F367515

General Info

Members Datasets Scaffolds Average Seq Length
257 155 257 247

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0245669|Ga0451576_0245669_684_1460
Length 258
Sequence MGASDAGGASPAPSASDTASAQALRYSVVVPVFNEAENIGPFCRQAKQMLPAGYELLVCYDFDEDNTLPALAALKDDEKPPLVRLVRNRLGRGVRYAIEAGMQAAQAPVVLVTMVDLSDDLTNAEQMIAKAEAGADVVCGSRYMKGGQQIGGPRLKGLLSRTAGLTLHWFAGLPTHDPTNSFKVYRREFLKRTPIESTAGFCLGLELTVKAHFAGSRIEEVPAIWTDRAAGESRFQLRKWLPMYLRWYVMALRKRWVG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 6.61
Rhizosphere 92.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100046475 3300005329 Unclassified 4011
2 Ga0070683_100248956 3300005329 Bacteria 1690
3 Ga0070692_10057287 3300005345 Bacteria 2043
4 Ga0070669_100253472 3300005353 Bacteria 1402
5 Ga0070675_100050943 3300005354 Unclassified 3401
6 Ga0070673_100665490 3300005364 Bacteria 954
7 Ga0070659_100058950 3300005366 Bacteria 3031
8 Ga0070667_100324436 3300005367 Bacteria 1390
9 Ga0070705_100066083 3300005440 Bacteria 2168
10 Ga0070705_100099970 3300005440 Bacteria 1829
11 Ga0070694_100262811 3300005444 Unclassified 1310
12 Ga0070694_100277426 3300005444 Bacteria 1277
13 Ga0070694_100294968 3300005444 Unclassified 1241
14 Ga0070708_100099337 3300005445 Bacteria 2662
15 Ga0070708_100140406 3300005445 Bacteria 2240
16 Ga0070681_10216763 3300005458 Bacteria 1830
17 Ga0068867_100091540 3300005459 Bacteria 2309
18 Ga0070685_10039001 3300005466 Bacteria 2696
19 Ga0070706_100000164 3300005467 Bacteria 84577
20 Ga0070706_100146038 3300005467 Bacteria 2208
21 Ga0070707_100000658 3300005468 Bacteria 34404
22 Ga0070707_100001508 3300005468 Bacteria 22712
23 Ga0070707_100093206 3300005468 Bacteria 2916
24 Ga0070707_100451260 3300005468 Bacteria 1246
25 Ga0070707_100627196 3300005468 Bacteria 1037
26 Ga0070707_100664906 3300005468 Bacteria 1004
27 Ga0070698_100000619 3300005471 Bacteria 38232
28 Ga0070698_100004584 3300005471 Bacteria 15177
29 Ga0070698_100006767 3300005471 Bacteria 12428
30 Ga0070698_100054825 3300005471 Bacteria 4046
31 Ga0070698_100162236 3300005471 Unclassified 2179
32 Ga0070699_100031311 3300005518 Bacteria 4591
33 Ga0070699_100516587 3300005518 Bacteria 1085
34 Ga0070699_100549637 3300005518 Bacteria 1051
35 Ga0070684_100083631 3300005535 Bacteria 2828
36 Ga0070697_100025318 3300005536 Bacteria 4733
37 Ga0070697_100041822 3300005536 Bacteria 3710
38 Ga0070697_100196160 3300005536 Bacteria 1715
39 Ga0070697_100504555 3300005536 Unclassified 1058
40 Ga0070695_100007371 3300005545 Bacteria 6523
41 Ga0070696_100002735 3300005546 Bacteria 11706
42 Ga0070696_100025769 3300005546 Bacteria 3999
43 Ga0070696_100045431 3300005546 Bacteria 3043
44 Ga0070696_100270045 3300005546 Bacteria 1293
45 Ga0070665_100821011 3300005548 Bacteria 943
46 Ga0070704_100080065 3300005549 Unclassified 2401
47 Ga0068855_100273487 3300005563 Bacteria 1878
48 Ga0070702_100008290 3300005615 Bacteria 5023
49 Ga0068864_100217452 3300005618 Bacteria 1762
50 Ga0068860_100036761 3300005843 Bacteria 4689
51 Ga0068860_100267248 3300005843 Bacteria 1668
52 Ga0068862_100327892 3300005844 Bacteria 1415
53 Ga0081539_10019480 3300005985 Unclassified 4641
54 Ga0070717_10713870 3300006028 Bacteria 911
55 Ga0075365_10021471 3300006038 Bacteria 4029
56 Ga0070716_100292538 3300006173 Bacteria 1129
57 Ga0070712_100150175 3300006175 Bacteria 1788
58 Ga0075428_100000307 3300006844 Bacteria 48150
59 Ga0075428_100046651 3300006844 Bacteria 4758
60 Ga0075434_100681300 3300006871 Unclassified 1046
61 Ga0068865_100174272 3300006881 Bacteria 1652
62 Ga0075436_100011024 3300006914 Bacteria 6203
63 Ga0111539_10256159 3300009094 Unclassified 2038
64 Ga0114129_10024953 3300009147 Bacteria 8475
65 Ga0114129_10191459 3300009147 Bacteria 2777
