F367481

General Info

Members Datasets Scaffolds Average Seq Length
257 186 514 323

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1468842|Ga0436363_1468842_387_1514
Length 375
Sequence MPLHQTFRLPRGNADDAPWLYPTQEDSVPVPLPGRTFADAGRAVPDLDPRDPEGAIAAAARRCSNQGRWGEDDVLGTLNFLDDAKRREGAALVRRGVAFSLSQPFDTNGPQTGWRRRTNPVHTMLDTGTDAERGTQGFPHGIGGADDVVFMPLQASTQWDGLGHIFDHGRAYNGRRAGDVVTSDGDRVTGIETVRDRIAGRGVLLDVGRALGAELGTDGELPDGFAVTAAHLEATIAAQGESARVGRGDLLLVRTXQLTRARRGLAEGRGWGGYAGGPAPGLSFTTVDWLHAAEIAGIATDTWGFEVRPNEFHDAFQPLHQVAIPHIGLFLGELWDLDALAADCAADGVWEFFLVAAPLPVTGAVGAPVNPLALK

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
125 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
126 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
127 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
128 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
173 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
174 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
175 2643221548 Streptomyces sp. Root55 Isolate Unclassified
176 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
177 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
178 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
179 2643221692 Nocardia sp. Root136 Isolate Unclassified
180 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
181 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
182 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
183 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
184 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
185 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
186 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0
Isolates 4.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0.39
Rhizoplane 10.51
Rhizosphere 71.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1468842 3300039450 Bacteria 1721
2 Ga0070683_100092010 3300005329 Bacteria 2848
3 Ga0068869_100075263 3300005334 Bacteria 2508
4 Ga0070680_100292049 3300005336 Bacteria 1382
5 Ga0070682_100014822 3300005337 Bacteria 4511
6 Ga0070660_100029294 3300005339 Bacteria 4125
7 Ga0070661_100050350 3300005344 Bacteria 3048
8 Ga0070661_100122678 3300005344 Bacteria 1947
9 Ga0070692_10057096 3300005345 Bacteria 2046
10 Ga0070668_100001068 3300005347 Bacteria 19275
11 Ga0070668_100020297 3300005347 Bacteria 5013
12 Ga0070668_100300709 3300005347 Bacteria 1346
13 Ga0070675_100139535 3300005354 Bacteria 2071
14 Ga0070659_100023129 3300005366 Bacteria 4752
15 Ga0070667_100306031 3300005367 Bacteria 1432
16 Ga0070709_10025298 3300005434 Bacteria 3506
17 Ga0070714_100286510 3300005435 Bacteria 1532
18 Ga0070713_100001611 3300005436 Bacteria 14456
19 Ga0070713_100045572 3300005436 Bacteria 3594
20 Ga0070710_10000630 3300005437 Bacteria 16776
21 Ga0070701_10073685 3300005438 Bacteria 1832
22 Ga0070711_100048756 3300005439 Bacteria 2898
23 Ga0070663_100026132 3300005455 Bacteria 3950
24 Ga0070663_100058723 3300005455 Bacteria 2763
25 Ga0070663_100178190 3300005455 Bacteria 1647
