F367386

General Info

Members Datasets Scaffolds Average Seq Length
257 155 514 451

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10142782|Ga0268264_101427822
Length 497
Sequence MRGDRADHRALVAQPFRAARARIGRREGLRYRRARVLVATCLFAVVPVGRPAIAQQPDEATRLLREYVAIDTSNPPGDTRKAADFLASVLERDGIAVTRYESAPGKAIVYARLKATVSPPAGKAILLLHHMDVVPADRAQWKTDPFTPTIKNNELWARGAMDMKGQGVAQLLAFLRLKRDRVPLTRDVILLAEPDEEVGGAMGARWMIANHYAELDPEYVIDEGGFGSRDLFAANRLVYGISVAEKKIVWLKLRAEGVAGHGSQPNDQNPNDRLVRALARLLDDGRSPDRLALQPSQSQSQGARAFQASGASREPSVLDVMHAKVGTFAENKFTNAIQHSTIALTWFRSGVGDPPKINVIPSVAEAGIDCRVLPGTTKDQWIAEVKRRLGDPSIAIELINESDDPVVTTQDSPLFRNLEAAIKRRHVDAVVTPLLIPYGTDSNAFRPRGVKAYGIFPAILSAEIAASMHSDAERMPLDAVSEAAQVFFEALRDTLAK

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
110 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
111 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0
Rhizoplane 5.84
Rhizosphere 89.49
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_10142782 3300028381 Unclassified 2137
2 Ga0065715_10128539 3300005293 Bacteria 2064
3 Ga0065707_10112856 3300005295 Bacteria 2346
4 Ga0070676_10002265 3300005328 Bacteria 9818
5 Ga0070676_10076123 3300005328 Bacteria 2025
6 Ga0070683_100000168 3300005329 Bacteria 42900
7 Ga0070690_100030673 3300005330 Bacteria 3343
8 Ga0070670_100001240 3300005331 Bacteria 20296
9 Ga0070670_100073575 3300005331 Bacteria 2935
10 Ga0070670_100110667 3300005331 Bacteria 2366
11 Ga0070670_100143506 3300005331 Bacteria 2065
12 Ga0068869_100127231 3300005334 Bacteria 1955
13 Ga0070666_10046676 3300005335 Bacteria 2906
14 Ga0070666_10054398 3300005335 Bacteria 2700
15 Ga0070680_100051426 3300005336 Bacteria 3362
16 Ga0068868_100153730 3300005338 Unclassified 1896
17 Ga0070687_100017584 3300005343 Bacteria 3291
18 Ga0070661_100005877 3300005344 Bacteria 8443
19 Ga0070661_100114265 3300005344 Bacteria 2018
20 Ga0070692_10017691 3300005345 Bacteria 3414
21 Ga0070675_100000646 3300005354 Bacteria 24086
22 Ga0070675_100024511 3300005354 Bacteria 4831
23 Ga0070675_100033588 3300005354 Bacteria 4161
24 Ga0070675_100035874 3300005354 Bacteria 4032
25 Ga0070675_100040821 3300005354 Bacteria 3789
26 Ga0070671_100128314 3300005355 Bacteria 2135
27 Ga0070673_100007817 3300005364 Bacteria 7080
28 Ga0070667_100177458 3300005367 Bacteria 1883
29 Ga0070700_100008338 3300005441 Bacteria 5642
30 Ga0070700_100035925 3300005441 Bacteria 3002
31 Ga0070700_100045864 3300005441 Bacteria 2698
32 Ga0070694_100008256 3300005444 Bacteria 6369
33 Ga0070708_100184078 3300005445 Unclassified 1953
34 Ga0068867_100012160 3300005459 Bacteria 6081
35 Ga0068867_100036520 3300005459 Bacteria 3568
36 Ga0070706_100119385 3300005467 Unclassified 2457
37 Ga0070707_100045883 3300005468 Bacteria 4182
38 Ga0070698_100121409 3300005471 Bacteria 2573
39 Ga0070699_100125177 3300005518 Bacteria 2262
40 Ga0070679_100046940 3300005530 Bacteria 4306
41 Ga0070684_100002247 3300005535 Bacteria 14205
42 Ga0070697_100046235 3300005536 Bacteria 3528
43 Ga0070672_100026378 3300005543 Bacteria 4323
