F367731

General Info

Members Datasets Scaffolds Average Seq Length
257 190 514 244

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8025478263|8025479835
Length 285
Sequence TNATNAATGATTGAADVTDAAGTADAAAAAAGLPGAQPQPRDQLKEMPTDWRRALAIVAHPDDLEYGASAAVATWLDDGRECVYLLASVGEAGIDTLAPAEAGPLREREQRAGAAAVGVETVEFLGHPDGVIEYGTALRRDFAAAIRRHRPELVLTLNHHDTWSWGDSVFWNTPDHRNVGRAVLDAVADAGNRWIFPDLAEEGLLPWDGVRYVAVAGSPRPTHAVDASSGLDRAVASLLCHRTYIEALTKEDPETYCRTFLEGGMQGVAARFGGRPGVSFELFNR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
17 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
22 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
23 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
24 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
25 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
26 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
27 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
28 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
29 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
30 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
31 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
32 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
33 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
34 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
35 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
36 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
41 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
42 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
43 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
44 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
45 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
46 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
47 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
69 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
75 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
76 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
80 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
81 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
126 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
127 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
128 2547132424 Nocardia nova SH22a Isolate Unclassified
129 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
130 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
131 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
132 2582580736 Prauserella sp. Am3 Isolate Unclassified
133 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
134 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
135 2643221578 Streptomyces sp. Root63 Isolate Unclassified
136 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
137 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
138 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
139 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
140 2643221692 Nocardia sp. Root136 Isolate Unclassified
141 2643221714 Streptomyces sp. Root264 Isolate Unclassified
142 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
143 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
144 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
145 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
146 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
147 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
148 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
