F366819

General Info

Members Datasets Scaffolds Average Seq Length
256 196 250 394

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0010667|Ga0496121_0010667_2564_3880
Length 438
Sequence MAGSSVCYIVDKFRNSFCTPGCQLNKPVILSEDTVAAPIVTDTPAPSAVTAPAIGVLSAVSLSHFLNDMLQSLVPSIYPILKQNYGLDFSQIGMITFAFMVTSSLLQPVVGIYTDRHPKPFSLSIGMGFTFAGMILLGLAHRYEAILAAAALVGIGSAIFHPESARIARAASGGRFGFAQSLFQVGGNFGQALGPMLAALVVVPFGQGSVAWFSIAAAIAIIILWRLGVWYKPRIGPRKAANVASINSAGLSRGKVATVLVVLVSLVFSKAFYLAGINSYYTFFLIHRFGVSTQTAQMFLFVFLAASASGVFLGGPLGDRFGRKYVIWFSIVGSLPFTIALPYASLSWTFALSILIGFILSSAMPAIIVYAQELMPHRFGMISGIFFGFVFGIGGIGAAVLGEVADAHGIDFVYRICSFLPAIGLLALFLPRLKKARA

Samples

Sample ID Description Type Environment
1 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
2 2643221651 Afipia sp. Root123D2 Isolate Unclassified
3 2821131069 Duganella sp. 1224 Isolate Unclassified
4 2857564685 Duganella sp. R-74599 Isolate Unclassified
5 2919476304 Duganella sp. 3397 Isolate Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
193 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 0.39
Rhizoplane 3.12
Rhizosphere 80.86
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10012794 3300003215 Bacteria 3594
2 rootL2_10154046 3300003322 Bacteria 4268
3 JGI25160J50197_1006121 3300003354 Bacteria 4908
4 Ga0055525_1000009 3300003759 Bacteria 596899
5 Ga0055529_1000146 3300003763 Bacteria 100947
6 Ga0055526_1000152 3300003771 Bacteria 61430
7 Ga0065165_1002476 3300005262 Bacteria 15530
8 Ga0065715_10179519 3300005293 Bacteria 1486
9 Ga0070658_10093418 3300005327 Bacteria 2481
10 Ga0070683_100063512 3300005329 Bacteria 3435
11 Ga0070670_100278143 3300005331 Bacteria 1461
12 Ga0070668_100024001 3300005347 Bacteria 4618
13 Ga0070669_100001192 3300005353 Bacteria 18941
14 Ga0070675_100043613 3300005354 Bacteria 3666
15 Ga0070673_100165673 3300005364 Bacteria 1883
16 Ga0070659_100093387 3300005366 Bacteria 2414
17 Ga0070709_10000755 3300005434 Bacteria 18278
18 Ga0070709_10008023 3300005434 Bacteria 5793
19 Ga0070713_100027261 3300005436 Bacteria 4496
20 Ga0070713_100030595 3300005436 Bacteria 4277
21 Ga0070710_10002971 3300005437 Bacteria 8051
22 Ga0070711_100064864 3300005439 Bacteria 2553
23 Ga0070705_100004014 3300005440 Bacteria 7187
24 Ga0070705_100026051 3300005440 Bacteria 3179
25 Ga0070700_100040299 3300005441 Bacteria 2859
26 Ga0070694_100001263 3300005444 Bacteria 14687
27 Ga0070708_100139565 3300005445 Bacteria 2247
28 Ga0070663_100131396 3300005455 Bacteria 1902
29 Ga0070662_100115850 3300005457 Bacteria 2047
30 Ga0070681_10010866 3300005458 Bacteria 8998
31 Ga0068867_100023346 3300005459 Bacteria 4428
32 Ga0070706_100078007 3300005467 Bacteria 3067
33 Ga0070698_100006494 3300005471 Bacteria 12684
34 Ga0070699_100060148 3300005518 Bacteria 3291
35 Ga0070679_100160186 3300005530 Bacteria 2225
36 Ga0070684_100061250 3300005535 Bacteria 3293
37 Ga0070686_100070859 3300005544 Bacteria 2281