26 Ga0070678_100074486 3300005456 Bacteria 2551
27 Ga0070678_100163470 3300005456 Bacteria 1806
28 Ga0070662_100011632 3300005457 Bacteria 5809
29 Ga0070685_10036227 3300005466 Bacteria 2788
30 Ga0070684_100064631 3300005535 Bacteria 3210
31 Ga0070684_100349073 3300005535 Bacteria 1361
32 Ga0068853_100035682 3300005539 Bacteria 4225
33 Ga0068853_100069592 3300005539 Bacteria 3062
34 Ga0070672_100519086 3300005543 Bacteria 1032
35 Ga0070693_100051469 3300005547 Bacteria 2359
36 Ga0070664_100008132 3300005564 Bacteria 8480
37 Ga0070664_100071808 3300005564 Bacteria 2967
38 Ga0070664_100142094 3300005564 Bacteria 2114
39 Ga0070664_100214638 3300005564 Bacteria 1720
40 Ga0068857_100125303 3300005577 Bacteria 2314
41 Ga0068857_100134729 3300005577 Bacteria 2230
42 Ga0068857_100302758 3300005577 Bacteria 1474
43 Ga0068854_100013700 3300005578 Bacteria 5328
44 Ga0068856_100066965 3300005614 Bacteria 3549
45 Ga0068856_100100971 3300005614 Bacteria 2878
46 Ga0068856_100162903 3300005614 Bacteria 2241
47 Ga0070702_100113374 3300005615 Bacteria 1685
48 Ga0068852_100081021 3300005616 Bacteria 2880
49 Ga0068859_100165611 3300005617 Bacteria 2290
50 Ga0068864_100055183 3300005618 Bacteria 3430
51 Ga0068864_100213377 3300005618 Bacteria 1778
52 Ga0068864_100236560 3300005618 Bacteria 1691
53 Ga0068870_10116301 3300005840 Bacteria 1534
54 Ga0068858_100069988 3300005842 Bacteria 3252
55 Ga0068858_100184917 3300005842 Bacteria 1968
56 Ga0068860_100017508 3300005843 Bacteria 6981
57 Ga0068862_100149653 3300005844 Bacteria 2077
58 Ga0068862_100223093 3300005844 Bacteria 1707
59 Ga0068862_100376508 3300005844 Bacteria 1323
60 Ga0081538_10069222 3300005981 Bacteria 1956
61 Ga0081539_10001179 3300005985 Bacteria 47264
62 Ga0070717_10003824 3300006028 Bacteria 10834
63 Ga0075365_10018302 3300006038 Bacteria 4306
64 Ga0075364_10020322 3300006051 Bacteria 4176
65 Ga0075369_10076588 3300006186 Bacteria 1479
66 Ga0075428_100324281 3300006844 Bacteria 1655
67 Ga0075434_100144590 3300006871 Bacteria 2398
68 Ga0068865_100105006 3300006881 Bacteria 2075
69 Ga0075436_100007307 3300006914 Bacteria 7552
70 Ga0097620_100165608 3300006931 Bacteria 2290
71 Ga0075435_100038080 3300007076 Bacteria 3833
72 Ga0105240_10031639 3300009093 Bacteria 6856
73 Ga0105245_10011257 3300009098 Bacteria 7788
74 Ga0105245_10190059 3300009098 Bacteria 1966
75 Ga0105245_10704476 3300009098 Bacteria 1043
76 Ga0105243_10032957 3300009148 Bacteria 4004
77 Ga0105241_10041431 3300009174 Bacteria 3479
78 Ga0105248_10157709 3300009177 Bacteria 2561
79 Ga0105249_10015567 3300009553 Bacteria 6734
80 Ga0105246_10031866 3300011119 Bacteria 3491
81 Ga0105246_10044872 3300011119 Bacteria 3006
82 Ga0157369_10027886 3300013105 Bacteria 6256
83 Ga0157369_10069550 3300013105 Bacteria 3782
84 Ga0157374_10432832 3300013296 Bacteria 1315
85 Ga0163162_10070264 3300013306 Bacteria 3553
86 Ga0157372_10031627 3300013307 Bacteria 5794
87 Ga0157372_10089056 3300013307 Bacteria 3506
88 Ga0163163_10087790 3300014325 Bacteria 3121
89 Ga0163163_10142325 3300014325 Bacteria 2441