149 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
150 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
151 2808606448 Streptomyces sp. 193411 Isolate Unclassified
152 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
153 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
154 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
155 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
156 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
157 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
158 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
159 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
160 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
161 2862574272 Streptomyces sp. AcE210 Isolate Nodule
162 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
163 2867475112 Streptomyces sp. TM32 Isolate Unclassified
164 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
165 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
166 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
167 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
168 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
169 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
170 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
171 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
172 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
173 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
174 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
175 2922554459 Rhodococcus sp. 66b Isolate Unclassified
176 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
177 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
178 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
179 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
180 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
181 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
182 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
183 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
184 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
185 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
186 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
187 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
188 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
189 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
190 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.76
Metatranscriptomes 0.39
Isolates 26.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 1.17
Rhizoplane 0.78
Rhizosphere 75.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10016332 3300001990 Bacteria 2397
2 rootH1_10088624 3300003316 Bacteria 1732
3 Ga0006562J51391_1109796 3300003578 Bacteria 2180
4 Ga0070714_100068744 3300005435 Bacteria 3057
5 Ga0070714_100641100 3300005435 Bacteria 1022
6 Ga0068856_100200917 3300005614 Bacteria 2008
7 Ga0081455_10000011 3300005937 Bacteria 203132
8 Ga0081455_10070238 3300005937 Bacteria 2909
9 Ga0075363_100001924 3300006048 Bacteria 8231
10 Ga0075363_100021354 3300006048 Bacteria 3259
11 Ga0075364_10330310 3300006051 Bacteria 1039
12 Ga0075367_10000180 3300006178 Bacteria 20556
13 Ga0075370_10129767 3300006353 Bacteria 1470
14 Ga0075431_100014202 3300006847 Bacteria 8053
15 Ga0075429_100148171 3300006880 Bacteria 2055
16 Ga0114129_10212554 3300009147 Bacteria 2614
17 Ga0105248_10063216 3300009177 Bacteria 4155
18 Ga0105248_10751478 3300009177 Bacteria 1100
19 Ga0105246_10012477 3300011119 Bacteria 5305