44 Ga0070686_100000232 3300005544 Bacteria 38298
45 Ga0070686_100164355 3300005544 Bacteria 1565
46 Ga0070695_100008103 3300005545 Bacteria 6226
47 Ga0070695_100018506 3300005545 Bacteria 4231
48 Ga0070696_100012471 3300005546 Bacteria 5703
49 Ga0070696_100149353 3300005546 Bacteria 1714
50 Ga0070693_100030618 3300005547 Bacteria 2943
51 Ga0070665_100001749 3300005548 Bacteria 24852
52 Ga0070665_100005683 3300005548 Bacteria 12816
53 Ga0068855_100007737 3300005563 Bacteria 12978
54 Ga0068857_100014475 3300005577 Bacteria 6882
55 Ga0068857_100045581 3300005577 Bacteria 3891
56 Ga0070702_100000567 3300005615 Bacteria 13457
57 Ga0070702_100045868 3300005615 Bacteria 2475
58 Ga0068852_100027213 3300005616 Bacteria 4658
59 Ga0068859_100108745 3300005617 Bacteria 2833
60 Ga0068859_100124061 3300005617 Bacteria 2650
61 Ga0068866_10042098 3300005718 Bacteria 2271
62 Ga0068861_100035221 3300005719 Bacteria 3707
63 Ga0068861_100049501 3300005719 Bacteria 3182
64 Ga0068861_100096742 3300005719 Bacteria 2340
65 Ga0068851_10030493 3300005834 Bacteria 2674
66 Ga0068863_100086854 3300005841 Bacteria 2964
67 Ga0068858_100018185 3300005842 Bacteria 6582
68 Ga0068858_100031430 3300005842 Bacteria 4931
69 Ga0068862_100011041 3300005844 Bacteria 7460
70 Ga0068862_100012432 3300005844 Bacteria 7043
71 Ga0068862_100059881 3300005844 Bacteria 3271
72 Ga0081539_10006372 3300005985 Bacteria 11357
73 Ga0075365_10011503 3300006038 Bacteria 5205
74 Ga0075363_100010901 3300006048 Bacteria 4337
75 Ga0075364_10001907 3300006051 Bacteria 11604
76 Ga0075364_10003789 3300006051 Bacteria 8649
77 Ga0075366_10013893 3300006195 Bacteria 4589
78 Ga0097621_100014588 3300006237 Bacteria 5887
79 Ga0068871_100030039 3300006358 Bacteria 4275
80 Ga0075428_100000386 3300006844 Bacteria 43670
81 Ga0075428_100195810 3300006844 Unclassified 2185
82 Ga0075431_100016540 3300006847 Bacteria 7487
83 Ga0075433_10140057 3300006852 Bacteria 2150
84 Ga0075434_100000019 3300006871 Bacteria 73391
85 Ga0075434_100035917 3300006871 Bacteria 4900
86 Ga0075434_100042005 3300006871 Bacteria 4532
87 Ga0075434_100084171 3300006871 Bacteria 3179
88 Ga0075434_100290502 3300006871 Unclassified 1655
89 Ga0075436_100000160 3300006914 Bacteria 41885
90 Ga0075436_100020299 3300006914 Bacteria 4561
91 Ga0097620_100108749 3300006931 Bacteria 2833
92 Ga0097620_100124059 3300006931 Bacteria 2650
93 Ga0075435_100000041 3300007076 Bacteria 66202
94 Ga0075435_100000475 3300007076 Bacteria 24383
95 Ga0075435_100002730 3300007076 Bacteria 11785
96 Ga0075435_100017579 3300007076 Bacteria 5417
97 Ga0075435_100017739 3300007076 Bacteria 5394
98 Ga0075435_100036573 3300007076 Bacteria 3904
99 Ga0075435_100087165 3300007076 Bacteria 2572
100 Ga0075435_100186270 3300007076 Bacteria 1755
101 Ga0105240_10026833 3300009093 Bacteria 7554
102 Ga0105240_10084112 3300009093 Bacteria 3902
103 Ga0111539_10000381 3300009094 Bacteria 54711
104 Ga0111539_10018391 3300009094 Bacteria 8656
105 Ga0111539_10082364 3300009094 Bacteria 3785
