ga0501035_0022236
499 Ga0501035_0044363
500 Ga0501035_0197602
501 Ga0501044_0042763
502 Ga0501044_0059862
503 Ga0501044_0328097
504 Ga0501044_0571313
505 nmdc:mga05p37_161402_c1
506 nmdc:mga08y16_512488_c1
507 nmdc:mga0a205_345_c2
508 nmdc:mga0a205_634080_c1
509 Ga0500646_0018589
510 Ga0500595_001830
511 Ga0500568_0080692
512 Ga0500573_0000002
513 Ga0500619_039804
514 Ga0501084_0129411
515 Ga0501082_0044638
516 2894235028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

48

158

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

192

266

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9765 4 120
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9732 4 120
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9714 4 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9712 4 122
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.97 5 121
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9941 5 87 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9931 1 83 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9907 4 80 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9887 4 80 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9814 1 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A496TXD4-F1-model_v4 DNA-binding transcriptional regulator NtrC (Nitrogen regulation protein NR(I)) (Nitrogen regulator I) 0.9754 3 126 GO:0000160
GO:0005524
GO:0006355
GO:0016887
AF-A0A2V5SBS5-F1-model_v4 DNA-binding response regulator 0.9746 4 129 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7Y8IIF2-F1-model_v4 Response regulator 0.9701 3 126 GO:0000160
GO:0016787
AF-A0A2V5SBS5-F1-model_v4 DNA-binding response regulator 0.967 4 129 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7C3ASW8-F1-model_v4 Response regulator 0.9665 1 126 GO:0000160
GO:0016787

Map