20 Ga0157379_10077758 3300014968 Bacteria 2971
21 Ga0157379_10295192 3300014968 Bacteria 1476
22 Ga0183367_1016 3300015688 Bacteria 290198
23 Ga0207426_1000825 3300025302 Bacteria 33172
24 Ga0207647_10063109 3300025904 Bacteria 2254
25 Ga0207711_10675557 3300025941 Bacteria 963
26 Ga0307515_10117131 3300028794 Bacteria 3052
27 Ga0307512_10015013 3300030522 Bacteria 7199
28 Ga0307512_10091729 3300030522 Bacteria 2111
29 Ga0307513_10251561 3300031456 Bacteria 1563
30 Ga0307514_10022748 3300031649 Bacteria 5090
31 Ga0307514_10025234 3300031649 Bacteria 4807
32 Ga0307516_10007178 3300031730 Bacteria 12861
33 Ga0307413_10001674 3300031824 Bacteria 8620
34 Ga0307507_10130945 3300033179 Bacteria 1963
35 Ga0307510_10132238 3300033180 Bacteria 2164
36 Ga0373953_0027565 3300035117 Bacteria 2185
37 Ga0373933_0305665 3300035724 Bacteria 1030
38 Ga0395900_0376159 3300037418 Bacteria 1389
39 Ga0395898_0006686 3300037466 Bacteria 12296
40 Ga0395898_0551157 3300037466 Bacteria 1095
41 Ga0395905_0466659 3300037471 Bacteria 1161
42 Ga0395901_0315852 3300038443 Bacteria 1617
43 Ga0439436_0001294 3300041404 Bacteria 7157
44 Ga0439436_0001671 3300041404 Bacteria 6485
45 Ga0439436_0011895 3300041404 Bacteria 2642
46 Ga0439439_0005880 3300041406 Bacteria 2822
47 Ga0451853_0041857 3300041512 Bacteria 2794
48 Ga0451853_0203822 3300041512 Bacteria 3285
49 Ga0439433_0000892 3300041999 Bacteria 5945
50 Ga0439433_0004973 3300041999 Bacteria 2855
51 Ga0439449_0000188 3300042007 Bacteria 21587
52 Ga0439449_0007145 3300042007 Bacteria 4248
53 Ga0439449_0014806 3300042007 Bacteria 2930
54 Ga0439449_0073319 3300042007 Bacteria 1261
55 Ga0439457_000300 3300042014 Bacteria 13655
56 Ga0439457_002176 3300042014 Bacteria 5668
57 Ga0439457_027183 3300042014 Bacteria 1266
58 Ga0450894_000760 3300042131 Bacteria 5287
59 Ga0450896_002244 3300042133 Bacteria 2481
60 Ga0450898_001393 3300042134 Bacteria 3171
61 Ga0450899_001507 3300042135 Bacteria 2590
62 Ga0450906_003651 3300042145 Bacteria 3282
63 Ga0439458_0068116 3300042157 Bacteria 896
64 Ga0466969_0069788 3300044656 Bacteria 1691
65 Ga0466972_0000339 3300044658 Bacteria 25923
66 Ga0466972_0026951 3300044658 Bacteria 2846
67 Ga0466972_0243993 3300044658 Bacteria 840
68 Ga0466966_0007527 3300044684 Bacteria 7213
69 Ga0466966_0018853 3300044684 Bacteria 4546
70 Ga0466966_0114725 3300044684 Bacteria 1659
71 Ga0466961_0003928 3300044693 Bacteria 9295
72 Ga0466961_0113861 3300044693 Bacteria 1700
73 Ga0466963_0078155 3300044694 Bacteria 2236
74 Ga0466964_0007697 3300044706 Bacteria 4033
75 Ga0466971_0000199 3300044719 Bacteria 23105
76 Ga0466968_0029437 3300044735 Bacteria 2271
77 Ga0466970_0002035 3300044765 Bacteria 9785
78 Ga0466957_0000128 3300044842 Bacteria 32238
79 Ga0466960_0000596 3300044901 Bacteria 12501
80 Ga0466960_0070920 3300044901 Bacteria 1734
81 Ga0466960_0155618 3300044901 Bacteria 1224
82 Ga0466959_0066864 3300045049 Bacteria 2606
83 Ga0466958_0001905 3300045836 Bacteria 10204
84 Ga0466958_0159139 3300045836 Bacteria 1426
85 Ga0466967_0005788 3300045976 Bacteria 8644
86 Ga0466967_0946595 3300045976 Bacteria 857
87 Ga0495617_005632 3300046452 Bacteria 4429
88 Ga0495603_0006312 3300046455 Bacteria 7092
89 Ga0495603_0030321 3300046455 Bacteria 3257
90 Ga0495629_0038617 3300046459 Bacteria 3362
91 Ga0495605_0008156 3300046474 Bacteria 5923
92 Ga0495605_0017613 3300046474 Bacteria 3842
93 Ga0495605_0119444 3300046474 Bacteria 1196
94 Ga0495585_0015233 3300046492 Bacteria 4468