106 Ga0111539_10121026 3300009094 Bacteria 3067
107 Ga0105245_10058036 3300009098 Bacteria 3483
108 Ga0105247_10008468 3300009101 Bacteria 6263
109 Ga0114129_10001153 3300009147 Bacteria 34987
110 Ga0114129_10001188 3300009147 Bacteria 34556
111 Ga0114129_10014717 3300009147 Bacteria 11145
112 Ga0114129_10028071 3300009147 Bacteria 7973
113 Ga0114129_10111734 3300009147 Bacteria 3770
114 Ga0114129_10133276 3300009147 Bacteria 3411
115 Ga0114129_10193743 3300009147 Bacteria 2758
116 Ga0114129_10365732 3300009147 Unclassified 1908
117 Ga0114129_10368532 3300009147 Bacteria 1899
118 Ga0105243_10012883 3300009148 Bacteria 6319
119 Ga0105242_10004885 3300009176 Bacteria 10378
120 Ga0105242_10053094 3300009176 Bacteria 3308
121 Ga0105248_10003262 3300009177 Bacteria 17991
122 Ga0105248_10027333 3300009177 Bacteria 6350
123 Ga0105248_10027742 3300009177 Bacteria 6305
124 Ga0105248_10345584 3300009177 Bacteria 1675
125 Ga0105249_10000528 3300009553 Bacteria 35130
126 Ga0105249_10071223 3300009553 Unclassified 3211
127 Ga0105249_10091527 3300009553 Unclassified 2846
128 Ga0105249_10160611 3300009553 Bacteria 2171
129 Ga0163162_10044868 3300013306 Bacteria 4428
130 Ga0163162_10110188 3300013306 Bacteria 2850
131 Ga0163162_10152559 3300013306 Bacteria 2429
132 Ga0157375_10208622 3300013308 Bacteria 2110
133 Ga0163163_10001949 3300014325 Bacteria 17449
134 Ga0163163_10051889 3300014325 Bacteria 4044
135 Ga0157380_10027458 3300014326 Bacteria 4330
136 Ga0157380_10061367 3300014326 Bacteria 3008
137 Ga0157377_10067294 3300014745 Bacteria 2062
138 Ga0157379_10029578 3300014968 Bacteria 4870
139 Ga0157379_10037723 3300014968 Bacteria 4310
140 Ga0157376_10033881 3300014969 Bacteria 4117
141 Ga0213876_10087556 3300021384 Unclassified 1649
142 Ga0207688_10039817 3300025901 Bacteria 2610
143 Ga0207645_10006085 3300025907 Bacteria 8677
144 Ga0207707_10016771 3300025912 Bacteria 6380
145 Ga0207662_10034851 3300025918 Bacteria 2938
146 Ga0207649_10009827 3300025920 Bacteria 5243
147 Ga0207646_10056248 3300025922 Bacteria 3517
148 Ga0207646_10251812 3300025922 Bacteria 1596
149 Ga0207681_10017362 3300025923 Bacteria 4518
150 Ga0207650_10005273 3300025925 Bacteria 8816
151 Ga0207650_10059881 3300025925 Bacteria 2840
152 Ga0207659_10003974 3300025926 Bacteria 8924
153 Ga0207659_10016887 3300025926 Bacteria 4760
154 Ga0207659_10039348 3300025926 Bacteria 3297
155 Ga0207700_10046837 3300025928 Unclassified 3201
156 Ga0207706_10044276 3300025933 Bacteria 3945
157 Ga0207686_10051011 3300025934 Bacteria 2575
158 Ga0207709_10045881 3300025935 Bacteria 2649
159 Ga0207691_10016064 3300025940 Bacteria 7111
160 Ga0207711_10038572 3300025941 Bacteria 4063
161 Ga0207711_10133043 3300025941 Bacteria 2231
162 Ga0207689_10021628 3300025942 Bacteria 5409
163 Ga0207661_10254002 3300025944 Unclassified 1564
164 Ga0207679_10029059 3300025945 Bacteria 3846
165 Ga0207712_10010279 3300025961 Bacteria 5937
166 Ga0207640_10029940 3300025981 Bacteria 3348
