F367620

General Info

Members Datasets Scaffolds Average Seq Length
257 170 514 235

Family's Representative Sequence

Representative Sequence 3300049161|Ga0501305_027041|Ga0501305_027041_23_757
Length 244
Sequence LIKGVMMMNGSIQNRDSFLDNIAANLKRSRRTSGVVKPQWKHAPQHEVYRSYSPDQLKKELENHCERIHTRYVETSSQHLPAVLEEVVANYGNGLVSTWDDPRFSEYGLNLLMEKWETSSSLHVWNSAKGDENIKLAEQANVGITFSDLTLAESGTVVLFSSAEKGRSVSLLPATYIAIIPQSSIVPRMTQAAEMIHEKVERGEKIASCINFITGPSNSADIEMNLVVGVHGPIQATYIVVNDR

Samples

Sample ID Description Type Environment
1 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
19 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
22 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
35 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
36 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
37 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
38 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
39 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
40 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
41 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
42 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
43 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
44 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
45 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
46 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
47 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
48 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
49 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
50 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
51 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
52 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
53 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
54 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
55 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
56 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
57 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
58 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
59 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
60 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
61 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
62 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
63 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
69 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
70 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
71 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
72 2554235283 Bacillus safensis VK Isolate Rhizosphere
73 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
74 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
75 2643221729 Bacillus sp. Root11 Isolate Unclassified
76 2643221730 Bacillus sp. Root131 Isolate Unclassified
77 2643221731 Bacillus sp. Root147 Isolate Unclassified
78 2643221732 Bacillus sp. Root239 Isolate Unclassified
79 2643221735 Bacillus sp. Root920 Isolate Unclassified
80 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
81 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
82 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
83 2684622632 Bacillus cereus 905 Isolate Unclassified
84 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
85 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
86 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
87 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
88 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
89 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
90 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
91 2738541295 Bacillus sp. OK085 Isolate Unclassified
92 2738541358 Bacillus sp. OV752 Isolate Unclassified
93 2738543006 Bacillus sp. OK077 Isolate Unclassified