95 Ga0495594_0001123 3300046499 Bacteria 13960
96 Ga0495607_0042304 3300046501 Bacteria 2701
97 Ga0495607_0245026 3300046501 Bacteria 865
98 Ga0495583_0004414 3300046506 Bacteria 10087
99 Ga0495583_0026512 3300046506 Bacteria 2871
100 Ga0495583_0065071 3300046506 Bacteria 1616
101 Ga0495583_0122893 3300046506 Bacteria 1091
102 Ga0495606_0012215 3300046507 Bacteria 6911
103 Ga0495616_0059913 3300046513 Bacteria 1871
104 Ga0495618_0087630 3300046514 Bacteria 1991
105 Ga0495620_0004525 3300046515 Bacteria 7825
106 Ga0495628_0199416 3300046516 Bacteria 1508
107 Ga0495643_0009009 3300046522 Bacteria 6265
108 Ga0495648_0027638 3300046524 Bacteria 3794
109 Ga0495666_0212663 3300046526 Bacteria 887
110 Ga0495642_0074967 3300046528 Bacteria 1419
111 Ga0495640_0019782 3300046533 Bacteria 4966
112 Ga0495640_0175941 3300046533 Bacteria 1366
113 Ga0495609_0194943 3300046538 Bacteria 849
114 Ga0495597_0021940 3300046542 Bacteria 2965
115 Ga0495622_0057681 3300046557 Bacteria 1799
116 Ga0495668_0000123 3300046616 Bacteria 115173
117 Ga0495668_0001208 3300046616 Bacteria 26137
118 Ga0495668_0096924 3300046616 Bacteria 1614
119 Ga0495611_0040896 3300046648 Bacteria 2067
120 Ga0495611_0130307 3300046648 Bacteria 1173
121 Ga0495625_0004487 3300046660 Bacteria 13171
122 Ga0495635_0135406 3300046663 Bacteria 1679
123 Ga0495661_0227944 3300046665 Bacteria 962
124 Ga0495657_0009054 3300046675 Bacteria 7570
125 Ga0495646_0121078 3300046680 Bacteria 1481
126 Ga0495613_0027633 3300046689 Bacteria 4222
127 Ga0495613_0126075 3300046689 Bacteria 1836
128 Ga0495624_0061780 3300046690 Bacteria 2346
129 Ga0495649_0026056 3300046694 Bacteria 3255
130 Ga0495589_0014253 3300046794 Bacteria 4096
131 Ga0495589_0036100 3300046794 Bacteria 2478
132 Ga0495589_0080727 3300046794 Bacteria 1582
133 Ga0495589_0094696 3300046794 Bacteria 1449
134 Ga0495589_0124788 3300046794 Bacteria 1238
135 Ga0495589_0151525 3300046794 Bacteria 1107
136 Ga0495600_0104999 3300046809 Bacteria 1841
137 Ga0495660_0030624 3300046810 Bacteria 3030
138 Ga0495660_0034930 3300046810 Bacteria 2811
139 Ga0495660_0132482 3300046810 Bacteria 1249
140 Ga0495604_0033087 3300047317 Bacteria 4094
141 Ga0495636_0000439 3300047318 Bacteria 15408
142 Ga0495636_0018434 3300047318 Bacteria 2801
143 Ga0495636_0114439 3300047318 Bacteria 1189
144 Ga0495636_0134558 3300047318 Bacteria 1101
145 Ga0495676_0030990 3300047321 Bacteria 4529
146 Ga0495676_0057929 3300047321 Bacteria 3051
147 Ga0495676_0195722 3300047321 Bacteria 1407
148 Ga0495680_0077746 3300047322 Bacteria 2513
149 Ga0495683_0003278 3300047323 Bacteria 9462
150 Ga0495683_0005837 3300047323 Bacteria 6772
151 Ga0495687_016327 3300047443 Bacteria 3736
152 Ga0495685_001274 3300047447 Bacteria 7697
153 Ga0495685_019424 3300047447 Bacteria 2335
154 Ga0495681_0185009 3300047470 Bacteria 854
155 Ga0495593_0007394 3300047673 Bacteria 6434
156 Ga0495614_0085866 3300048089 Bacteria 1366
157 Ga0496108_0120786 3300048911 Bacteria 2247
158 Ga0496114_0148708 3300048917 Bacteria 2031
159 Ga0496125_0022073 3300048928 Bacteria 5918
160 Ga0495678_082076 3300049459 Bacteria 1155
161 Ga0501032_0006012 3300049569 Bacteria 8951
162 Ga0501033_0061101 3300049570 Bacteria 2777
163 Ga0501034_0081230 3300049571 Bacteria 3244
164 Ga0501034_0185590 3300049571 Bacteria 2043
165 Ga0501034_0320285 3300049571 Bacteria 1483
166 Ga0501036_0018935 3300049572 Bacteria 5775
167 Ga0501036_0322662 3300049572 Bacteria 1290
168 Ga0501037_0031171 3300049573 Bacteria 3937