90 Ga0163163_10402851 3300014325 Bacteria 1426
91 Ga0157380_10592374 3300014326 Bacteria 1095
92 Ga0157379_10181480 3300014968 Bacteria 1901
93 Ga0157376_10002267 3300014969 Bacteria 12983
94 Ga0213875_10015849 3300021388 Bacteria 3662
95 Ga0207692_10026914 3300025898 Bacteria 2702
96 Ga0207710_10046179 3300025900 Bacteria 1944
97 Ga0207688_10003750 3300025901 Bacteria 8296
98 Ga0207647_10060952 3300025904 Bacteria 2304
99 Ga0207647_10128425 3300025904 Bacteria 1491
100 Ga0207643_10005799 3300025908 Bacteria 6601
101 Ga0207643_10113241 3300025908 Bacteria 1600
102 Ga0207705_10190764 3300025909 Bacteria 1550
103 Ga0207695_10069916 3300025913 Bacteria 3591
104 Ga0207693_10067397 3300025915 Bacteria 2803
105 Ga0207663_10067328 3300025916 Bacteria 2296
106 Ga0207657_10027545 3300025919 Bacteria 5203
107 Ga0207649_10134782 3300025920 Bacteria 1682
108 Ga0207694_10061572 3300025924 Bacteria 2921
109 Ga0207687_10068420 3300025927 Bacteria 2530
110 Ga0207700_10084455 3300025928 Bacteria 2489
111 Ga0207690_10019693 3300025932 Bacteria 4159
112 Ga0207706_10004068 3300025933 Bacteria 13822
113 Ga0207669_10011829 3300025937 Bacteria 4265
114 Ga0207691_10052321 3300025940 Bacteria 3730
115 Ga0207689_10004064 3300025942 Bacteria 13295
116 Ga0207689_10075326 3300025942 Bacteria 2774
117 Ga0207689_10105824 3300025942 Bacteria 2311
118 Ga0207679_10014138 3300025945 Bacteria 5240
119 Ga0207679_10104990 3300025945 Bacteria 2218
120 Ga0207712_10079751 3300025961 Bacteria 2379
121 Ga0207668_10002796 3300025972 Bacteria 10200
122 Ga0207668_10017830 3300025972 Bacteria 4456
123 Ga0207668_10063798 3300025972 Bacteria 2600
124 Ga0207640_10079786 3300025981 Bacteria 2232
125 Ga0207640_10174758 3300025981 Bacteria 1604
126 Ga0207658_10029260 3300025986 Bacteria 3888
127 Ga0207677_10240024 3300026023 Bacteria 1465
128 Ga0207703_10212635 3300026035 Bacteria 1725
129 Ga0207639_10018090 3300026041 Bacteria 5002
130 Ga0207678_10023775 3300026067 Bacteria 5358
131 Ga0207678_10075372 3300026067 Bacteria 2890
132 Ga0207708_10006576 3300026075 Bacteria 8603
133 Ga0207702_10100744 3300026078 Bacteria 2549
134 Ga0207641_10141277 3300026088 Bacteria 2173
135 Ga0207648_10162773 3300026089 Bacteria 1971
136 Ga0207676_10039579 3300026095 Bacteria 3607
137 Ga0207675_100394290 3300026118 Bacteria 1363
138 Ga0207683_10013213 3300026121 Bacteria 7041
139 Ga0207698_10226533 3300026142 Bacteria 1694
140 Ga0268265_10041825 3300028380 Bacteria 3395
141 Ga0268264_10131750 3300028381 Bacteria 2217
142 Ga0307515_10000436 3300028794 Bacteria 100131
143 Ga0307515_10009597 3300028794 Bacteria 18691
144 Ga0307515_10032834 3300028794 Bacteria 8576
145 Ga0307515_10062941 3300028794 Bacteria 5226
146 Ga0307512_10003653 3300030522 Bacteria 17570
147 Ga0307512_10093449 3300030522 Bacteria 2081
148 Ga0307513_10004812 3300031456 Bacteria 17929
149 Ga0307513_10233184 3300031456 Bacteria 1652
150 Ga0307509_10018999 3300031507 Bacteria 7864
151 Ga0307509_10215461 3300031507 Bacteria 1740
152 Ga0307508_10004620 3300031616 Bacteria 13371