66 Ga0114129_10206797 3300009147 Bacteria 2655
67 Ga0114129_10612613 3300009147 Bacteria 1409
68 Ga0105243_10178940 3300009148 Bacteria 1843
69 Ga0105243_10495830 3300009148 Bacteria 1156
70 Ga0105243_10647020 3300009148 Bacteria 1024
71 Ga0105242_10011928 3300009176 Bacteria 6690
72 Ga0105242_10359922 3300009176 Bacteria 1346
73 Ga0105249_10014357 3300009553 Bacteria 7002
74 Ga0105249_10187608 3300009553 Bacteria 2016
75 Ga0105239_11423822 3300010375 Unclassified 800
76 Ga0105246_10024601 3300011119 Bacteria 3914
77 Ga0105246_10195885 3300011119 Bacteria 1567
78 Ga0157378_10146463 3300013297 Bacteria 2197
79 Ga0157378_10173041 3300013297 Bacteria 2026
80 Ga0157378_10276894 3300013297 Bacteria 1616
81 Ga0163162_10162689 3300013306 Unclassified 2354
82 Ga0163163_10115541 3300014325 Bacteria 2715
83 Ga0157377_10016077 3300014745 Unclassified 3843
84 Ga0157379_10568100 3300014968 Bacteria 1056
85 Ga0163161_10046823 3300017792 Bacteria 3121
86 Ga0163161_10246574 3300017792 Bacteria 1391
87 Ga0207653_10041432 3300025885 Bacteria 1513
88 Ga0207688_10430502 3300025901 Bacteria 821
89 Ga0207684_10000452 3300025910 Bacteria 53994
90 Ga0207684_10095315 3300025910 Bacteria 2539
91 Ga0207684_10245205 3300025910 Bacteria 1546
92 Ga0207693_10139000 3300025915 Bacteria 1910
93 Ga0207662_10008455 3300025918 Bacteria 5636
94 Ga0207662_10175639 3300025918 Bacteria 1376
95 Ga0207662_10301590 3300025918 Bacteria 1065
96 Ga0207646_10002163 3300025922 Bacteria 23479
97 Ga0207646_10006121 3300025922 Bacteria 12527
98 Ga0207646_10071365 3300025922 Bacteria 3101
99 Ga0207646_10089942 3300025922 Bacteria 2748
100 Ga0207646_10137013 3300025922 Bacteria 2204
101 Ga0207646_10277240 3300025922 Bacteria 1515
102 Ga0207681_10131750 3300025923 Unclassified 1850
103 Ga0207650_10173765 3300025925 Bacteria 1713
104 Ga0207659_10219714 3300025926 Bacteria 1527
105 Ga0207687_10099323 3300025927 Bacteria 2139
106 Ga0207690_10293360 3300025932 Bacteria 1270
107 Ga0207686_10091534 3300025934 Bacteria 2009
108 Ga0207686_10223615 3300025934 Bacteria 1361
109 Ga0207709_10107306 3300025935 Bacteria 1859
110 Ga0207709_10116020 3300025935 Unclassified 1799
111 Ga0207709_10419866 3300025935 Bacteria 1027
112 Ga0207709_10521540 3300025935 Unclassified 930
113 Ga0207669_10003600 3300025937 Bacteria 6721
114 Ga0207669_10408331 3300025937 Bacteria 1066
115 Ga0207689_10204401 3300025942 Bacteria 1631
116 Ga0207667_10775356 3300025949 Unclassified 957
117 Ga0207712_10032613 3300025961 Bacteria 3516
118 Ga0207640_10042626 3300025981 Bacteria 2895
119 Ga0207640_10348990 3300025981 Bacteria 1188
120 Ga0207678_10054394 3300026067 Unclassified 3448
121 Ga0207678_10564819 3300026067 Archaea 996
122 Ga0207648_10109708 3300026089 Bacteria 2422
123 Ga0207674_10029966 3300026116 Bacteria 5725
124 Ga0207675_100179343 3300026118 Bacteria 2028
125 Ga0207683_10478119 3300026121 Bacteria 1150
126 Ga0268265_10487612 3300028380 Unclassified 1159
127 Ga0268264_10125078 3300028381 Bacteria 2271
128 Ga0265319_1001213 3300028563 Bacteria 15907
129 Ga0265334_10008086 3300028573 Bacteria 4485
130 Ga0265334_10060550 3300028573 Bacteria 1429
131 Ga0265318_10035464 3300028577 Bacteria 1917
132 Ga0265322_10032208 3300028654 Bacteria 1495
133 Ga0265336_10002467 3300028666 Bacteria 7597
134 Ga0265338_10045858 3300028800 Bacteria 4014
135 Ga0265324_10019001 3300029957 Bacteria 2477
136 Ga0265330_10031769 3300031235 Bacteria 2367
137 Ga0265320_10005877 3300031240 Bacteria 7811
138 Ga0265325_10148676 3300031241 Bacteria 1109
139 Ga0265329_10006336 3300031242 Bacteria 4702
140 Ga0265340_10001704 3300031247 Bacteria 12618
141 Ga0265339_10084948 3300031249 Bacteria 1667
142 Ga0265331_10093863 3300031250 Bacteria 1385
143 Ga0265316_10037284 3300031344 Bacteria 3926