169 Ga0501038_0083658 3300049574 Bacteria 2686
170 Ga0501038_0130761 3300049574 Bacteria 2061
171 Ga0501039_0140581 3300049575 Bacteria 1896
172 Ga0501043_0046988 3300049579 Bacteria 3393
173 Ga0501047_0015517 3300049581 Bacteria 7257
174 Ga0501047_0083246 3300049581 Bacteria 3075
175 Ga0501070_0060601 3300049586 Bacteria 3137
176 Ga0501070_0366405 3300049586 Bacteria 1168
177 Ga0501070_0423113 3300049586 Bacteria 1076
178 Ga0501035_0002053 3300049822 Bacteria 20069
179 Ga0501035_0027195 3300049822 Bacteria 5229
180 Ga0501035_0315874 3300049822 Bacteria 1313
181 Ga0501044_0002818 3300049823 Bacteria 19811
182 Ga0501044_0010363 3300049823 Bacteria 10115
183 Ga0501044_0322776 3300049823 Bacteria 1468
184 Ga0501045_0449861 3300049824 Bacteria 957
185 nmdc:mga0yw44_403523_c1 3300050492 Bacteria 924
186 nmdc:mga07m45_65740_c1 3300050496 Bacteria 1481
187 nmdc:mga05p37_344187_c1 3300050507 Bacteria 1757
188 Ga0500600_0071961 3300053149 Bacteria 1894
189 8025479835 8025478263 Bacteria 8209203
190 2547409297 2547132111 Bacteria 8013147
191 2548697669 2547132424 Bacteria 8348532
192 2552109266 2551306166 Bacteria 9731570
193 2554261106 2554235005 Bacteria 6457341
194 2566996643 2565956761 Bacteria 6601618
195 2583150606 2582580736 Bacteria 5325865
196 2585315076 2582581314 Bacteria 11452267
197 2616698861 2616644814 Bacteria 11555299
198 2643901103 2643221578 Bacteria 9213798
199 2643943113 2643221587 Bacteria 7586415
200 2644407247 2643221673 Bacteria 9196637
201 2644430573 2643221677 Bacteria 7584031
202 2644440666 2643221678 Bacteria 9540101
203 2644512839 2643221692 Bacteria 7282860
204 2644627821 2643221714 Bacteria 9015452
205 2676476077 2675903058 Bacteria 6822861
206 2676491252 2675903060 Bacteria 10051191
207 2738891381 2738541308 Bacteria 7020677
208 2744956846 2744054611 Bacteria 5611514
209 2784586174 2784132148 Bacteria 8627943
210 2784592255 2784132148 Bacteria 8627943
211 2785339324 2784746763 Bacteria 9783172
212 2795797036 2795385472 Bacteria 6627535
213 2808845667 2808606359 Bacteria 9866990
214 2808915461 2808606375 Bacteria 9466072
215 2809229696 2808606448 Bacteria 8656184
216 2809235899 2808606448 Bacteria 8656184
217 2811842991 2808606982 Bacteria 7791042
218 2812353950 2811994879 Bacteria 9313447
219 2812483037 2811994917 Bacteria 7761064
220 2827633907 2827628540 Bacteria 6858585
221 2852639142 2852635781 Bacteria 8251373
222 2862282782 2862281513 Bacteria 9621493
223 2862293301 2862290372 Bacteria 7471434
224 2862384557 2862382967 Bacteria 10317375
225 2862515919 2862507626 Bacteria 9425308
226 2862575144 2862574272 Bacteria 10567477
227 2863410630 2863404153 Bacteria 9672205
228 2867476662 2867475112 Bacteria 6909112
229 2873158020 2873151551 Bacteria 8625867
230 2875398272 2875391855 Bacteria 7600475
231 2884700739 2884693830 Bacteria 11273186
232 2895429120 2895427314 Bacteria 13147766
233 2895452544 2895442618 Bacteria 11027144
234 2899367949 2899359706 Bacteria 10940472
235 2904539161 2904535858 Bacteria 6308016
236 2912715430 2912715099 Bacteria 9460473
237 2912715638 2912715099 Bacteria 9460473
238 2918508110 2918501144 Bacteria 8668083
239 2919472960 2919468124 Bacteria 9133025
240 2919716104 2919713450 Bacteria 7431245
241 2922555829 2922554459 Bacteria 6683962
242 2946071745 2946064051 Bacteria 8957905
243 2946079523 2946072368 Bacteria 8999607
244 2947232633 2947224130 Bacteria 9938529
245 2966599001 2966598605 Bacteria 7676064
246 2990064406 2990059506 Bacteria 9321252