38 Ga0070695_100000155 3300005545 Bacteria 32258
39 Ga0070695_100012116 3300005545 Bacteria 5168
40 Ga0070696_100000499 3300005546 Bacteria 24777
41 Ga0070696_100018420 3300005546 Bacteria 4719
42 Ga0070665_100041626 3300005548 Bacteria 4619
43 Ga0070665_100241121 3300005548 Bacteria 1808
44 Ga0070704_100001112 3300005549 Bacteria 13983
45 Ga0070704_100001916 3300005549 Bacteria 11493
46 Ga0070704_100022977 3300005549 Bacteria 4065
47 Ga0068855_100114733 3300005563 Bacteria 3088
48 Ga0070664_100063151 3300005564 Bacteria 3158
49 Ga0068857_100034333 3300005577 Bacteria 4486
50 Ga0068857_100062335 3300005577 Bacteria 3314
51 Ga0068864_100031978 3300005618 Bacteria 4468
52 Ga0068870_10011402 3300005840 Bacteria 4120
53 Ga0068860_100066879 3300005843 Bacteria 3415
54 Ga0068862_100001571 3300005844 Bacteria 20810
55 Ga0068871_100223032 3300006358 Bacteria 1634
56 Ga0075433_10020715 3300006852 Bacteria 5503
57 Ga0075433_10042871 3300006852 Bacteria 3927
58 Ga0075434_100002820 3300006871 Bacteria 15389
59 Ga0075434_100041237 3300006871 Bacteria 4573
60 Ga0075434_100060230 3300006871 Bacteria 3776
61 Ga0075429_100067113 3300006880 Bacteria 3122
62 Ga0075429_100239121 3300006880 Bacteria 1591
63 Ga0075435_100065317 3300007076 Bacteria 2958
64 Ga0075435_100068309 3300007076 Bacteria 2895
65 Ga0075435_100075892 3300007076 Bacteria 2754
66 Ga0105244_10010285 3300009036 Bacteria 5681
67 Ga0114129_10016230 3300009147 Bacteria 10597
68 Ga0105238_10076150 3300009551 Bacteria 3346
69 Ga0163162_10179346 3300013306 Bacteria 2244
70 Ga0157375_10022671 3300013308 Bacteria 5782
71 Ga0157375_10239610 3300013308 Bacteria 1973
72 Ga0163163_10032193 3300014325 Bacteria 5064
73 Ga0157379_10010153 3300014968 Bacteria 8207
74 Ga0213876_10034874 3300021384 Bacteria 2654
75 Ga0213871_10005143 3300021441 Bacteria 2675
76 Ga0209563_100015 3300025230 Bacteria 879901
77 Ga0207425_1000536 3300025245 Bacteria 22859
78 Ga0209455_1000037 3300025272 Bacteria 464097
79 Ga0209130_1000502 3300025284 Bacteria 39793
80 Ga0209025_1028064 3300025294 Bacteria 2770
81 Ga0209564_1000009 3300025295 Bacteria 950196
82 Ga0209564_1010366 3300025295 Bacteria 4300
83 Ga0209758_1000914 3300025297 Bacteria 39998
84 Ga0209758_1005881 3300025297 Bacteria 9155
85 Ga0209758_1007271 3300025297 Bacteria 7608
86 Ga0207426_1000576 3300025302 Bacteria 49162
87 Ga0207426_1001240 3300025302 Bacteria 22455
88 Ga0209257_1000836 3300025304 Bacteria 44366
89 Ga0207697_10019565 3300025315 Bacteria 2774
90 Ga0207692_10000064 3300025898 Bacteria 31069
91 Ga0207699_10000224 3300025906 Bacteria 32816
92 Ga0207705_10037940 3300025909 Bacteria 3448
93 Ga0207684_10123396 3300025910 Bacteria 2222
94 Ga0207707_10048093 3300025912 Bacteria 3715
95 Ga0207662_10046246 3300025918 Bacteria 2574
96 Ga0207657_10011666 3300025919 Bacteria 8710
97 Ga0207657_10085426 3300025919 Bacteria 2643
98 Ga0207650_10169083 3300025925 Bacteria 1736