153 Ga0307508_10017931 3300031616 Bacteria 6432
154 Ga0307516_10002978 3300031730 Bacteria 22125
155 Ga0307516_10015614 3300031730 Bacteria 7982
156 Ga0307516_10016971 3300031730 Bacteria 7601
157 Ga0307410_10009081 3300031852 Bacteria 5555
158 Ga0307410_10198073 3300031852 Bacteria 1532
159 Ga0307406_10006369 3300031901 Bacteria 6513
160 Ga0307406_10111943 3300031901 Bacteria 1881
161 Ga0307409_100035597 3300031995 Bacteria 3650
162 Ga0307409_100059532 3300031995 Bacteria 2973
163 Ga0307409_100126987 3300031995 Bacteria 2171
164 Ga0307409_100427254 3300031995 Bacteria 1272
165 Ga0307416_100052426 3300032002 Bacteria 3266
166 Ga0307416_100073513 3300032002 Bacteria 2851
167 Ga0307416_100206962 3300032002 Bacteria 1867
168 Ga0307415_100053494 3300032126 Bacteria 2751
169 Ga0307507_10098767 3300033179 Bacteria 2456
170 Ga0373940_0003625 3300035088 Bacteria 3173
171 Ga0395898_0020772 3300037466 Bacteria 6665
172 Ga0436364_0793323 3300037853 Bacteria 7859
173 Ga0395901_0017546 3300038443 Bacteria 7306
174 Ga0451791_0116305 3300041451 Bacteria 4722
175 Ga0451793_0084835 3300041452 Bacteria 5750
176 Ga0451797_1033951 3300041453 Bacteria 6327
177 Ga0451795_0617287 3300041456 Bacteria 1749
178 Ga0451839_1218868 3300041496 Bacteria 2898
179 Ga0451841_1273432 3300041498 Bacteria 2436
180 Ga0451851_1332013 3300041507 Bacteria 1852
181 Ga0451843_1024046 3300041509 Bacteria 1912
182 Ga0451853_2724669 3300041512 Bacteria 1163
183 Ga0439464_0007484 3300042439 Bacteria 2856
184 Ga0466972_0028895 3300044658 Bacteria 2731
185 Ga0466965_0002964 3300044683 Bacteria 7352
186 Ga0466965_0005302 3300044683 Bacteria 5801
187 Ga0466965_0108246 3300044683 Bacteria 1426
188 Ga0466966_0102107 3300044684 Bacteria 1773
189 Ga0466961_0124975 3300044693 Bacteria 1614
190 Ga0466963_0084530 3300044694 Bacteria 2153
191 Ga0466963_0126871 3300044694 Bacteria 1759
192 Ga0466970_0145856 3300044765 Bacteria 1305
193 Ga0466957_0096039 3300044842 Bacteria 1862
194 Ga0466960_0000272 3300044901 Bacteria 17893
195 Ga0466960_0047759 3300044901 Bacteria 2054
196 Ga0466959_0133499 3300045049 Bacteria 1758
197 Ga0466958_0047381 3300045836 Bacteria 2595
198 Ga0466967_0001529 3300045976 Bacteria 13529
199 Ga0495603_0007163 3300046455 Bacteria 6698
200 Ga0495638_0118641 3300046460 Bacteria 1565
201 Ga0495650_0019104 3300046471 Bacteria 3385
202 Ga0495639_0092680 3300046475 Bacteria 1419
203 Ga0495632_0032213 3300046519 Bacteria 2703
204 Ga0495665_0064093 3300046531 Bacteria 1940
205 Ga0495588_0131916 3300046674 Bacteria 1318
206 Ga0495613_0108696 3300046689 Bacteria 2000
207 Ga0495600_0060907 3300046809 Bacteria 2465
208 Ga0495676_0005405 3300047321 Bacteria 11709
209 Ga0495680_0081765 3300047322 Bacteria 2438
210 Ga0496102_0023219 3300048905 Bacteria 5505
211 Ga0496102_0206084 3300048905 Bacteria 1854
212 Ga0496104_0001276 3300048907 Bacteria 21718
213 Ga0496104_0133756 3300048907 Bacteria 2382
214 Ga0496105_0005063 3300048908 Bacteria 9984
215 Ga0496105_0082293 3300048908 Bacteria 2659