247 3006491146 3006486233 Bacteria 8157040
248 3006495750 3006493962 Bacteria 8825450
249 8001787475 8001781756 Bacteria 9586736
250 8008564659 8008558824 Bacteria 10610750
251 8023625925 8023623736 Bacteria 8593882
252 8023629881 8023623736 Bacteria 8593882
253 8025416602 8025413630 Bacteria 7014048
254 8033685505 8033684223 Bacteria 6906479
255 8048411266 8048406513 Bacteria 8936924
256 8054160640 8054160619 Bacteria 7783213
257 8056670629 8056667051 Bacteria 6953971
258 JGI24737J22298_10016332
259 rootH1_10088624
260 Ga0006562J51391_1109796
261 Ga0070714_100068744
262 Ga0070714_100641100
263 Ga0068856_100200917
264 Ga0081455_10000011
265 Ga0081455_10070238
266 Ga0075363_100001924
267 Ga0075363_100021354
268 Ga0075364_10330310
269 Ga0075367_10000180
270 Ga0075370_10129767
271 Ga0075431_100014202
272 Ga0075429_100148171
273 Ga0114129_10212554
274 Ga0105248_10063216
275 Ga0105248_10751478
276 Ga0105246_10012477
277 Ga0157379_10077758
278 Ga0157379_10295192
279 Ga0183367_1016
280 Ga0207426_1000825
281 Ga0207647_10063109
282 Ga0207711_10675557
283 Ga0307515_10117131
284 Ga0307512_10015013
285 Ga0307512_10091729
286 Ga0307513_10251561
287 Ga0307514_10022748
288 Ga0307514_10025234
289 Ga0307516_10007178
290 Ga0307413_10001674
291 Ga0307507_10130945
292 Ga0307510_10132238
293 Ga0373953_0027565
294 Ga0373933_0305665
295 Ga0395900_0376159
296 Ga0395898_0006686
297 Ga0395898_0551157
298 Ga0395905_0466659
299 Ga0395901_0315852
300 Ga0439436_0001294
301 Ga0439436_0001671
302 Ga0439436_0011895
303 Ga0439439_0005880
304 Ga0451853_0041857
305 Ga0451853_0203822
306 Ga0439433_0000892
307 Ga0439433_0004973
308 Ga0439449_0000188
309 Ga0439449_0007145
310 Ga0439449_0014806
311 Ga0439449_0073319
312 Ga0439457_000300
313 Ga0439457_002176
314 Ga0439457_027183
315 Ga0450894_000760
316 Ga0450896_002244
317 Ga0450898_001393
318 Ga0450899_001507
319 Ga0450906_003651
320 Ga0439458_0068116
321 Ga0466969_0069788
322 Ga0466972_0000339
323 Ga0466972_0026951
324 Ga0466972_0243993
325 Ga0466966_0007527
326 Ga0466966_0018853
327 Ga0466966_0114725
328 Ga0466961_0003928
329 Ga0466961_0113861
330 Ga0466963_0078155
331 Ga0466964_0007697
332 Ga0466971_0000199
333 Ga0466968_0029437
334 Ga0466970_0002035
335 Ga0466957_0000128
336 Ga0466960_0000596
337 Ga0466960_0070920
338 Ga0466960_0155618
339 Ga0466959_0066864
340 Ga0466958_0001905
341 Ga0466958_0159139
342 Ga0466967_0005788
343 Ga0466967_0946595
344 Ga0495617_005632
345 Ga0495603_0006312
346 Ga0495603_0030321
347 Ga0495629_0038617
348 Ga0495605_0008156
349 Ga0495605_0017613
350 Ga0495605_0119444
351 Ga0495585_0015233
352 Ga0495594_0001123
353 Ga0495607_0042304
354 Ga0495607_0245026
355 Ga0495583_0004414
356 Ga0495583_0026512
357 Ga0495583_0065071
358 Ga0495583_0122893
359 Ga0495606_0012215
360 Ga0495616_0059913
361 Ga0495618_0087630
362 Ga0495620_0004525
363 Ga0495628_0199416
364 Ga0495643_0009009
365 Ga0495648_0027638
366 Ga0495666_0212663
367 Ga0495642_0074967
368 Ga0495640_0019782
369 Ga0495640_0175941
370 Ga0495609_0194943
371 Ga0495597_0021940
372 Ga0495622_0057681
373 Ga0495668_0000123
374 Ga0495668_0001208
375 Ga0495668_0096924
376 Ga0495611_0040896
377 Ga0495611_0130307
378 Ga0495625_0004487
379 Ga0495635_0135406
380 Ga0495661_0227944
381 Ga0495657_0009054
382 Ga0495646_0121078
383 Ga0495613_0027633
384 Ga0495613_0126075
385 Ga0495624_0061780
386 Ga0495649_0026056
387 Ga0495589_0014253
388 Ga0495589_0036100
389 Ga0495589_0080727
390 Ga0495589_0094696
391 Ga0495589_0124788
392 Ga0495589_0151525