144 Ga0265316_10376225 3300031344 Bacteria 1025
145 Ga0265313_10047182 3300031595 Bacteria 2086
146 Ga0265314_10059716 3300031711 Bacteria 2607
147 Ga0265342_10109099 3300031712 Bacteria 1568
148 Ga0316576_10373054 3300031727 Unclassified 1060
149 Ga0316577_10000183 3300031733 Bacteria 20441
150 Ga0307406_10090949 3300031901 Unclassified 2055
151 Ga0307415_100041546 3300032126 Bacteria 3054
152 Ga0373944_0092966 3300035089 Unclassified 1010
153 Ga0316584_0027581 3300036712 Bacteria 4181
154 Ga0439466_0110719 3300041411 Unclassified 852
155 Ga0451577_0207366 3300042876 Bacteria 1770
156 Ga0453683_0069928 3300044673 Bacteria 2195
157 Ga0453684_0022046 3300044712 Bacteria 9473
158 Ga0466959_0103590 3300045049 Bacteria 2036
159 Ga0451576_0155674 3300045051 Bacteria 2384
160 Ga0451576_0245669 3300045051 Bacteria 1870
161 Ga0495651_0355496 3300046462 Bacteria 967
162 Ga0495644_0125557 3300046523 Bacteria 977
163 Ga0495581_0264032 3300047315 Bacteria 1007
164 Ga0495676_0244621 3300047321 Bacteria 1227
165 Ga0496100_0333797 3300048903 Unclassified 1142
166 Ga0496102_0111727 3300048905 Bacteria 2548
167 Ga0496102_0463788 3300048905 Bacteria 1188
168 Ga0496103_0013622 3300048906 Bacteria 4824
169 Ga0496103_0052656 3300048906 Bacteria 2521
170 Ga0496104_0205994 3300048907 Bacteria 1879
171 Ga0496106_0072495 3300048909 Bacteria 2634
172 Ga0496107_0034176 3300048910 Unclassified 3641
173 Ga0496108_0143400 3300048911 Bacteria 2058
174 Ga0496109_0052658 3300048912 Unclassified 3710
175 Ga0496109_0102760 3300048912 Bacteria 2652
176 Ga0496111_0073441 3300048914 Bacteria 2491
177 Ga0496111_0165404 3300048914 Bacteria 1643
178 Ga0496112_0523972 3300048915 Bacteria 1120
179 Ga0496113_0013721 3300048916 Bacteria 5502
180 Ga0496113_0062716 3300048916 Bacteria 2808
181 Ga0496113_0618941 3300048916 Unclassified 867
182 Ga0501031_0004093 3300049568 Bacteria 9415
183 Ga0501031_0028128 3300049568 Bacteria 3665
184 Ga0501031_0370420 3300049568 Bacteria 927
185 Ga0501036_0070627 3300049572 Bacteria 2953
186 Ga0501037_0121394 3300049573 Unclassified 1879
187 Ga0501038_0131318 3300049574 Bacteria 2056
188 Ga0501039_0024967 3300049575 Bacteria 4590
189 Ga0501039_0027914 3300049575 Bacteria 4341
190 Ga0501039_0097827 3300049575 Bacteria 2289
191 Ga0501040_0023444 3300049576 Bacteria 4139
192 Ga0501041_0015699 3300049577 Bacteria 4498
193 Ga0501041_0349521 3300049577 Unclassified 934
194 Ga0501042_0006562 3300049578 Bacteria 7566
195 Ga0501042_0180509 3300049578 Unclassified 1523
196 Ga0501043_0196905 3300049579 Bacteria 1565
197 Ga0501046_0118589 3300049580 Bacteria 2015
198 Ga0501047_0247860 3300049581 Bacteria 1630
199 Ga0501048_0013435 3300049582 Bacteria 6077
200 Ga0501048_0028819 3300049582 Bacteria 4030
201 Ga0501048_0046743 3300049582 Bacteria 3090
202 Ga0501048_0102496 3300049582 Bacteria 2019
203 Ga0501068_0105896 3300049584 Bacteria 1746
204 Ga0501068_0114873 3300049584 Bacteria 1676
205 Ga0501070_0062927 3300049586 Bacteria 3074
206 Ga0501071_0005245 3300049587 Bacteria 8306
207 Ga0501071_0111945 3300049587 Bacteria 2018
208 Ga0501072_0008054 3300049588 Bacteria 8000
209 Ga0501072_0011214 3300049588 Bacteria 6841
210 Ga0501072_0099909 3300049588 Bacteria 2306
211 Ga0501072_0231429 3300049588 Bacteria 1472
212 Ga0501073_0144062 3300049589 Bacteria 1651
213 Ga0501073_0419633 3300049589 Bacteria 925
214 Ga0501074_0188212 3300049590 Bacteria 1472
215 Ga0501074_0611668 3300049590 Bacteria 770
216 Ga0501075_0003190 3300049591 Bacteria 10971
217 Ga0501075_0003666 3300049591 Bacteria 10304
218 Ga0501075_0025284 3300049591 Bacteria 4363
219 Ga0501075_0191886 3300049591 Unclassified 1558
220 Ga0501075_0423314 3300049591 Bacteria 1015
221 Ga0501075_0431847 3300049591 Bacteria 1004
222 Ga0501076_0004973 3300049592 Bacteria 9518