94 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
95 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
96 2811994870 Bacillus sp. JB4 Isolate Unclassified
97 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
98 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
99 2818991441 Niallia circulans 3243 Isolate Rhizosphere
100 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
101 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
102 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
103 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
104 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
105 2842682962 Bacillus sp. R-72492 Isolate Unclassified
106 2842882022 Bacillus sp. R-71893 Isolate Unclassified
107 2849139964 Bacillus sp. R-71875 Isolate Unclassified
108 2857581216 Bacillus sp. R-71922 Isolate Unclassified
109 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
110 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
111 2860837431 Bacillus sp. WR11 Isolate Unclassified
112 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
113 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
114 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
115 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
116 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
117 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
118 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
119 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
120 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
121 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
122 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
123 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
124 2919720352 Priestia megaterium 4340 Isolate Unclassified
125 2919726948 Bacillus pumilus 4489 Isolate Unclassified
126 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
127 2929004312 Priestia megaterium 1104 Isolate Unclassified
128 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
129 2938917290 Bacillus sp. CR71 Isolate Unclassified
130 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
131 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
132 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
133 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
134 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
135 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
136 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
137 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
138 2965761152 Bacillus sp. COPE52 Isolate Unclassified
139 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
140 2969141011 Bacillus velezensis MH25 Isolate Unclassified
141 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
142 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
143 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
144 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
145 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
146 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
147 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
148 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
149 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
150 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
151 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
152 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
153 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
154 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
155 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
156 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
157 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
158 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
159 8022653035 Bacillus sp. Rc4 Isolate Unclassified