167 Ga0207677_10086358 3300026023 Bacteria 2267
168 Ga0207703_10021300 3300026035 Bacteria 5076
169 Ga0207703_10060143 3300026035 Bacteria 3105
170 Ga0207703_10221358 3300026035 Bacteria 1692
171 Ga0207708_10026649 3300026075 Bacteria 4376
172 Ga0207708_10027114 3300026075 Bacteria 4338
173 Ga0207708_10113704 3300026075 Bacteria 2103
174 Ga0207641_10001068 3300026088 Bacteria 27583
175 Ga0207641_10055085 3300026088 Bacteria 3377
176 Ga0207648_10000815 3300026089 Bacteria 35275
177 Ga0207648_10110704 3300026089 Bacteria 2411
178 Ga0207674_10019993 3300026116 Bacteria 7245
179 Ga0207675_100013103 3300026118 Bacteria 7736
180 Ga0207675_100019415 3300026118 Bacteria 6341
181 Ga0207675_100055583 3300026118 Bacteria 3693
182 Ga0207675_100083572 3300026118 Unclassified 2995
183 Ga0207683_10029632 3300026121 Bacteria 4739
184 Ga0207698_10060415 3300026142 Bacteria 2948
185 Ga0268266_10009847 3300028379 Bacteria 8402
186 Ga0268264_10236523 3300028381 Unclassified 1690
187 Ga0307416_100051504 3300032002 Unclassified 3289
188 Ga0373930_0003862 3300034816 Bacteria 2403
189 Ga0373958_0006104 3300034819 Unclassified 1862
190 Ga0373928_0002174 3300035084 Bacteria 3821
191 Ga0373929_0008342 3300035085 Bacteria 1907
192 Ga0373940_0000564 3300035088 Bacteria 5862
193 Ga0373949_0000423 3300035090 Bacteria 14657
194 Ga0373951_0012577 3300035091 Bacteria 1903
195 Ga0373932_0002534 3300035112 Bacteria 4582
196 Ga0373939_0008394 3300035114 Bacteria 2531
197 Ga0373941_0003318 3300035115 Bacteria 3636
198 Ga0373960_0023591 3300035121 Bacteria 1658
199 Ga0373942_0007994 3300035207 Bacteria 2458
200 Ga0373962_0013432 3300035242 Bacteria 2074
201 Ga0373931_0021016 3300035691 Bacteria 3270
202 Ga0373933_0012102 3300035724 Archaea 4764
203 Ga0373937_0003893 3300036401 Bacteria 12629
204 Ga0373937_0040722 3300036401 Unclassified 4236
205 Ga0436365_0756464 3300039437 Unclassified 2803
206 Ga0451577_0035272 3300042876 Bacteria 4506
207 Ga0451576_0002751 3300045051 Bacteria 25497
208 Ga0495628_0075444 3300046516 Bacteria 2626
209 Ga0495674_0019703 3300047319 Bacteria 6257
210 Ga0496102_0204425 3300048905 Bacteria 1862
211 Ga0496104_0008214 3300048907 Bacteria 9267
212 Ga0496107_0098377 3300048910 Bacteria 2143
213 Ga0496107_0130798 3300048910 Bacteria 1853
214 Ga0496108_0003552 3300048911 Bacteria 12510
215 Ga0496109_0003205 3300048912 Bacteria 13615
216 Ga0496110_0002546 3300048913 Bacteria 13700
217 Ga0496111_0041803 3300048914 Bacteria 3290
218 Ga0496112_0002973 3300048915 Bacteria 13828
219 Ga0496112_0056096 3300048915 Bacteria 3877
220 Ga0496112_0280048 3300048915 Bacteria 1615
221 Ga0496113_0042100 3300048916 Bacteria 3373
222 Ga0496114_0068652 3300048917 Bacteria 2976
223 Ga0496114_0142649 3300048917 Unclassified 2075
224 Ga0496114_0145414 3300048917 Bacteria 2055
225 Ga0501034_0013158 3300049571 Bacteria 8524
226 Ga0501034_0091381 3300049571 Bacteria 3042
227 nmdc:mga00v17_11458_c1 3300050491 Bacteria 4873
228 nmdc:mga00v17_85904_c1 3300050491 Bacteria 1971