393 Ga0495600_0104999
394 Ga0495660_0030624
395 Ga0495660_0034930
396 Ga0495660_0132482
397 Ga0495604_0033087
398 Ga0495636_0000439
399 Ga0495636_0018434
400 Ga0495636_0114439
401 Ga0495636_0134558
402 Ga0495676_0030990
403 Ga0495676_0057929
404 Ga0495676_0195722
405 Ga0495680_0077746
406 Ga0495683_0003278
407 Ga0495683_0005837
408 Ga0495687_016327
409 Ga0495685_001274
410 Ga0495685_019424
411 Ga0495681_0185009
412 Ga0495593_0007394
413 Ga0495614_0085866
414 Ga0496108_0120786
415 Ga0496114_0148708
416 Ga0496125_0022073
417 Ga0495678_082076
418 Ga0501032_0006012
419 Ga0501033_0061101
420 Ga0501034_0081230
421 Ga0501034_0185590
422 Ga0501034_0320285
423 Ga0501036_0018935
424 Ga0501036_0322662
425 Ga0501037_0031171
426 Ga0501038_0083658
427 Ga0501038_0130761
428 Ga0501039_0140581
429 Ga0501043_0046988
430 Ga0501047_0015517
431 Ga0501047_0083246
432 Ga0501070_0060601
433 Ga0501070_0366405
434 Ga0501070_0423113
435 Ga0501035_0002053
436 Ga0501035_0027195
437 Ga0501035_0315874
438 Ga0501044_0002818
439 Ga0501044_0010363
440 Ga0501044_0322776
441 Ga0501045_0449861
442 nmdc:mga0yw44_403523_c1
443 nmdc:mga07m45_65740_c1
444 nmdc:mga05p37_344187_c1
445 Ga0500600_0071961
446 8025479835
447 2547409297
448 2548697669
449 2552109266
450 2554261106
451 2566996643
452 2583150606
453 2585315076
454 2616698861
455 2643901103
456 2643943113
457 2644407247
458 2644430573
459 2644440666
460 2644512839
461 2644627821
462 2676476077
463 2676491252
464 2738891381
465 2744956846
466 2784586174
467 2784592255
468 2785339324
469 2795797036
470 2808845667
471 2808915461
472 2809229696
473 2809235899
474 2811842991
475 2812353950
476 2812483037
477 2827633907
478 2852639142
479 2862282782
480 2862293301
481 2862384557
482 2862515919
483 2862575144
484 2863410630
485 2867476662
486 2873158020
487 2875398272
488 2884700739
489 2895429120
490 2895452544
491 2899367949
492 2904539161
493 2912715430
494 2912715638
495 2918508110
496 2919472960
497 2919716104
498 2922555829
499 2946071745
500 2946079523
501 2947232633
502 2966599001
503 2990064406
504 3006491146
505 3006495750
506 8001787475
507 8008564659
508 8023625925
509 8023629881
510 8025416602
511 8033685505
512 8048411266
513 8054160640
514 8056670629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

55

187

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.9804 9 243
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.9563 9 243
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.9073 15 243
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.9028 15 243
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.9014 15 242
ID Description Score Start End Superfamily
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9783 8 242 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9465 8 242 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.89 19 240 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8898 15 243 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.855 19 240 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A4S2U9M5-F1-model_v4 PIG-L family deacetylase 0.9994 8 244 GO:0016137
GO:0016811
AF-A0A6B3CKG7-F1-model_v4 PIG-L family deacetylase 0.9985 8 244 GO:0016137
GO:0016811
AF-A0A1K2DBW4-F1-model_v4 N-acetylglucosaminyl deacetylase, LmbE family 0.998 12 190 GO:0016137
GO:0016811
AF-A0A4Z0HF53-F1-model_v4 PIG-L family deacetylase 0.9966 5 244 GO:0016137
GO:0016811
AF-A0A2N7YDI8-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9942 15 100 GO:0016811

Map