160 8022792930 Bacillus sp. Xin Isolate Rhizosphere
161 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
162 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
163 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
164 8023438354 Bacillus sp. BH2 Isolate Unclassified
165 8023444577 Bacillus sp. BH32 Isolate Unclassified
166 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
167 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
168 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
169 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
170 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 54.09
Metatranscriptomes 1.95
Isolates 43.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.68
Nodule 0
Rhizoplane 8.56
Rhizosphere 45.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501305_027041 3300049161 Bacteria 878
2 JGI25159J45721_1000688 3300002987 Bacteria 14844
3 JGI25159J45721_1006610 3300002987 Bacteria 3446
4 JGI25159J45721_1008484 3300002987 Bacteria 2818
5 JGI25151J46595_10000012 3300003187 Bacteria 254028
6 JGI25151J46595_10001358 3300003187 Bacteria 16946
7 JGI25151J46595_10001910 3300003187 Bacteria 13231
8 JGI25151J46595_10014985 3300003187 Bacteria 3439
9 JGI25151J46595_10015705 3300003187 Bacteria 3326
10 JGI25151J46595_10016813 3300003187 Bacteria 3191
11 JGI25151J46595_10022802 3300003187 Bacteria 2591
12 JGI25151J46595_10025876 3300003187 Bacteria 2378
13 JGI25151J46595_10030771 3300003187 Bacteria 2106
14 JGI25151J46595_10042237 3300003187 Bacteria 1645
15 rootH1_10011350 3300003316 Bacteria 16310
16 rootL2_10019319 3300003322 Bacteria 26434
17 Ga0006562J51391_1001573 3300003578 Bacteria 9980
18 Ga0006562J51391_1007014 3300003578 Bacteria 7430
19 Ga0055538_1000310 3300003751 Bacteria 23455
20 Ga0055528_1028606 3300003790 Bacteria 1533
21 Ga0070669_100012823 3300005353 Bacteria 5953
22 Ga0070669_100091966 3300005353 Bacteria 2276
23 Ga0068870_10019998 3300005840 Bacteria 3254
24 Ga0105251_10006839 3300009011 Bacteria 7173
25 Ga0105251_10012156 3300009011 Bacteria 4884
26 Ga0105251_10016954 3300009011 Bacteria 3915
27 Ga0105244_10008527 3300009036 Bacteria 6394
28 Ga0105244_10016631 3300009036 Bacteria 4184
29 Ga0105244_10022633 3300009036 Bacteria 3457
30 Ga0105244_10024412 3300009036 Bacteria 3300
31 Ga0105244_10150853 3300009036 Bacteria 1114
32 Ga0105244_10246291 3300009036 Bacteria 834
33 Ga0105250_10000615 3300009092 Bacteria 23219
34 Ga0105250_10001293 3300009092 Bacteria 13737
35 Ga0105250_10007388 3300009092 Bacteria 4725
36 Ga0105250_10010237 3300009092 Bacteria 3910
37 Ga0105250_10011307 3300009092 Bacteria 3704
38 Ga0105250_10033093 3300009092 Bacteria 2075
39 Ga0105243_10483177 3300009148 Bacteria 1169
40 Ga0105242_10191811 3300009176 Bacteria 1809
41 Ga0105249_10036685 3300009553 Bacteria 4447
42 Ga0105246_10004921 3300011119 Bacteria 8140
43 Ga0105246_10009271 3300011119 Bacteria 6061
44 Ga0105246_10021859 3300011119 Bacteria 4122
45 Ga0157374_10015715 3300013296 Bacteria 6646
46 Ga0209784_100100 3300025224 Bacteria 101657
47 Ga0209147_101694 3300025229 Bacteria 7192
48 Ga0209147_103243 3300025229 Bacteria 3300
49 Ga0209147_112534 3300025229 Bacteria 907
50 Ga0209673_1002552 3300025273 Bacteria 12431
51 Ga0209130_1001408 3300025284 Bacteria 16068
52 Ga0209130_1001763 3300025284 Bacteria 12811
53 Ga0209130_1003600 3300025284 Bacteria 6454
54 Ga0209130_1004185 3300025284 Bacteria 5640
55 Ga0209130_1022855 3300025284 Bacteria 1388
56 Ga0209676_1000874 3300025292 Bacteria 38585
57 Ga0209676_1008823 3300025292 Bacteria 4436
58 Ga0209025_1000001 3300025294 Bacteria 1888151
59 Ga0209025_1000457 3300025294 Bacteria 79829
60 Ga0209025_1000722 3300025294 Bacteria 56052
61 Ga0209025_1001100 3300025294 Bacteria 38938