223 Ga0501076_0009139 3300049592 Bacteria 7299
224 Ga0501076_0035794 3300049592 Bacteria 3885
225 Ga0501076_0111763 3300049592 Bacteria 2209
226 Ga0501079_0003467 3300049741 Bacteria 11594
227 Ga0501079_0029804 3300049741 Bacteria 4191
228 Ga0501079_0195483 3300049741 Bacteria 1579
229 Ga0501080_0016651 3300049742 Bacteria 6789
230 Ga0501080_0167769 3300049742 Bacteria 2026
231 Ga0501081_0008761 3300049743 Bacteria 6574
232 Ga0501081_0039294 3300049743 Bacteria 3237
233 Ga0501081_0094080 3300049743 Unclassified 2111
234 Ga0501035_0222064 3300049822 Bacteria 1613
235 Ga0501045_0006112 3300049824 Bacteria 8339
236 Ga0501045_0021962 3300049824 Bacteria 4567
237 Ga0501045_0338286 3300049824 Bacteria 1120
238 nmdc:mga05p37_182979_c1 3300050507 Bacteria 2549
239 nmdc:mga05p37_692495_c1 3300050507 Bacteria 1134
240 nmdc:mga06r32_628506_c1 3300050510 Unclassified 1043
241 nmdc:mga08y16_382405_c1 3300050511 Bacteria 1443
242 nmdc:mga0a205_428000_c1 3300050515 Bacteria 1185
243 nmdc:mga0a205_64694_c1 3300050515 Bacteria 3533
244 Ga0495619_0264561 3300053085 Bacteria 1192
245 Ga0495619_0289014 3300053085 Bacteria 1136
246 Ga0500555_017557 3300053103 Bacteria 2062
247 Ga0501084_0012189 3300054114 Bacteria 7115
248 Ga0501084_0022011 3300054114 Bacteria 5318
249 Ga0501084_0241065 3300054114 Bacteria 1526
250 Ga0590071_001646 3300059421 Bacteria 5828
251 Ga0501082_0005946 3300060353 Bacteria 10587
252 Ga0501082_0014066 3300060353 Bacteria 6882
253 Ga0501082_0326358 3300060353 Bacteria 1337
254 Ga0530510_0005177 3300061734 Bacteria 9000
255 Ga0530510_0353139 3300061734 Bacteria 1104
256 Ga0530510_0359614 3300061734 Bacteria 1094
257 Ga0530510_0375851 3300061734 Bacteria 1069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10301590 Ga0207662_103015902 221
2 3300031727 Ga0316576_10373054 Ga0316576_103730542 227
3 3300031733 Ga0316577_10000183 Ga0316577_1000018315 227
4 3300036712 Ga0316584_0027581 Ga0316584_0027581_1041_1784 227
5 3300044712 Ga0453684_0022046 Ga0453684_0022046_5564_6271 231
6 3300025949 Ga0207667_10775356 Ga0207667_107753561 232
7 3300005468 Ga0070707_100627196 Ga0070707_1006271961 233
8 3300005518 Ga0070699_100516587 Ga0070699_1005165871 233
9 3300005536 Ga0070697_100196160 Ga0070697_1001961602 233
10 3300006028 Ga0070717_10713870 Ga0070717_107138701 233
11 3300025922 Ga0207646_10071365 Ga0207646_100713653 233
12 3300053103 Ga0500555_017557 Ga0500555_017557_803_1522 233
13 3300005468 Ga0070707_100093206 Ga0070707_1000932064 234
14 3300005471 Ga0070698_100054825 Ga0070698_1000548254 234
15 3300006844 Ga0075428_100000307 Ga0075428_10000030717 234
16 3300009147 Ga0114129_10612613 Ga0114129_106126132 234
17 3300025918 Ga0207662_10175639 Ga0207662_101756391 234
18 3300025922 Ga0207646_10277240 Ga0207646_102772402 234
19 3300045049 Ga0466959_0103590 Ga0466959_0103590_1008_1757 235
20 3300049581 Ga0501047_0247860 Ga0501047_0247860_724_1443 235
21 3300005471 Ga0070698_100006767 Ga0070698_10000676711 236
22 3300048916 Ga0496113_0618941 Ga0496113_0618941_88_804 236
23 3300005843 Ga0068860_100036761 Ga0068860_1000367611 237
24 3300006914 Ga0075436_100011024 Ga0075436_1000110245 237
25 3300009176 Ga0105242_10359922 Ga0105242_103599222 237
26 3300011119 Ga0105246_10195885 Ga0105246_101958851 237
27 3300013297 Ga0157378_10173041 Ga0157378_101730412 237
28 3300025901 Ga0207688_10430502 Ga0207688_104305021 237
29 3300025923 Ga0207681_10131750 Ga0207681_101317502 237
30 3300050515 nmdc:mga0a205_64694_c1 nmdc:mga0a205_64694_c1_337_1068 237
31 3300006173 Ga0070716_100292538 Ga0070716_1002925381 238
32 3300006175 Ga0070712_100150175 Ga0070712_1001501752 238
33 3300025915 Ga0207693_10139000 Ga0207693_101390002 238
34 3300026121 Ga0207683_10478119 Ga0207683_104781192 238