216 Ga0496108_0000191 3300048911 Bacteria 56975
217 Ga0496108_0003007 3300048911 Bacteria 13549
218 Ga0496108_0301248 3300048911 Bacteria 1396
219 Ga0496109_0042463 3300048912 Bacteria 4119
220 Ga0496109_0251182 3300048912 Bacteria 1665
221 Ga0496109_0294813 3300048912 Bacteria 1529
222 Ga0496109_0386188 3300048912 Bacteria 1323
223 Ga0496109_0395887 3300048912 Bacteria 1305
224 Ga0496110_0102624 3300048913 Bacteria 2565
225 Ga0496111_0002936 3300048914 Bacteria 10427
226 Ga0496111_0079895 3300048914 Bacteria 2386
227 Ga0496112_0183586 3300048915 Bacteria 2056
228 Ga0496113_0046061 3300048916 Bacteria 3237
229 Ga0496113_0071990 3300048916 Bacteria 2630
230 Ga0496114_0000632 3300048917 Bacteria 26002
231 Ga0496114_0063370 3300048917 Bacteria 3095
232 Ga0496114_0185280 3300048917 Bacteria 1819
233 Ga0501047_0005289 3300049581 Bacteria 12128
234 nmdc:mga00v17_10920_c1 3300050491 Bacteria 4977
235 nmdc:mga0n895_141355_c1 3300050512 Bacteria 2436
236 nmdc:mga0rr50_43193_c1 3300050513 Bacteria 3297
237 nmdc:mga08x19_15122_c1 3300050514 Bacteria 4691
238 Ga0495619_0025435 3300053085 Bacteria 3802
239 Ga0495619_0165691 3300053085 Bacteria 1527
240 Ga0500583_0107602 3300053092 Bacteria 1371
241 Ga0500651_0102681 3300053093 Bacteria 1752
242 Ga0500556_0000169 3300053104 Bacteria 53730
243 Ga0500593_000317 3300053117 Bacteria 19366
244 Ga0500655_000993 3300053133 Bacteria 5470
245 Ga0500600_0058182 3300053149 Bacteria 2165
246 2643761234 2643221548 Bacteria 8053412
247 2644183240 2643221632 Bacteria 3406696
248 2644442195 2643221678 Bacteria 9540101
249 2644459361 2643221682 Bacteria 6743283
250 2644515864 2643221692 Bacteria 7282860
251 2753271290 2751185782 Bacteria 11227053
252 2774393264 2773857762 Bacteria 5971770
253 2809197105 2808606439 Bacteria 5952208
254 2809226119 2808606447 Bacteria 3572005
255 2891971645 2891968417 Bacteria 5821697
256 8003320808 8003314358 Bacteria 10575343
257 8054614564 8054609563 Bacteria 5170090
258 Ga0436363_1468842
259 Ga0070683_100092010
260 Ga0068869_100075263
261 Ga0070680_100292049
262 Ga0070682_100014822
263 Ga0070660_100029294
264 Ga0070661_100050350
265 Ga0070661_100122678
266 Ga0070692_10057096
267 Ga0070668_100001068
268 Ga0070668_100020297
269 Ga0070668_100300709
270 Ga0070675_100139535
271 Ga0070659_100023129
272 Ga0070667_100306031
273 Ga0070709_10025298
274 Ga0070714_100286510
275 Ga0070713_100001611
276 Ga0070713_100045572
277 Ga0070710_10000630
278 Ga0070701_10073685
279 Ga0070711_100048756
280 Ga0070663_100026132
281 Ga0070663_100058723
282 Ga0070663_100178190
283 Ga0070678_100074486
284 Ga0070678_100163470
285 Ga0070662_100011632
286 Ga0070685_10036227
287 Ga0070684_100064631
288 Ga0070684_100349073
289 Ga0068853_100035682
290 Ga0068853_100069592
291 Ga0070672_100519086
292 Ga0070693_100051469
293 Ga0070664_100008132
294 Ga0070664_100071808
295 Ga0070664_100142094
296 Ga0070664_100214638
297 Ga0068857_100125303
298 Ga0068857_100134729
299 Ga0068857_100302758
300 Ga0068854_100013700
301 Ga0068856_100066965
302 Ga0068856_100100971