62 Ga0209025_1001182 3300025294 Bacteria 36937
63 Ga0209025_1001731 3300025294 Bacteria 26322
64 Ga0209025_1005084 3300025294 Bacteria 10946
65 Ga0209025_1005931 3300025294 Bacteria 9738
66 Ga0209025_1006419 3300025294 Bacteria 9136
67 Ga0209025_1007033 3300025294 Bacteria 8526
68 Ga0209025_1007233 3300025294 Bacteria 8351
69 Ga0209025_1007694 3300025294 Bacteria 7954
70 Ga0209025_1007733 3300025294 Bacteria 7926
71 Ga0209025_1008151 3300025294 Bacteria 7597
72 Ga0209025_1008356 3300025294 Bacteria 7461
73 Ga0209025_1013755 3300025294 Bacteria 5052
74 Ga0209025_1019326 3300025294 Bacteria 3792
75 Ga0209025_1019827 3300025294 Bacteria 3716
76 Ga0209025_1021185 3300025294 Bacteria 3514
77 Ga0209025_1024125 3300025294 Bacteria 3153
78 Ga0209025_1030169 3300025294 Bacteria 2602
79 Ga0207696_1001702 3300025711 Bacteria 11420
80 Ga0207696_1002274 3300025711 Bacteria 9545
81 Ga0207696_1002494 3300025711 Bacteria 8995
82 Ga0207696_1060104 3300025711 Bacteria 1070
83 Ga0207696_1076844 3300025711 Bacteria 925
84 Ga0207655_1012320 3300025728 Bacteria 5007
85 Ga0207655_1039371 3300025728 Bacteria 2054
86 Ga0207655_1046447 3300025728 Bacteria 1803
87 Ga0207655_1047733 3300025728 Bacteria 1764
88 Ga0207655_1051408 3300025728 Bacteria 1666
89 Ga0207655_1092229 3300025728 Bacteria 1063
90 Ga0207713_1004517 3300025735 Bacteria 9013
91 Ga0207713_1008696 3300025735 Bacteria 5802
92 Ga0207713_1012644 3300025735 Bacteria 4496
93 Ga0207713_1024155 3300025735 Bacteria 2841
94 Ga0207643_10138109 3300025908 Bacteria 1454
95 Ga0207681_10080006 3300025923 Bacteria 2304
96 Ga0207709_10402377 3300025935 Bacteria 1047
97 Ga0237817_10021 3300030083 Bacteria 63280
98 Ga0237817_10040 3300030083 Bacteria 44341
99 Ga0307408_100015572 3300031548 Bacteria 5064
100 Ga0307416_100099771 3300032002 Bacteria 2523
101 Ga0307416_100207299 3300032002 Bacteria 1866
102 Ga0395899_0166114 3300037312 Bacteria 1557
103 Ga0395898_0254794 3300037466 Bacteria 1674
104 Ga0237819_00046 3300038705 Bacteria 42295
105 Ga0237819_00103 3300038705 Bacteria 31220
106 Ga0466967_0003627 3300045976 Bacteria 10143
107 Ga0495637_0089214 3300046520 Bacteria 1219
108 Ga0495661_0246461 3300046665 Bacteria 914
109 Ga0495670_0229150 3300046691 Bacteria 988
110 Ga0495670_0400129 3300046691 Bacteria 742
111 Ga0495676_0124109 3300047321 Bacteria 1874
112 Ga0495626_0154080 3300048091 Bacteria 967
113 Ga0496100_0002231 3300048903 Bacteria 9785
114 Ga0496101_0066233 3300048904 Bacteria 2634
115 Ga0496101_0502916 3300048904 Bacteria 957
116 Ga0496102_0003716 3300048905 Bacteria 12894
117 Ga0496102_0030000 3300048905 Bacteria 4866
118 Ga0496103_0004040 3300048906 Bacteria 8916
119 Ga0496103_0020634 3300048906 Bacteria 3958
120 Ga0496104_0004233 3300048907 Bacteria 12461
121 Ga0496105_0002073 3300048908 Bacteria 14504
122 Ga0496106_0000227 3300048909 Bacteria 39343
123 Ga0496107_0000148 3300048910 Bacteria 35455
124 Ga0496108_0001890 3300048911 Bacteria 16782
125 Ga0496108_0020834 3300048911 Bacteria 5392
126 Ga0496109_0046382 3300048912 Bacteria 3947
127 Ga0496110_0000495 3300048913 Bacteria 26775
128 Ga0496110_0031612 3300048913 Bacteria 4568
129 Ga0496110_0338550 3300048913 Bacteria 1370
130 Ga0496111_0004563 3300048914 Bacteria 8770
131 Ga0496111_0025172 3300048914 Bacteria 4197
132 Ga0496112_0243837 3300048915 Bacteria 1749
133 Ga0496113_0020083 3300048916 Bacteria 4689
134 Ga0496114_0609596 3300048917 Bacteria 962
135 Ga0496116_0011510 3300048919 Bacteria 7312
136 Ga0496117_0036013 3300048920 Bacteria 3708
137 Ga0496119_0053301 3300048922 Bacteria 2471
138 Ga0496122_0026786 3300048925 Bacteria 4954
139 Ga0496123_0041003 3300048926 Bacteria 3216
140 Ga0496124_0179679 3300048927 Bacteria 1630
141 Ga0496125_0206483 3300048928 Bacteria 1280
142 Ga0496126_0020286 3300048929 Bacteria 6523