99 Ga0207700_10025214 3300025928 Bacteria 4126
100 Ga0207700_10082517 3300025928 Bacteria 2514
101 Ga0207690_10031212 3300025932 Bacteria 3407
102 Ga0207665_10107809 3300025939 Bacteria 1953
103 Ga0207679_10014030 3300025945 Bacteria 5256
104 Ga0207679_10019325 3300025945 Bacteria 4574
105 Ga0207667_10113670 3300025949 Bacteria 2791
106 Ga0207678_10149952 3300026067 Bacteria 1991
107 Ga0207648_10000280 3300026089 Bacteria 55313
108 Ga0207683_10065897 3300026121 Bacteria 3193
109 Ga0207428_10000481 3300027907 Bacteria 48194
110 Ga0268265_10032659 3300028380 Bacteria 3774
111 Ga0268264_10061547 3300028381 Bacteria 3149
112 Ga0265340_10001353 3300031247 Bacteria 14056
113 Ga0265331_10028745 3300031250 Bacteria 2779
114 Ga0265313_10007075 3300031595 Bacteria 7751
115 Ga0265342_10005406 3300031712 Bacteria 9751
116 Ga0265342_10020026 3300031712 Bacteria 4300
117 Ga0373935_0172526 3300035692 Bacteria 1480
118 Ga0373937_0002679 3300036401 Bacteria 14848
119 Ga0395899_0031029 3300037312 Bacteria 4018
120 Ga0395900_0001974 3300037418 Bacteria 23153
121 Ga0395900_0105540 3300037418 Bacteria 2894
122 Ga0395900_0140383 3300037418 Bacteria 2474
123 Ga0395900_0321047 3300037418 Bacteria 1529
124 Ga0395898_0093580 3300037466 Bacteria 2888
125 Ga0395901_0184659 3300038443 Bacteria 2187
126 Ga0436365_0874714 3300039437 Bacteria 8359
127 Ga0436360_0565042 3300039438 Bacteria 4866
128 Ga0436362_0340980 3300039453 Bacteria 3471
129 Ga0466972_0000164 3300044658 Bacteria 53019
130 Ga0453683_0026774 3300044673 Bacteria 3661
131 Ga0466966_0012581 3300044684 Bacteria 5608
132 Ga0466959_0011383 3300045049 Bacteria 6391
133 Ga0495653_0000002 3300046463 Bacteria 507262
134 Ga0495650_0000118 3300046471 Bacteria 187358
135 Ga0495650_0013560 3300046471 Bacteria 4301
136 Ga0495605_0000168 3300046474 Bacteria 82889
137 Ga0495605_0003733 3300046474 Bacteria 9037
138 Ga0495664_0072806 3300046477 Bacteria 2054
139 Ga0495584_0005406 3300046491 Bacteria 6766
140 Ga0495596_0003786 3300046500 Bacteria 7553
141 Ga0495607_0003689 3300046501 Bacteria 11622
142 Ga0495583_0000074 3300046506 Bacteria 177273
143 Ga0495606_0000064 3300046507 Bacteria 183631
144 Ga0495606_0001143 3300046507 Bacteria 37675
145 Ga0495606_0001845 3300046507 Bacteria 26690
146 Ga0495610_0011964 3300046512 Bacteria 5259
147 Ga0495616_0013643 3300046513 Bacteria 4576
148 Ga0495632_0001158 3300046519 Bacteria 22480
149 Ga0495637_0001096 3300046520 Bacteria 16730
150 Ga0495643_0006691 3300046522 Bacteria 7549
151 Ga0495643_0028745 3300046522 Bacteria 3114
152 Ga0495654_0000038 3300046530 Bacteria 185693
153 Ga0495609_0000002 3300046538 Bacteria 739816
154 Ga0495645_0071618 3300046543 Bacteria 2499
155 Ga0495633_0000390 3300046558 Bacteria 46254
156 Ga0495633_0007075 3300046558 Bacteria 6526
157 Ga0495656_0098059 3300046615 Bacteria 1351
158 Ga0495668_0000533 3300046616 Bacteria 47352