35 3300028563 Ga0265319_1001213 Ga0265319_10012134 238
36 3300028573 Ga0265334_10008086 Ga0265334_100080866 238
37 3300028577 Ga0265318_10035464 Ga0265318_100354642 238
38 3300028654 Ga0265322_10032208 Ga0265322_100322082 238
39 3300028666 Ga0265336_10002467 Ga0265336_100024674 238
40 3300028800 Ga0265338_10045858 Ga0265338_100458581 238
41 3300029957 Ga0265324_10019001 Ga0265324_100190011 238
42 3300031235 Ga0265330_10031769 Ga0265330_100317692 238
43 3300031240 Ga0265320_10005877 Ga0265320_100058775 238
44 3300031241 Ga0265325_10148676 Ga0265325_101486762 238
45 3300031242 Ga0265329_10006336 Ga0265329_100063365 238
46 3300031247 Ga0265340_10001704 Ga0265340_100017044 238
47 3300031249 Ga0265339_10084948 Ga0265339_100849482 238
48 3300031250 Ga0265331_10093863 Ga0265331_100938632 238
49 3300031344 Ga0265316_10037284 Ga0265316_100372845 238
50 3300031595 Ga0265313_10047182 Ga0265313_100471822 238
51 3300031711 Ga0265314_10059716 Ga0265314_100597162 238
52 3300031712 Ga0265342_10109099 Ga0265342_101090992 238
53 3300005536 Ga0070697_100041822 Ga0070697_1000418224 239
54 3300013297 Ga0157378_10276894 Ga0157378_102768941 239
55 3300047315 Ga0495581_0264032 Ga0495581_0264032_144_866 239
56 3300047321 Ga0495676_0244621 Ga0495676_0244621_35_757 239
57 3300048912 Ga0496109_0102760 Ga0496109_0102760_1724_2536 239
58 3300048914 Ga0496111_0073441 Ga0496111_0073441_1535_2347 239
59 3300005353 Ga0070669_100253472 Ga0070669_1002534722 240
60 3300005444 Ga0070694_100294968 Ga0070694_1002949682 240
61 3300005471 Ga0070698_100004584 Ga0070698_1000045844 240
62 3300009147 Ga0114129_10206797 Ga0114129_102067972 240
63 3300009148 Ga0105243_10495830 Ga0105243_104958302 240
64 3300025935 Ga0207709_10419866 Ga0207709_104198661 240
65 3300031344 Ga0265316_10376225 Ga0265316_103762251 240
66 3300049568 Ga0501031_0004093 Ga0501031_0004093_6662_7393 240
67 3300049568 Ga0501031_0370420 Ga0501031_0370420_97_828 240
68 3300049573 Ga0501037_0121394 Ga0501037_0121394_500_1231 240
69 3300049575 Ga0501039_0097827 Ga0501039_0097827_1143_1874 240
70 3300049577 Ga0501041_0349521 Ga0501041_0349521_76_807 240
71 3300049578 Ga0501042_0180509 Ga0501042_0180509_618_1349 240
72 3300049582 Ga0501048_0046743 Ga0501048_0046743_1735_2466 240
73 3300049582 Ga0501048_0102496 Ga0501048_0102496_462_1193 240
74 3300049584 Ga0501068_0114873 Ga0501068_0114873_652_1383 240
75 3300049587 Ga0501071_0111945 Ga0501071_0111945_121_852 240
76 3300049588 Ga0501072_0011214 Ga0501072_0011214_4834_5565 240
77 3300049588 Ga0501072_0099909 Ga0501072_0099909_1066_1797 240
78 3300049589 Ga0501073_0419633 Ga0501073_0419633_45_776 240
79 3300049590 Ga0501074_0188212 Ga0501074_0188212_127_858 240
80 3300049591 Ga0501075_0003666 Ga0501075_0003666_2251_2982 240
81 3300049591 Ga0501075_0191886 Ga0501075_0191886_754_1485 240
82 3300049591 Ga0501075_0423314 Ga0501075_0423314_268_999 240
83 3300049591 Ga0501075_0431847 Ga0501075_0431847_220_951 240
84 3300049592 Ga0501076_0004973 Ga0501076_0004973_7264_7995 240
85 3300049592 Ga0501076_0111763 Ga0501076_0111763_181_912 240
86 3300049741 Ga0501079_0029804 Ga0501079_0029804_1924_2655 240
87 3300049742 Ga0501080_0167769 Ga0501080_0167769_100_831 240
88 3300049743 Ga0501081_0039294 Ga0501081_0039294_276_1007 240
89 3300049743 Ga0501081_0094080 Ga0501081_0094080_551_1282 240
90 3300049824 Ga0501045_0006112 Ga0501045_0006112_590_1321 240
91 3300049824 Ga0501045_0338286 Ga0501045_0338286_305_1036 240
92 3300050507 nmdc:mga05p37_692495_c1 nmdc:mga05p37_692495_c1_76_807 240
93 3300054114 Ga0501084_0022011 Ga0501084_0022011_3999_4730 240
94 3300060353 Ga0501082_0005946 Ga0501082_0005946_6241_6972 240
95 3300060353 Ga0501082_0326358 Ga0501082_0326358_56_787 240
96 3300061734 Ga0530510_0353139 Ga0530510_0353139_223_954 240