143 Ga0501341_02870 3300049131 Bacteria 953
144 Ga0501332_01214 3300049548 Bacteria 1317
145 2511701147 2511231119 Bacteria 4019861
146 2540608320 2540341094 Bacteria 4061186
147 2545558766 2545555800 Bacteria 4222588
148 2553393996 2551306519 Bacteria 5465154
149 2555470302 2554235283 Bacteria 3683090
150 2578933221 2576861599 Bacteria 4217202
151 2631984772 2630968484 Bacteria 3876276
152 2644703799 2643221729 Bacteria 6621700
153 2644708491 2643221730 Bacteria 6523787
154 2644719526 2643221731 Bacteria 5623886
155 2644722033 2643221732 Bacteria 5756404
156 2644740121 2643221735 Bacteria 3676263
157 2651530758 2648501850 Bacteria 3975476
158 2672337308 2671180330 Bacteria 5521719
159 2674421918 2671180844 Bacteria 4164150
160 2685149224 2684622632 Bacteria 5380049
161 2686996942 2684623153 Bacteria 3878815
162 2687498246 2687453109 Bacteria 3860091
163 2695629097 2695420354 Bacteria 3922431
164 2698323955 2695420987 Bacteria 6152737
165 2705993019 2703719227 Bacteria 5631989
166 2705993268 2703719227 Bacteria 5631989
167 2717915199 2716884898 Bacteria 3928789
168 2721504606 2718218445 Bacteria 5113413
169 2738815039 2738541295 Bacteria 5730091
170 2738817047 2738541295 Bacteria 5730091
171 2739156433 2738541358 Bacteria 5932299
172 2739156680 2738541358 Bacteria 5932299
173 2739210045 2738543006 Bacteria 5904091
174 2739210281 2738543006 Bacteria 5904091
175 2791212967 2788500588 Bacteria 4584915
176 2809053458 2808606399 Bacteria 4021018
177 2812316129 2811994870 Bacteria 3776934
178 2816862269 2816332186 Bacteria 5331395
179 2817481738 2816332295 Bacteria 4352468
180 2819570008 2818991441 Bacteria 5062707
181 2819579624 2818991443 Bacteria 6598732
182 2819625326 2818991451 Bacteria 4697364
183 2819708269 2818991465 Bacteria 5388835
184 2819724871 2818991468 Bacteria 3723169
185 2823528094 2823526263 Bacteria 3765752
186 2842684816 2842682962 Bacteria 5589973
187 2842885483 2842882022 Bacteria 6158489
188 2849141372 2849139964 Bacteria 5613304
189 2857585446 2857581216 Bacteria 5522813
190 2857604795 2857604169 Bacteria 5111450
191 2857609672 2857609550 Bacteria 3753890
192 2860841122 2860837431 Bacteria 4202080
193 2877772031 2877768649 Bacteria 3957164
194 2880172869 2880169592 Bacteria 3900066
195 2881645385 2881644220 Bacteria 5302661
196 2897113150 2897109615 Bacteria 4009619
197 2904527920 2904524088 Bacteria 5887454
198 2904561472 2904560550 Bacteria 4029838
199 2904607299 2904606771 Bacteria 4684500
200 2908665633 2908665501 Bacteria 3678115
201 2919094261 2919093281 Bacteria 3660974
202 2919148004 2919143609 Bacteria 6219228
203 2919414513 2919414237 Bacteria 5429133
204 2919521031 2919517244 Bacteria 5858162
205 2919724247 2919720352 Bacteria 5986006
206 2919728925 2919726948 Bacteria 3696050
207 2928097725 2928093941 Bacteria 5965005
208 2928099454 2928093941 Bacteria 5965005
209 2929004873 2929004312 Bacteria 5678476
210 2929234494 2929233124 Bacteria 5948380
211 2938918675 2938917290 Bacteria 5914775
212 2939594636 2939593269 Bacteria 4798695
213 2947428043 2947426588 Bacteria 5357194
214 2954774400 2954773129 Bacteria 3741715
215 2956897892 2956897341 Bacteria 5447711
216 2960322426 2960319331 Bacteria 5502575
217 2960381329 2960375949 Bacteria 5361395
218 2962294348 2962290636 Bacteria 4072939
219 2964378128 2964375228 Bacteria 4909004
220 2965762525 2965761152 Bacteria 5806513
221 2969140316 2969136845 Bacteria 3923176
222 2969144593 2969141011 Bacteria 4118468
223 2969768898 2969765954 Bacteria 4216713
224 2969771231 2969770375 Bacteria 4271280
225 2971896711 2971893375 Bacteria 3929648
226 2979084955 2979083700 Bacteria 5894929
227 2980496104 2980492589 Bacteria 4072961
228 2990276824 2990275345 Bacteria 4887158
229 2990279657 2990275345 Bacteria 4887158