159 Ga0495611_0008821 3300046648 Bacteria 4265
160 Ga0495625_0000318 3300046660 Bacteria 73498
161 Ga0495659_0000001 3300046664 Bacteria 325846
162 Ga0495661_0000183 3300046665 Bacteria 72020
163 Ga0495661_0066327 3300046665 Bacteria 2124
164 Ga0495649_0000979 3300046694 Bacteria 22501
165 Ga0495589_0000083 3300046794 Bacteria 87058
166 Ga0495660_0003026 3300046810 Bacteria 10485
167 Ga0495672_0000168 3300047320 Bacteria 95544
168 Ga0495683_0034743 3300047323 Bacteria 2563
169 Ga0495687_000197 3300047443 Bacteria 86694
170 Ga0495677_0000030 3300047445 Bacteria 87817
171 Ga0495677_0000615 3300047445 Bacteria 14515
172 Ga0495679_010674 3300047446 Bacteria 3592
173 Ga0495673_0000003 3300047469 Bacteria 1491337
174 Ga0495673_0000097 3300047469 Bacteria 182247
175 Ga0495681_0016071 3300047470 Bacteria 4213
176 Ga0495686_0006489 3300047472 Bacteria 8940
177 Ga0495626_0000102 3300048091 Bacteria 110315
178 Ga0495626_0001324 3300048091 Bacteria 20137
179 Ga0495626_0013608 3300048091 Bacteria 4223
180 Ga0496104_0150669 3300048907 Bacteria 2233
181 Ga0496105_0018038 3300048908 Bacteria 5665
182 Ga0496106_0019921 3300048909 Bacteria 4975
183 Ga0496107_0052387 3300048910 Bacteria 2944
184 Ga0496109_0083414 3300048912 Bacteria 2947
185 Ga0496110_0003123 3300048913 Bacteria 12580
186 Ga0496113_0004459 3300048916 Bacteria 8614
187 Ga0496115_0051798 3300048918 Bacteria 3291
188 Ga0496121_0000624 3300048924 Bacteria 65948
189 Ga0496121_0010667 3300048924 Bacteria 10315
190 Ga0496121_0034331 3300048924 Bacteria 4567
191 Ga0496121_0185594 3300048924 Bacteria 1496
192 Ga0496122_0008013 3300048925 Bacteria 11539
193 Ga0496123_0044317 3300048926 Bacteria 3043
194 Ga0496124_0056540 3300048927 Bacteria 3308
195 Ga0496125_0138031 3300048928 Bacteria 1701
196 Ga0496126_0047932 3300048929 Bacteria 3909
197 Ga0501031_0009254 3300049568 Bacteria 6400
198 Ga0501032_0040179 3300049569 Bacteria 3180
199 Ga0501032_0147439 3300049569 Bacteria 1548
200 Ga0501033_0001316 3300049570 Bacteria 22076
201 Ga0501034_0168335 3300049571 Bacteria 2159
202 Ga0501034_0409277 3300049571 Bacteria 1278
203 Ga0501037_0019268 3300049573 Bacteria 5030
204 Ga0501037_0160930 3300049573 Bacteria 1600
205 Ga0501038_0007707 3300049574 Bacteria 9928
206 Ga0501038_0053704 3300049574 Bacteria 3467
207 Ga0501039_0032984 3300049575 Bacteria 3994
208 Ga0501041_0133070 3300049577 Bacteria 1549
209 Ga0501042_0058589 3300049578 Bacteria 2749
210 Ga0501043_0000980 3300049579 Bacteria 25248
211 Ga0501043_0048598 3300049579 Bacteria 3335
212 Ga0501043_0127492 3300049579 Bacteria 1995
213 Ga0501046_0173582 3300049580 Bacteria 1616
214 Ga0501047_0124793 3300049581 Bacteria 2455
215 Ga0501048_0042835 3300049582 Bacteria 3240
216 Ga0501068_0026161 3300049584 Bacteria 3436
217 Ga0501070_0044186 3300049586 Bacteria 3707
218 Ga0501072_0262877 3300049588 Bacteria 1373
219 Ga0501074_0066657 3300049590 Bacteria 2589