97 3300061734 Ga0530510_0359614 Ga0530510_0359614_193_924 240
98 3300061734 Ga0530510_0375851 Ga0530510_0375851_67_798 240
99 3300005471 Ga0070698_100000619 Ga0070698_10000061927 241
100 3300009148 Ga0105243_10178940 Ga0105243_101789402 241
101 3300017792 Ga0163161_10246574 Ga0163161_102465742 241
102 3300025934 Ga0207686_10091534 Ga0207686_100915342 241
103 3300025935 Ga0207709_10521540 Ga0207709_105215402 241
104 3300025981 Ga0207640_10042626 Ga0207640_100426262 241
105 3300028573 Ga0265334_10060550 Ga0265334_100605502 241
106 3300041411 Ga0439466_0110719 Ga0439466_0110719_105_836 241
107 3300042876 Ga0451577_0207366 Ga0451577_0207366_648_1385 241
108 3300046462 Ga0495651_0355496 Ga0495651_0355496_59_796 241
109 3300046523 Ga0495644_0125557 Ga0495644_0125557_192_929 241
110 3300048905 Ga0496102_0111727 Ga0496102_0111727_727_1467 241
111 3300049572 Ga0501036_0070627 Ga0501036_0070627_741_1481 241
112 3300049575 Ga0501039_0027914 Ga0501039_0027914_2387_3127 241
113 3300049582 Ga0501048_0013435 Ga0501048_0013435_2157_2897 241
114 3300049588 Ga0501072_0231429 Ga0501072_0231429_373_1107 241
115 3300049591 Ga0501075_0025284 Ga0501075_0025284_1483_2223 241
116 3300049592 Ga0501076_0035794 Ga0501076_0035794_292_1032 241
117 3300049741 Ga0501079_0195483 Ga0501079_0195483_347_1087 241
118 3300049824 Ga0501045_0021962 Ga0501045_0021962_3350_4090 241
119 3300053085 Ga0495619_0289014 Ga0495619_0289014_30_770 241
120 3300054114 Ga0501084_0241065 Ga0501084_0241065_232_966 241
121 3300005440 Ga0070705_100066083 Ga0070705_1000660832 242
122 3300005444 Ga0070694_100277426 Ga0070694_1002774262 242
123 3300005445 Ga0070708_100099337 Ga0070708_1000993373 242
124 3300005467 Ga0070706_100000164 Ga0070706_10000016473 242
125 3300005468 Ga0070707_100000658 Ga0070707_1000006588 242
126 3300005468 Ga0070707_100451260 Ga0070707_1004512602 242
127 3300005468 Ga0070707_100664906 Ga0070707_1006649061 242
128 3300005471 Ga0070698_100162236 Ga0070698_1001622362 242
129 3300005518 Ga0070699_100549637 Ga0070699_1005496371 242
130 3300005546 Ga0070696_100045431 Ga0070696_1000454313 242
131 3300025885 Ga0207653_10041432 Ga0207653_100414322 242
132 3300025910 Ga0207684_10000452 Ga0207684_1000045210 242
133 3300025910 Ga0207684_10095315 Ga0207684_100953153 242
134 3300025922 Ga0207646_10002163 Ga0207646_100021638 242
135 3300025922 Ga0207646_10089942 Ga0207646_100899423 242
136 3300025922 Ga0207646_10137013 Ga0207646_101370131 242
137 3300025927 Ga0207687_10099323 Ga0207687_100993231 242
138 3300025937 Ga0207669_10408331 Ga0207669_104083311 242
139 3300026067 Ga0207678_10564819 Ga0207678_105648192 242
140 3300035089 Ga0373944_0092966 Ga0373944_0092966_130_906 242
141 3300045051 Ga0451576_0245669 Ga0451576_0245669_684_1460 242
142 3300048906 Ga0496103_0013622 Ga0496103_0013622_2345_3079 242
143 3300048907 Ga0496104_0205994 Ga0496104_0205994_528_1262 242
144 3300048914 Ga0496111_0165404 Ga0496111_0165404_73_807 242
145 3300049568 Ga0501031_0028128 Ga0501031_0028128_1065_1805 242
146 3300049574 Ga0501038_0131318 Ga0501038_0131318_561_1301 242
147 3300049575 Ga0501039_0024967 Ga0501039_0024967_3066_3806 242
148 3300049576 Ga0501040_0023444 Ga0501040_0023444_1705_2445 242
149 3300049577 Ga0501041_0015699 Ga0501041_0015699_2977_3717 242
150 3300049578 Ga0501042_0006562 Ga0501042_0006562_2732_3472 242
151 3300049579 Ga0501043_0196905 Ga0501043_0196905_318_1058 242
152 3300049580 Ga0501046_0118589 Ga0501046_0118589_924_1664 242
153 3300049582 Ga0501048_0028819 Ga0501048_0028819_2059_2799 242
154 3300049586 Ga0501070_0062927 Ga0501070_0062927_524_1264 242
155 3300049587 Ga0501071_0005245 Ga0501071_0005245_1854_2594 242
156 3300049588 Ga0501072_0008054 Ga0501072_0008054_924_1664 242