230 3001271361 3001267043 Bacteria 4823521
231 3001272285 3001272096 Bacteria 4729684
232 3001893224 3001892409 Bacteria 6328293
233 3001897201 3001892409 Bacteria 6328293
234 3006828200 3006826541 Bacteria 4678913
235 3006862169 3006858327 Bacteria 4317835
236 3006882857 3006879489 Bacteria 4064221
237 3006973645 3006969106 Bacteria 4739423
238 3006978965 3006978542 Bacteria 5328100
239 3006987983 3006984091 Bacteria 4207523
240 3006992532 3006988479 Bacteria 4767936
241 8022622458 8022621104 Bacteria 5241040
242 8022633294 8022630665 Bacteria 3886130
243 8022657147 8022653035 Bacteria 4035078
244 8022798335 8022792930 Bacteria 5693794
245 8022893869 8022893055 Bacteria 5300455
246 8022915761 8022914991 Bacteria 5584517
247 8022951106 8022948649 Bacteria 5366783
248 8022951606 8022948649 Bacteria 5366783
249 8023442652 8023438354 Bacteria 5779374
250 8023449515 8023444577 Bacteria 5661597
251 8051954353 8051952484 Bacteria 3926774
252 8052175568 8052174270 Bacteria 3881265
253 8055533836 8055531788 Bacteria 5249694
254 8055536531 8055531788 Bacteria 5249694
255 8057584043 8057582654 Bacteria 5218944
256 8057587548 8057582654 Bacteria 5218944
257 8057633563 8057632132 Bacteria 4726859
258 Ga0501305_027041
259 JGI25159J45721_1000688
260 JGI25159J45721_1006610
261 JGI25159J45721_1008484
262 JGI25151J46595_10000012
263 JGI25151J46595_10001358
264 JGI25151J46595_10001910
265 JGI25151J46595_10014985
266 JGI25151J46595_10015705
267 JGI25151J46595_10016813
268 JGI25151J46595_10022802
269 JGI25151J46595_10025876
270 JGI25151J46595_10030771
271 JGI25151J46595_10042237
272 rootH1_10011350
273 rootL2_10019319
274 Ga0006562J51391_1001573
275 Ga0006562J51391_1007014
276 Ga0055538_1000310
277 Ga0055528_1028606
278 Ga0070669_100012823
279 Ga0070669_100091966
280 Ga0068870_10019998
281 Ga0105251_10006839
282 Ga0105251_10012156
283 Ga0105251_10016954
284 Ga0105244_10008527
285 Ga0105244_10016631
286 Ga0105244_10022633
287 Ga0105244_10024412
288 Ga0105244_10150853
289 Ga0105244_10246291
290 Ga0105250_10000615
291 Ga0105250_10001293
292 Ga0105250_10007388
293 Ga0105250_10010237
294 Ga0105250_10011307
295 Ga0105250_10033093
296 Ga0105243_10483177
297 Ga0105242_10191811
298 Ga0105249_10036685
299 Ga0105246_10004921
300 Ga0105246_10009271
301 Ga0105246_10021859
302 Ga0157374_10015715
303 Ga0209784_100100
304 Ga0209147_101694
305 Ga0209147_103243
306 Ga0209147_112534
307 Ga0209673_1002552
308 Ga0209130_1001408
309 Ga0209130_1001763
310 Ga0209130_1003600
311 Ga0209130_1004185
312 Ga0209130_1022855
313 Ga0209676_1000874
314 Ga0209676_1008823
315 Ga0209025_1000001
316 Ga0209025_1000457
317 Ga0209025_1000722
318 Ga0209025_1001100
319 Ga0209025_1001182
320 Ga0209025_1001731
321 Ga0209025_1005084
322 Ga0209025_1005931
323 Ga0209025_1006419
324 Ga0209025_1007033
325 Ga0209025_1007233
326 Ga0209025_1007694
327 Ga0209025_1007733
328 Ga0209025_1008151
329 Ga0209025_1008356
330 Ga0209025_1013755
331 Ga0209025_1019326
332 Ga0209025_1019827
333 Ga0209025_1021185
334 Ga0209025_1024125
335 Ga0209025_1030169
336 Ga0207696_1001702
337 Ga0207696_1002274
338 Ga0207696_1002494
339 Ga0207696_1060104
340 Ga0207696_1076844
341 Ga0207655_1012320
342 Ga0207655_1039371
343 Ga0207655_1046447
344 Ga0207655_1047733
345 Ga0207655_1051408
346 Ga0207655_1092229
347 Ga0207713_1004517
348 Ga0207713_1008696
349 Ga0207713_1012644
350 Ga0207713_1024155
351 Ga0207643_10138109
352 Ga0207681_10080006
353 Ga0207709_10402377
354 Ga0237817_10021
355 Ga0237817_10040
356 Ga0307408_100015572
357 Ga0307416_100099771
358 Ga0307416_100207299
359 Ga0395899_0166114
360 Ga0395898_0254794
361 Ga0237819_00046
362 Ga0237819_00103
363 Ga0466967_0003627
364 Ga0495637_0089214
365 Ga0495661_0246461
366 Ga0495670_0229150
367 Ga0495670_0400129
368 Ga0495676_0124109
369 Ga0495626_0154080