220 Ga0501074_0138604 3300049590 Bacteria 1740
221 Ga0501074_0170956 3300049590 Bacteria 1551
222 Ga0501077_0010855 3300049593 Bacteria 5674
223 Ga0501079_0104996 3300049741 Bacteria 2192
224 Ga0501080_0077279 3300049742 Bacteria 3096
225 Ga0501083_0044289 3300049744 Bacteria 3012
226 Ga0501083_0131129 3300049744 Bacteria 1643
227 Ga0501035_0010172 3300049822 Bacteria 8730
228 Ga0501035_0018983 3300049822 Bacteria 6330
229 Ga0501035_0038361 3300049822 Bacteria 4338
230 Ga0501044_0007503 3300049823 Bacteria 11997
231 Ga0501044_0033359 3300049823 Bacteria 5412
232 Ga0501045_0044539 3300049824 Bacteria 3232
233 nmdc:mga07m45_101865_c1 3300050496 Bacteria 1649
234 nmdc:mga05p37_100357_c1 3300050507 Bacteria 3565
235 nmdc:mga05p37_17501_c1 3300050507 Bacteria 8651
236 nmdc:mga09592_17655_c1 3300050508 Bacteria 5848
237 nmdc:mga0n895_127160_c1 3300050512 Bacteria 2573
238 nmdc:mga0n895_14275_c1 3300050512 Bacteria 7207
239 nmdc:mga0n895_251475_c1 3300050512 Bacteria 1794
240 nmdc:mga0n895_31942_c1 3300050512 Bacteria 5048
241 nmdc:mga0rr50_24440_c1 3300050513 Bacteria 4184
242 nmdc:mga0a205_21905_c1 3300050515 Bacteria 6044
243 nmdc:mga0a205_24177_c1 3300050515 Bacteria 5771
244 Ga0500616_0000028 3300053153 Bacteria 435722
245 Ga0500624_000007 3300053157 Bacteria 184487
246 Ga0500609_002761 3300053731 Bacteria 2500
247 Ga0501084_0066062 3300054114 Bacteria 3026
248 Ga0501084_0075781 3300054114 Bacteria 2818
249 Ga0501082_0037175 3300060353 Bacteria 4196
250 Ga0501082_0105762 3300060353 Bacteria 2434

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0262877 Ga0501072_0262877_242_1351 299
2 3300046477 Ga0495664_0072806 Ga0495664_0072806_36_1070 301
3 3300049571 Ga0501034_0168335 Ga0501034_0168335_16_1125 305
4 3300044684 Ga0466966_0012581 Ga0466966_0012581_1940_3151 308
5 3300045049 Ga0466959_0011383 Ga0466959_0011383_1424_2635 308
6 3300025939 Ga0207665_10107809 Ga0207665_101078092 309
7 3300048924 Ga0496121_0185594 Ga0496121_0185594_13_1107 310
8 3300046665 Ga0495661_0066327 Ga0495661_0066327_1018_2112 311
9 3300049577 Ga0501041_0133070 Ga0501041_0133070_19_1128 311
10 3300014968 Ga0157379_10010153 Ga0157379_100101531 314
11 3300048913 Ga0496110_0003123 Ga0496110_0003123_9685_10770 314
12 3300048928 Ga0496125_0138031 Ga0496125_0138031_11_1114 315
13 3300046615 Ga0495656_0098059 Ga0495656_0098059_237_1331 318
14 3300047469 Ga0495673_0000097 Ga0495673_0000097_172817_173926 321
15 3300049742 Ga0501080_0077279 Ga0501080_0077279_474_1691 321
16 3300046474 Ga0495605_0003733 Ga0495605_0003733_4222_5328 322
17 3300048925 Ga0496122_0008013 Ga0496122_0008013_10339_11493 322
18 3300046558 Ga0495633_0007075 Ga0495633_0007075_2795_3916 323
19 3300049590 Ga0501074_0138604 Ga0501074_0138604_10_1110 323
20 3300005327 Ga0070658_10093418 Ga0070658_100934182 324
21 3300005455 Ga0070663_100131396 Ga0070663_1001313962 324
22 3300005530 Ga0070679_100160186 Ga0070679_1001601861 324