157 3300049589 Ga0501073_0144062 Ga0501073_0144062_12_752 242
158 3300049590 Ga0501074_0611668 Ga0501074_0611668_17_757 242
159 3300049591 Ga0501075_0003190 Ga0501075_0003190_7029_7769 242
160 3300049592 Ga0501076_0009139 Ga0501076_0009139_4724_5464 242
161 3300049741 Ga0501079_0003467 Ga0501079_0003467_4970_5710 242
162 3300049742 Ga0501080_0016651 Ga0501080_0016651_5448_6188 242
163 3300049743 Ga0501081_0008761 Ga0501081_0008761_3999_4739 242
164 3300049822 Ga0501035_0222064 Ga0501035_0222064_105_845 242
165 3300054114 Ga0501084_0012189 Ga0501084_0012189_2932_3672 242
166 3300060353 Ga0501082_0014066 Ga0501082_0014066_4356_5096 242
167 3300061734 Ga0530510_0005177 Ga0530510_0005177_5184_5924 242
168 3300005329 Ga0070683_100248956 Ga0070683_1002489562 243
169 3300005440 Ga0070705_100099970 Ga0070705_1000999702 243
170 3300005467 Ga0070706_100146038 Ga0070706_1001460382 243
171 3300005536 Ga0070697_100025318 Ga0070697_1000253184 243
172 3300005536 Ga0070697_100504555 Ga0070697_1005045552 243
173 3300005545 Ga0070695_100007371 Ga0070695_1000073712 243
174 3300005546 Ga0070696_100002735 Ga0070696_10000273510 243
175 3300005549 Ga0070704_100080065 Ga0070704_1000800652 243
176 3300006871 Ga0075434_100681300 Ga0075434_1006813001 243
177 3300025910 Ga0207684_10245205 Ga0207684_102452052 243
178 3300025935 Ga0207709_10116020 Ga0207709_101160202 243
179 3300048903 Ga0496100_0333797 Ga0496100_0333797_118_897 243
180 3300048906 Ga0496103_0052656 Ga0496103_0052656_1623_2360 243
181 3300005444 Ga0070694_100262811 Ga0070694_1002628112 244
182 3300005546 Ga0070696_100025769 Ga0070696_1000257692 244
183 3300005563 Ga0068855_100273487 Ga0068855_1002734872 244
184 3300005985 Ga0081539_10019480 Ga0081539_100194804 244
185 3300009147 Ga0114129_10191459 Ga0114129_101914592 244
186 3300009553 Ga0105249_10014357 Ga0105249_100143573 244
187 3300025961 Ga0207712_10032613 Ga0207712_100326132 244
188 3300026118 Ga0207675_100179343 Ga0207675_1001793432 244
189 3300028380 Ga0268265_10487612 Ga0268265_104876122 244
190 3300044673 Ga0453683_0069928 Ga0453683_0069928_1270_2013 244
191 3300045051 Ga0451576_0155674 Ga0451576_0155674_947_1690 244
192 3300048909 Ga0496106_0072495 Ga0496106_0072495_1313_2098 244
193 3300049584 Ga0501068_0105896 Ga0501068_0105896_592_1362 244
194 3300050507 nmdc:mga05p37_182979_c1 nmdc:mga05p37_182979_c1_1229_1990 244
195 3300050511 nmdc:mga08y16_382405_c1 nmdc:mga08y16_382405_c1_472_1230 244
196 3300059421 Ga0590071_001646 Ga0590071_001646_4058_4801 244
197 3300048916 Ga0496113_0013721 Ga0496113_0013721_2957_3838 246
198 3300005445 Ga0070708_100140406 Ga0070708_1001404062 247
199 3300005468 Ga0070707_100001508 Ga0070707_1000015084 247
200 3300005518 Ga0070699_100031311 Ga0070699_1000313113 247
201 3300005548 Ga0070665_100821011 Ga0070665_1008210112 247
202 3300005844 Ga0068862_100327892 Ga0068862_1003278921 247
203 3300025922 Ga0207646_10006121 Ga0207646_100061218 247
204 3300005458 Ga0070681_10216763 Ga0070681_102167632 248
205 3300014325 Ga0163163_10115541 Ga0163163_101155412 248
206 3300031901 Ga0307406_10090949 Ga0307406_100909492 248
207 3300032126 Ga0307415_100041546 Ga0307415_1000415463 248
208 3300050510 nmdc:mga06r32_628506_c1 nmdc:mga06r32_628506_c1_58_810 248
209 3300053085 Ga0495619_0264561 Ga0495619_0264561_80_850 248
210 3300005329 Ga0070683_100046475 Ga0070683_1000464752 250
211 3300005345 Ga0070692_10057287 Ga0070692_100572871 250
212 3300005354 Ga0070675_100050943 Ga0070675_1000509432 250
213 3300005364 Ga0070673_100665490 Ga0070673_1006654902 250
214 3300005366 Ga0070659_100058950 Ga0070659_1000589503 250
215 3300005367 Ga0070667_100324436 Ga0070667_1003244362 250
216 3300005459 Ga0068867_100091540 Ga0068867_1000915402 250
217 3300005466 Ga0070685_10039001 Ga0070685_100390012 250