370 Ga0496100_0002231
371 Ga0496101_0066233
372 Ga0496101_0502916
373 Ga0496102_0003716
374 Ga0496102_0030000
375 Ga0496103_0004040
376 Ga0496103_0020634
377 Ga0496104_0004233
378 Ga0496105_0002073
379 Ga0496106_0000227
380 Ga0496107_0000148
381 Ga0496108_0001890
382 Ga0496108_0020834
383 Ga0496109_0046382
384 Ga0496110_0000495
385 Ga0496110_0031612
386 Ga0496110_0338550
387 Ga0496111_0004563
388 Ga0496111_0025172
389 Ga0496112_0243837
390 Ga0496113_0020083
391 Ga0496114_0609596
392 Ga0496116_0011510
393 Ga0496117_0036013
394 Ga0496119_0053301
395 Ga0496122_0026786
396 Ga0496123_0041003
397 Ga0496124_0179679
398 Ga0496125_0206483
399 Ga0496126_0020286
400 Ga0501341_02870
401 Ga0501332_01214
402 2511701147
403 2540608320
404 2545558766
405 2553393996
406 2555470302
407 2578933221
408 2631984772
409 2644703799
410 2644708491
411 2644719526
412 2644722033
413 2644740121
414 2651530758
415 2672337308
416 2674421918
417 2685149224
418 2686996942
419 2687498246
420 2695629097
421 2698323955
422 2705993019
423 2705993268
424 2717915199
425 2721504606
426 2738815039
427 2738817047
428 2739156433
429 2739156680
430 2739210045
431 2739210281
432 2791212967
433 2809053458
434 2812316129
435 2816862269
436 2817481738
437 2819570008
438 2819579624
439 2819625326
440 2819708269
441 2819724871
442 2823528094
443 2842684816
444 2842885483
445 2849141372
446 2857585446
447 2857604795
448 2857609672
449 2860841122
450 2877772031
451 2880172869
452 2881645385
453 2897113150
454 2904527920
455 2904561472
456 2904607299
457 2908665633
458 2919094261
459 2919148004
460 2919414513
461 2919521031
462 2919724247
463 2919728925
464 2928097725
465 2928099454
466 2929004873
467 2929234494
468 2938918675
469 2939594636
470 2947428043
471 2954774400
472 2956897892
473 2960322426
474 2960381329
475 2962294348
476 2964378128
477 2965762525
478 2969140316
479 2969144593
480 2969768898
481 2969771231
482 2971896711
483 2979084955
484 2980496104
485 2990276824
486 2990279657
487 3001271361
488 3001272285
489 3001893224
490 3001897201
491 3006828200
492 3006862169
493 3006882857
494 3006973645
495 3006978965
496 3006987983
497 3006992532
498 8022622458
499 8022633294
500 8022657147
501 8022798335
502 8022893869
503 8022915761
504 8022951106
505 8022951606
506 8023442652
507 8023449515
508 8051954353
509 8052175568
510 8055533836
511 8055536531
512 8057584043
513 8057587548
514 8057633563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02589

LUD_dom

LUD domain

58

241

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.8011 42 230
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.7876 42 230
6bxn-assembly1.cif.gz_A crystal structure of candidatus methanoperedens nitroreducens dph2 with 4fe-4s cluster and sam 0.6255 71 136
2dx7-assembly1.cif.gz_B crystal structure of pyrococcus horikoshii ot3 aspartate racemase complex with citric acid 0.5898 71 134
1o8b-assembly1.cif.gz_A structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate. 0.554 111 192
ID Description Score Start End Superfamily
af_P77433_40_228_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8869 42 229 3.40.50.10420
af_P77433_40_228_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8734 42 229 3.40.50.10420
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8011 42 230 3.40.50.10420
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7876 42 230 3.40.50.10420
af_Q9BI24_30_213_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.6765 49 229 3.40.50.10420
ID Description Score Start End GO Terms
AF-A0A377KDH5-F1-model_v4 Transporter 0.9145 3 193
AF-C2WEA6-F1-model_v4 deleted 0.9138 25 233
AF-A0A377KDH5-F1-model_v4 Transporter 0.9099 3 193
AF-C2WEA6-F1-model_v4 deleted 0.9095 25 233
AF-A0A845EL87-F1-model_v4 deleted 0.8989 46 233

Map