23 3300005563 Ga0068855_100114733 Ga0068855_1001147332 324
24 3300006871 Ga0075434_100060230 Ga0075434_1000602302 324
25 3300009551 Ga0105238_10076150 Ga0105238_100761502 324
26 3300025909 Ga0207705_10037940 Ga0207705_100379403 324
27 3300025919 Ga0207657_10011666 Ga0207657_100116668 324
28 3300025949 Ga0207667_10113670 Ga0207667_101136701 324
29 3300026067 Ga0207678_10149952 Ga0207678_101499522 324
30 3300007076 Ga0075435_100068309 Ga0075435_1000683092 325
31 3300035692 Ga0373935_0172526 Ga0373935_0172526_21_1127 325
32 3300049573 Ga0501037_0160930 Ga0501037_0160930_464_1573 325
33 3300049593 Ga0501077_0010855 Ga0501077_0010855_2323_3540 325
34 3300050513 nmdc:mga0rr50_24440_c1 nmdc:mga0rr50_24440_c1_1146_2369 326
35 3300003354 JGI25160J50197_1006121 JGI25160J50197_10061215 327
36 3300025284 Ga0209130_1000502 Ga0209130_100050230 327
37 3300025302 Ga0207426_1000576 Ga0207426_100057621 327
38 3300031247 Ga0265340_10001353 Ga0265340_100013539 327
39 3300031595 Ga0265313_10007075 Ga0265313_100070751 327
40 3300031712 Ga0265342_10020026 Ga0265342_100200263 327
41 3300021384 Ga0213876_10034874 Ga0213876_100348741 330
42 3300039437 Ga0436365_0874714 Ga0436365_0874714_2958_4139 330
43 3300049744 Ga0501083_0044289 Ga0501083_0044289_1270_2484 330
44 3300054114 Ga0501084_0075781 Ga0501084_0075781_1270_2484 330
45 3300005347 Ga0070668_100024001 Ga0070668_1000240013 332
46 3300005354 Ga0070675_100043613 Ga0070675_1000436132 332
47 3300005441 Ga0070700_100040299 Ga0070700_1000402993 332
48 3300005457 Ga0070662_100115850 Ga0070662_1001158502 332
49 3300005459 Ga0068867_100023346 Ga0068867_1000233462 332
50 3300005544 Ga0070686_100070859 Ga0070686_1000708592 332
51 3300005549 Ga0070704_100001112 Ga0070704_1000011123 332
52 3300005577 Ga0068857_100062335 Ga0068857_1000623353 332
53 3300005840 Ga0068870_10011402 Ga0068870_100114022 332
54 3300005844 Ga0068862_100001571 Ga0068862_10000157115 332
55 3300013306 Ga0163162_10179346 Ga0163162_101793462 332
56 3300013308 Ga0157375_10022671 Ga0157375_100226715 332
57 3300026089 Ga0207648_10000280 Ga0207648_100002804 332
58 3300027907 Ga0207428_10000481 Ga0207428_100004818 332
59 3300028380 Ga0268265_10032659 Ga0268265_100326592 332
60 3300046507 Ga0495606_0000064 Ga0495606_0000064_4430_5581 332
61 3300046512 Ga0495610_0011964 Ga0495610_0011964_3841_4992 332
62 3300046522 Ga0495643_0028745 Ga0495643_0028745_571_1722 332
63 3300046616 Ga0495668_0000533 Ga0495668_0000533_38261_39412 332
64 3300046660 Ga0495625_0000318 Ga0495625_0000318_31260_32411 332
65 3300047472 Ga0495686_0006489 Ga0495686_0006489_4351_5502 332
66 3300005353 Ga0070669_100001192 Ga0070669_10000119215 333
67 3300006880 Ga0075429_100239121 Ga0075429_1002391212 333
68 3300025315 Ga0207697_10019565 Ga0207697_100195652 333
69 3300048912 Ga0496109_0083414 Ga0496109_0083414_1748_2905 333
70 3300005843 Ga0068860_100066879 Ga0068860_1000668793 334