229 nmdc:mga0yw44_45747_c1 3300050492 Bacteria 2625
230 nmdc:mga07m45_11228_c1 3300050496 Bacteria 4702
231 nmdc:mga05p37_12188_c1 3300050507 Bacteria 10266
232 nmdc:mga05p37_189912_c1 3300050507 Unclassified 2495
233 nmdc:mga05p37_21829_c1 3300050507 Bacteria 7755
234 nmdc:mga05p37_55375_c1 3300050507 Bacteria 4880
235 nmdc:mga09592_91250_c1 3300050508 Bacteria 2603
236 nmdc:mga06r32_113740_c1 3300050510 Bacteria 2664
237 nmdc:mga06r32_42388_c1 3300050510 Bacteria 4327
238 nmdc:mga08y16_19874_c1 3300050511 Bacteria 7084
239 nmdc:mga08y16_69885_c1 3300050511 Bacteria 3660
240 nmdc:mga0n895_127015_c1 3300050512 Bacteria 2574
241 nmdc:mga0n895_14665_c1 3300050512 Bacteria 7127
242 nmdc:mga0n895_281853_c1 3300050512 Unclassified 1685
243 nmdc:mga0n895_282795_c1 3300050512 Unclassified 1682
244 nmdc:mga0n895_41523_c1 3300050512 Bacteria 4473
245 nmdc:mga0n895_58409_c1 3300050512 Bacteria 3803
246 nmdc:mga0n895_81_c1 3300050512 Bacteria 54736
247 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
248 nmdc:mga0rr50_71727_c1 3300050513 Bacteria 2644
249 nmdc:mga0rr50_752_c1 3300050513 Bacteria 17463
250 nmdc:mga08x19_1391_c1 3300050514 Bacteria 14966
251 nmdc:mga08x19_265_c1 3300050514 Bacteria 39740
252 nmdc:mga08x19_61619_c1 3300050514 Bacteria 2432
253 nmdc:mga0a205_64284_c2 3300050515 Bacteria 1763
254 Ga0495601_0131328 3300053077 Unclassified 1631
255 Ga0495619_0055017 3300053085 Bacteria 2635
256 Ga0500628_003767 3300053129 Bacteria 2503
257 Ga0501082_0213173 3300060353 Bacteria 1680
258 Ga0268264_10142782
259 Ga0065715_10128539
260 Ga0065707_10112856
261 Ga0070676_10002265
262 Ga0070676_10076123
263 Ga0070683_100000168
264 Ga0070690_100030673
265 Ga0070670_100001240
266 Ga0070670_100073575
267 Ga0070670_100110667
268 Ga0070670_100143506
269 Ga0068869_100127231
270 Ga0070666_10046676
271 Ga0070666_10054398
272 Ga0070680_100051426
273 Ga0068868_100153730
274 Ga0070687_100017584
275 Ga0070661_100005877
276 Ga0070661_100114265
277 Ga0070692_10017691
278 Ga0070675_100000646
279 Ga0070675_100024511
280 Ga0070675_100033588
281 Ga0070675_100035874
282 Ga0070675_100040821
283 Ga0070671_100128314
284 Ga0070673_100007817
285 Ga0070667_100177458
286 Ga0070700_100008338
287 Ga0070700_100035925
288 Ga0070700_100045864
289 Ga0070694_100008256
290 Ga0070708_100184078
291 Ga0068867_100012160
292 Ga0068867_100036520
293 Ga0070706_100119385
294 Ga0070707_100045883
295 Ga0070698_100121409
296 Ga0070699_100125177
297 Ga0070679_100046940
298 Ga0070684_100002247
299 Ga0070697_100046235
300 Ga0070672_100026378
301 Ga0070686_100000232
302 Ga0070686_100164355
303 Ga0070695_100008103
304 Ga0070695_100018506
305 Ga0070696_100012471
306 Ga0070696_100149353
307 Ga0070693_100030618
308 Ga0070665_100001749
309 Ga0070665_100005683
310 Ga0068855_100007737
311 Ga0068857_100014475
312 Ga0068857_100045581
313 Ga0070702_100000567
314 Ga0070702_100045868
315 Ga0068852_100027213
316 Ga0068859_100108745
317 Ga0068859_100124061
318 Ga0068866_10042098
319 Ga0068861_100035221