303 Ga0068856_100162903
304 Ga0070702_100113374
305 Ga0068852_100081021
306 Ga0068859_100165611
307 Ga0068864_100055183
308 Ga0068864_100213377
309 Ga0068864_100236560
310 Ga0068870_10116301
311 Ga0068858_100069988
312 Ga0068858_100184917
313 Ga0068860_100017508
314 Ga0068862_100149653
315 Ga0068862_100223093
316 Ga0068862_100376508
317 Ga0081538_10069222
318 Ga0081539_10001179
319 Ga0070717_10003824
320 Ga0075365_10018302
321 Ga0075364_10020322
322 Ga0075369_10076588
323 Ga0075428_100324281
324 Ga0075434_100144590
325 Ga0068865_100105006
326 Ga0075436_100007307
327 Ga0097620_100165608
328 Ga0075435_100038080
329 Ga0105240_10031639
330 Ga0105245_10011257
331 Ga0105245_10190059
332 Ga0105245_10704476
333 Ga0105243_10032957
334 Ga0105241_10041431
335 Ga0105248_10157709
336 Ga0105249_10015567
337 Ga0105246_10031866
338 Ga0105246_10044872
339 Ga0157369_10027886
340 Ga0157369_10069550
341 Ga0157374_10432832
342 Ga0163162_10070264
343 Ga0157372_10031627
344 Ga0157372_10089056
345 Ga0163163_10087790
346 Ga0163163_10142325
347 Ga0163163_10402851
348 Ga0157380_10592374
349 Ga0157379_10181480
350 Ga0157376_10002267
351 Ga0213875_10015849
352 Ga0207692_10026914
353 Ga0207710_10046179
354 Ga0207688_10003750
355 Ga0207647_10060952
356 Ga0207647_10128425
357 Ga0207643_10005799
358 Ga0207643_10113241
359 Ga0207705_10190764
360 Ga0207695_10069916
361 Ga0207693_10067397
362 Ga0207663_10067328
363 Ga0207657_10027545
364 Ga0207649_10134782
365 Ga0207694_10061572
366 Ga0207687_10068420
367 Ga0207700_10084455
368 Ga0207690_10019693
369 Ga0207706_10004068
370 Ga0207669_10011829
371 Ga0207691_10052321
372 Ga0207689_10004064
373 Ga0207689_10075326
374 Ga0207689_10105824
375 Ga0207679_10014138
376 Ga0207679_10104990
377 Ga0207712_10079751
378 Ga0207668_10002796
379 Ga0207668_10017830
380 Ga0207668_10063798
381 Ga0207640_10079786
382 Ga0207640_10174758
383 Ga0207658_10029260
384 Ga0207677_10240024
385 Ga0207703_10212635
386 Ga0207639_10018090
387 Ga0207678_10023775
388 Ga0207678_10075372
389 Ga0207708_10006576
390 Ga0207702_10100744
391 Ga0207641_10141277
392 Ga0207648_10162773
393 Ga0207676_10039579
394 Ga0207675_100394290
395 Ga0207683_10013213
396 Ga0207698_10226533
397 Ga0268265_10041825
398 Ga0268264_10131750
399 Ga0307515_10000436
400 Ga0307515_10009597
401 Ga0307515_10032834
402 Ga0307515_10062941
403 Ga0307512_10003653
404 Ga0307512_10093449
405 Ga0307513_10004812
406 Ga0307513_10233184
407 Ga0307509_10018999
408 Ga0307509_10215461
409 Ga0307508_10004620
410 Ga0307508_10017931
411 Ga0307516_10002978
412 Ga0307516_10015614
413 Ga0307516_10016971
414 Ga0307410_10009081
415 Ga0307410_10198073
416 Ga0307406_10006369
417 Ga0307406_10111943
418 Ga0307409_100035597
419 Ga0307409_100059532
420 Ga0307409_100126987
421 Ga0307409_100427254
422 Ga0307416_100052426
423 Ga0307416_100073513
424 Ga0307416_100206962
425 Ga0307415_100053494
426 Ga0307507_10098767
427 Ga0373940_0003625
428 Ga0395898_0020772
429 Ga0436364_0793323
430 Ga0395901_0017546
431 Ga0451791_0116305
432 Ga0451793_0084835