71 3300028381 Ga0268264_10061547 Ga0268264_100615473 334
72 3300049579 Ga0501043_0127492 Ga0501043_0127492_133_1473 334
73 3300003322 rootL2_10154046 rootL2_101540464 337
74 3300003763 Ga0055529_1000146 Ga0055529_100014666 337
75 3300025272 Ga0209455_1000037 Ga0209455_1000037308 337
76 3300005458 Ga0070681_10010866 Ga0070681_100108669 338
77 3300006358 Ga0068871_100223032 Ga0068871_1002230322 339
78 3300037312 Ga0395899_0031029 Ga0395899_0031029_1796_3013 340
79 3300037418 Ga0395900_0105540 Ga0395900_0105540_248_1465 341
80 3300037418 Ga0395900_0140383 Ga0395900_0140383_868_2085 341
81 3300037466 Ga0395898_0093580 Ga0395898_0093580_1131_2348 341
82 3300046471 Ga0495650_0000118 Ga0495650_0000118_94803_96017 341
83 3300048907 Ga0496104_0150669 Ga0496104_0150669_433_1650 341
84 3300048916 Ga0496113_0004459 Ga0496113_0004459_4862_6133 341
85 3300048926 Ga0496123_0044317 Ga0496123_0044317_590_1861 341
86 3300003759 Ga0055525_1000009 Ga0055525_100000978 342
87 3300005366 Ga0070659_100093387 Ga0070659_1000933872 342
88 3300025230 Ga0209563_100015 Ga0209563_100015192 342
89 3300025919 Ga0207657_10085426 Ga0207657_100854262 342
90 3300025932 Ga0207690_10031212 Ga0207690_100312122 342
91 3300037418 Ga0395900_0001974 Ga0395900_0001974_6029_7246 342
92 3300048924 Ga0496121_0034331 Ga0496121_0034331_3082_4320 342
93 3300049571 Ga0501034_0409277 Ga0501034_0409277_61_1260 342
94 3300005293 Ga0065715_10179519 Ga0065715_101795191 343
95 3300005329 Ga0070683_100063512 Ga0070683_1000635122 343
96 3300005331 Ga0070670_100278143 Ga0070670_1002781431 343
97 3300005364 Ga0070673_100165673 Ga0070673_1001656732 343
98 3300005440 Ga0070705_100004014 Ga0070705_1000040146 343
99 3300005445 Ga0070708_100139565 Ga0070708_1001395652 343
100 3300005535 Ga0070684_100061250 Ga0070684_1000612503 343
101 3300005545 Ga0070695_100000155 Ga0070695_1000001559 343
102 3300005545 Ga0070695_100012116 Ga0070695_1000121163 343
103 3300005546 Ga0070696_100000499 Ga0070696_10000049925 343
104 3300005564 Ga0070664_100063151 Ga0070664_1000631514 343
105 3300005577 Ga0068857_100034333 Ga0068857_1000343332 343
106 3300005618 Ga0068864_100031978 Ga0068864_1000319783 343
107 3300006871 Ga0075434_100002820 Ga0075434_1000028204 343
108 3300006880 Ga0075429_100067113 Ga0075429_1000671131 343
109 3300007076 Ga0075435_100065317 Ga0075435_1000653171 343
110 3300009147 Ga0114129_10016230 Ga0114129_100162304 343
111 3300025912 Ga0207707_10048093 Ga0207707_100480932 343
112 3300025918 Ga0207662_10046246 Ga0207662_100462462 343
113 3300025925 Ga0207650_10169083 Ga0207650_101690831 343
114 3300025945 Ga0207679_10014030 Ga0207679_100140304 343
115 3300025945 Ga0207679_10019325 Ga0207679_100193254 343
116 3300044673 Ga0453683_0026774 Ga0453683_0026774_274_1494 343
117 3300046522 Ga0495643_0006691 Ga0495643_0006691_5807_6976 343
118 3300049582 Ga0501048_0042835 Ga0501048_0042835_463_1710 343