218 3300005535 Ga0070684_100083631 Ga0070684_1000836313 250
219 3300005546 Ga0070696_100270045 Ga0070696_1002700451 250
220 3300005615 Ga0070702_100008290 Ga0070702_1000082904 250
221 3300005618 Ga0068864_100217452 Ga0068864_1002174522 250
222 3300005843 Ga0068860_100267248 Ga0068860_1002672481 250
223 3300006038 Ga0075365_10021471 Ga0075365_100214714 250
224 3300006844 Ga0075428_100046651 Ga0075428_1000466513 250
225 3300006881 Ga0068865_100174272 Ga0068865_1001742722 250
226 3300009094 Ga0111539_10256159 Ga0111539_102561592 250
227 3300009147 Ga0114129_10024953 Ga0114129_100249536 250
228 3300009148 Ga0105243_10647020 Ga0105243_106470201 250
229 3300009176 Ga0105242_10011928 Ga0105242_100119282 250
230 3300009553 Ga0105249_10187608 Ga0105249_101876082 250
231 3300010375 Ga0105239_11423822 Ga0105239_114238221 250
232 3300011119 Ga0105246_10024601 Ga0105246_100246011 250
233 3300013297 Ga0157378_10146463 Ga0157378_101464633 250
234 3300013306 Ga0163162_10162689 Ga0163162_101626893 250
235 3300014745 Ga0157377_10016077 Ga0157377_100160773 250
236 3300014968 Ga0157379_10568100 Ga0157379_105681002 250
237 3300017792 Ga0163161_10046823 Ga0163161_100468232 250
238 3300025918 Ga0207662_10008455 Ga0207662_100084552 250
239 3300025925 Ga0207650_10173765 Ga0207650_101737652 250
240 3300025926 Ga0207659_10219714 Ga0207659_102197142 250
241 3300025932 Ga0207690_10293360 Ga0207690_102933602 250
242 3300025934 Ga0207686_10223615 Ga0207686_102236152 250
243 3300025935 Ga0207709_10107306 Ga0207709_101073062 250
244 3300025937 Ga0207669_10003600 Ga0207669_100036005 250
245 3300025942 Ga0207689_10204401 Ga0207689_102044012 250
246 3300025981 Ga0207640_10348990 Ga0207640_103489902 250
247 3300026067 Ga0207678_10054394 Ga0207678_100543943 250
248 3300026089 Ga0207648_10109708 Ga0207648_101097082 250
249 3300026116 Ga0207674_10029966 Ga0207674_100299663 250
250 3300028381 Ga0268264_10125078 Ga0268264_101250782 250
251 3300048905 Ga0496102_0463788 Ga0496102_0463788_388_1143 250
252 3300048910 Ga0496107_0034176 Ga0496107_0034176_319_1074 250
253 3300048911 Ga0496108_0143400 Ga0496108_0143400_1198_1950 250
254 3300048912 Ga0496109_0052658 Ga0496109_0052658_1242_1994 250
255 3300048915 Ga0496112_0523972 Ga0496112_0523972_167_919 250
256 3300048916 Ga0496113_0062716 Ga0496113_0062716_703_1458 250
257 3300050515 nmdc:mga0a205_428000_c1 nmdc:mga0a205_428000_c1_252_1007 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

27

193

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8448 11 234
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8435 13 235
3e25-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.7664 11 213
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7615 10 213
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7598 11 234
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8479 1 250 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.846 13 231 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8448 1 250 3.90.550.10
af_A0A0R0GWU7_24_252_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8331 13 230 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8153 13 231 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F5HPY9-F1-model_v4 Glycosyl transferase family 2 0.9756 11 240 GO:0004582
AF-A0A535PE87-F1-model_v4 Glycosyltransferase family 2 protein 0.9755 17 250 GO:0016757
AF-E8R4N1-F1-model_v4 Glycosyl transferase family 2 0.9745 10 240 GO:0005886
GO:0016757
AF-A0A1F6HQ91-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9735 11 240 GO:0004582
AF-A0A348XJP6-F1-model_v4 Glycosyl transferase family 2 0.9724 10 242 GO:0016757

Feature Viewer

pLDDT pTM Quality
90.91 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map