433 Ga0451797_1033951
434 Ga0451795_0617287
435 Ga0451839_1218868
436 Ga0451841_1273432
437 Ga0451851_1332013
438 Ga0451843_1024046
439 Ga0451853_2724669
440 Ga0439464_0007484
441 Ga0466972_0028895
442 Ga0466965_0002964
443 Ga0466965_0005302
444 Ga0466965_0108246
445 Ga0466966_0102107
446 Ga0466961_0124975
447 Ga0466963_0084530
448 Ga0466963_0126871
449 Ga0466970_0145856
450 Ga0466957_0096039
451 Ga0466960_0000272
452 Ga0466960_0047759
453 Ga0466959_0133499
454 Ga0466958_0047381
455 Ga0466967_0001529
456 Ga0495603_0007163
457 Ga0495638_0118641
458 Ga0495650_0019104
459 Ga0495639_0092680
460 Ga0495632_0032213
461 Ga0495665_0064093
462 Ga0495588_0131916
463 Ga0495613_0108696
464 Ga0495600_0060907
465 Ga0495676_0005405
466 Ga0495680_0081765
467 Ga0496102_0023219
468 Ga0496102_0206084
469 Ga0496104_0001276
470 Ga0496104_0133756
471 Ga0496105_0005063
472 Ga0496105_0082293
473 Ga0496108_0000191
474 Ga0496108_0003007
475 Ga0496108_0301248
476 Ga0496109_0042463
477 Ga0496109_0251182
478 Ga0496109_0294813
479 Ga0496109_0386188
480 Ga0496109_0395887
481 Ga0496110_0102624
482 Ga0496111_0002936
483 Ga0496111_0079895
484 Ga0496112_0183586
485 Ga0496113_0046061
486 Ga0496113_0071990
487 Ga0496114_0000632
488 Ga0496114_0063370
489 Ga0496114_0185280
490 Ga0501047_0005289
491 nmdc:mga00v17_10920_c1
492 nmdc:mga0n895_141355_c1
493 nmdc:mga0rr50_43193_c1
494 nmdc:mga08x19_15122_c1
495 Ga0495619_0025435
496 Ga0495619_0165691
497 Ga0500583_0107602
498 Ga0500651_0102681
499 Ga0500556_0000169
500 Ga0500593_000317
501 Ga0500655_000993
502 Ga0500600_0058182
503 2643761234
504 2644183240
505 2644442195
506 2644459361
507 2644515864
508 2753271290
509 2774393264
510 2809197105
511 2809226119
512 2891971645
513 8003320808
514 8054614564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

99

307

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.8027 16 322
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.7997 19 322
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.7952 19 322
5ibz-assembly1.cif.gz_C crystal structure of a novel cyclase (pfam04199). 0.7924 19 322
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.7903 16 322
ID Description Score Start End Superfamily
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.747 53 320 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7202 53 320 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.6692 53 320 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.6621 53 321 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.6522 53 320 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A7W5AG36-F1-model_v4 Kynurenine formamidase 0.9649 160 322 GO:0004061
GO:0019441
AF-A0A7W5AG36-F1-model_v4 Kynurenine formamidase 0.9528 160 322 GO:0004061
GO:0019441
AF-A0A383CWK2-F1-model_v4 Protein TolR 0.9502 154 322 GO:0004061
GO:0005886
GO:0019441
GO:0022857
AF-A0A849GSB7-F1-model_v4 Cyclase family protein 0.9438 120 322 GO:0004061
GO:0019441
AF-A0A537UIV5-F1-model_v4 Cyclase family protein 0.9424 127 310 GO:0004061
GO:0019441

Map