320 Ga0068861_100049501
321 Ga0068861_100096742
322 Ga0068851_10030493
323 Ga0068863_100086854
324 Ga0068858_100018185
325 Ga0068858_100031430
326 Ga0068862_100011041
327 Ga0068862_100012432
328 Ga0068862_100059881
329 Ga0081539_10006372
330 Ga0075365_10011503
331 Ga0075363_100010901
332 Ga0075364_10001907
333 Ga0075364_10003789
334 Ga0075366_10013893
335 Ga0097621_100014588
336 Ga0068871_100030039
337 Ga0075428_100000386
338 Ga0075428_100195810
339 Ga0075431_100016540
340 Ga0075433_10140057
341 Ga0075434_100000019
342 Ga0075434_100035917
343 Ga0075434_100042005
344 Ga0075434_100084171
345 Ga0075434_100290502
346 Ga0075436_100000160
347 Ga0075436_100020299
348 Ga0097620_100108749
349 Ga0097620_100124059
350 Ga0075435_100000041
351 Ga0075435_100000475
352 Ga0075435_100002730
353 Ga0075435_100017579
354 Ga0075435_100017739
355 Ga0075435_100036573
356 Ga0075435_100087165
357 Ga0075435_100186270
358 Ga0105240_10026833
359 Ga0105240_10084112
360 Ga0111539_10000381
361 Ga0111539_10018391
362 Ga0111539_10082364
363 Ga0111539_10121026
364 Ga0105245_10058036
365 Ga0105247_10008468
366 Ga0114129_10001153
367 Ga0114129_10001188
368 Ga0114129_10014717
369 Ga0114129_10028071
370 Ga0114129_10111734
371 Ga0114129_10133276
372 Ga0114129_10193743
373 Ga0114129_10365732
374 Ga0114129_10368532
375 Ga0105243_10012883
376 Ga0105242_10004885
377 Ga0105242_10053094
378 Ga0105248_10003262
379 Ga0105248_10027333
380 Ga0105248_10027742
381 Ga0105248_10345584
382 Ga0105249_10000528
383 Ga0105249_10071223
384 Ga0105249_10091527
385 Ga0105249_10160611
386 Ga0163162_10044868
387 Ga0163162_10110188
388 Ga0163162_10152559
389 Ga0157375_10208622
390 Ga0163163_10001949
391 Ga0163163_10051889
392 Ga0157380_10027458
393 Ga0157380_10061367
394 Ga0157377_10067294
395 Ga0157379_10029578
396 Ga0157379_10037723
397 Ga0157376_10033881
398 Ga0213876_10087556
399 Ga0207688_10039817
400 Ga0207645_10006085
401 Ga0207707_10016771
402 Ga0207662_10034851
403 Ga0207649_10009827
404 Ga0207646_10056248
405 Ga0207646_10251812
406 Ga0207681_10017362
407 Ga0207650_10005273
408 Ga0207650_10059881
409 Ga0207659_10003974
410 Ga0207659_10016887
411 Ga0207659_10039348
412 Ga0207700_10046837
413 Ga0207706_10044276
414 Ga0207686_10051011
415 Ga0207709_10045881
416 Ga0207691_10016064
417 Ga0207711_10038572
418 Ga0207711_10133043
419 Ga0207689_10021628
420 Ga0207661_10254002
421 Ga0207679_10029059
422 Ga0207712_10010279
423 Ga0207640_10029940
424 Ga0207677_10086358
425 Ga0207703_10021300
426 Ga0207703_10060143
427 Ga0207703_10221358
428 Ga0207708_10026649
429 Ga0207708_10027114
430 Ga0207708_10113704
431 Ga0207641_10001068
432 Ga0207641_10055085
433 Ga0207648_10000815
434 Ga0207648_10110704
435 Ga0207674_10019993
436 Ga0207675_100013103
437 Ga0207675_100019415
438 Ga0207675_100055583
439 Ga0207675_100083572
440 Ga0207683_10029632
441 Ga0207698_10060415
442 Ga0268266_10009847
443 Ga0268264_10236523
444 Ga0307416_100051504
445 Ga0373930_0003862
446 Ga0373958_0006104
447 Ga0373928_0002174
448 Ga0373929_0008342
449 Ga0373940_0000564
450 Ga0373949_0000423
451 Ga0373951_0012577
452 Ga0373932_0002534
453 Ga0373939_0008394
454 Ga0373941_0003318
455 Ga0373960_0023591
456 Ga0373942_0007994
457 Ga0373962_0013432
458 Ga0373931_0021016
459 Ga0373933_0012102
460 Ga0373937_0003893
461 Ga0373937_0040722
462 Ga0436365_0756464
463 Ga0451577_0035272
464 Ga0451576_0002751
465 Ga0495628_0075444
466 Ga0495674_0019703
467 Ga0496102_0204425
468 Ga0496104_0008214
469 Ga0496107_0098377
470 Ga0496107_0130798
471 Ga0496108_0003552
472 Ga0496109_0003205
473 Ga0496110_0002546
474 Ga0496111_0041803
475 Ga0496112_0002973
476 Ga0496112_0056096
477 Ga0496112_0280048
478 Ga0496113_0042100
479 Ga0496114_0068652
480 Ga0496114_0142649
481 Ga0496114_0145414
482 Ga0501034_0013158
483 Ga0501034_0091381
484 nmdc:mga00v17_11458_c1
485 nmdc:mga00v17_85904_c1
486 nmdc:mga0yw44_45747_c1
487 nmdc:mga07m45_11228_c1
488 nmdc:mga05p37_12188_c1
489 nmdc:mga05p37_189912_c1
490 nmdc:mga05p37_21829_c1
491 nmdc:mga05p37_55375_c1
492 nmdc:mga09592_91250_c1
493 nmdc:mga06r32_113740_c1
494 nmdc:mga06r32_42388_c1
495 nmdc:mga08y16_19874_c1
496 nmdc:mga08y16_69885_c1
497 nmdc:mga0n895_127015_c1
498 nmdc:mga0n895_14665_c1
499 nmdc:mga0n895_281853_c1
500 nmdc:mga0n895_282795_c1
501 nmdc:mga0n895_41523_c1
502 nmdc:mga0n895_58409_c1
503 nmdc:mga0n895_81_c1
504 nmdc:mga0rr50_1_c1
505 nmdc:mga0rr50_71727_c1
506 nmdc:mga0rr50_752_c1
507 nmdc:mga08x19_1391_c1
508 nmdc:mga08x19_265_c1
509 nmdc:mga08x19_61619_c1
510 nmdc:mga0a205_64284_c2
511 Ga0495601_0131328
512 Ga0495619_0055017
513 Ga0500628_003767
514 Ga0501082_0213173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

243

396

0.96

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

126

493

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8908 32 195
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8441 30 443
5xoy-assembly1.cif.gz_B-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.8401 33 442
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8371 28 441
5xoy-assembly1.cif.gz_A-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.835 33 442
ID Description Score Start End Superfamily
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.895 32 195 3.40.630.10
1q7lC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8884 32 195 3.40.630.10
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.866 31 193 3.40.630.10
af_P65807_4_190_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8578 26 193 3.40.630.10
af_B6TIJ2_17_198_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8536 33 183 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A800JSN1-F1-model_v4 deleted 0.9482 24 181
AF-A0A2V6UC30-F1-model_v4 Peptidase M20 family protein 0.9277 27 166 GO:0016787
AF-A0A838PAF3-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9272 22 182 GO:0016787
AF-A0A7C3I5M7-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9261 19 183 GO:0016787
AF-A0A1N7AHM1-F1-model_v4 Peptidase family M20/M25/M40 0.9228 29 164 GO:0016787

Map