119 3300049584 Ga0501068_0026161 Ga0501068_0026161_1219_2466 343
120 3300049586 Ga0501070_0044186 Ga0501070_0044186_2130_3377 343
121 3300049590 Ga0501074_0066657 Ga0501074_0066657_780_2027 343
122 3300049741 Ga0501079_0104996 Ga0501079_0104996_92_1339 343
123 3300049744 Ga0501083_0131129 Ga0501083_0131129_92_1339 343
124 3300049824 Ga0501045_0044539 Ga0501045_0044539_1837_3084 343
125 3300050507 nmdc:mga05p37_17501_c1 nmdc:mga05p37_17501_c1_396_1661 343
126 3300050508 nmdc:mga09592_17655_c1 nmdc:mga09592_17655_c1_2760_4025 343
127 3300050512 nmdc:mga0n895_127160_c1 nmdc:mga0n895_127160_c1_180_1409 343
128 3300050512 nmdc:mga0n895_14275_c1 nmdc:mga0n895_14275_c1_4706_5926 343
129 3300050512 nmdc:mga0n895_31942_c1 nmdc:mga0n895_31942_c1_59_1324 343
130 3300050515 nmdc:mga0a205_21905_c1 nmdc:mga0a205_21905_c1_4133_5362 343
131 3300050515 nmdc:mga0a205_24177_c1 nmdc:mga0a205_24177_c1_416_1681 343
132 3300054114 Ga0501084_0066062 Ga0501084_0066062_1285_2532 343
133 3300060353 Ga0501082_0105762 Ga0501082_0105762_970_2217 343
134 3300046471 Ga0495650_0013560 Ga0495650_0013560_523_1719 344
135 3300050507 nmdc:mga05p37_100357_c1 nmdc:mga05p37_100357_c1_333_1565 344
136 3300050512 nmdc:mga0n895_251475_c1 nmdc:mga0n895_251475_c1_250_1482 344
137 3300049590 Ga0501074_0170956 Ga0501074_0170956_215_1429 345
138 iso_pu_bacteria 2857564685 2857564748 345
139 3300005434 Ga0070709_10000755 Ga0070709_1000075513 346
140 3300005436 Ga0070713_100027261 Ga0070713_1000272612 346
141 3300005437 Ga0070710_10002971 Ga0070710_100029718 346
142 3300005440 Ga0070705_100026051 Ga0070705_1000260512 346
143 3300005444 Ga0070694_100001263 Ga0070694_10000126311 346
144 3300005467 Ga0070706_100078007 Ga0070706_1000780072 346
145 3300005471 Ga0070698_100006494 Ga0070698_1000064947 346
146 3300005518 Ga0070699_100060148 Ga0070699_1000601482 346
147 3300005546 Ga0070696_100018420 Ga0070696_1000184204 346
148 3300005549 Ga0070704_100001916 Ga0070704_1000019162 346
149 3300005549 Ga0070704_100022977 Ga0070704_1000229772 346
150 3300006852 Ga0075433_10020715 Ga0075433_100207152 346
151 3300006852 Ga0075433_10042871 Ga0075433_100428712 346
152 3300006871 Ga0075434_100041237 Ga0075434_1000412373 346
153 3300007076 Ga0075435_100075892 Ga0075435_1000758922 346
154 3300025898 Ga0207692_10000064 Ga0207692_1000006431 346
155 3300025906 Ga0207699_10000224 Ga0207699_1000022412 346
156 3300025910 Ga0207684_10123396 Ga0207684_101233962 346
157 3300025928 Ga0207700_10025214 Ga0207700_100252143 346
158 3300025928 Ga0207700_10082517 Ga0207700_100825172 346
159 3300036401 Ga0373937_0002679 Ga0373937_0002679_2230_3468 346
160 3300046558 Ga0495633_0000390 Ga0495633_0000390_20152_21369 347
161 3300046474 Ga0495605_0000168 Ga0495605_0000168_65522_66727 348
162 3300005548 Ga0070665_100041626 Ga0070665_1000416264 349
163 3300046506 Ga0495583_0000074 Ga0495583_0000074_124956_126173 349
164 3300046513 Ga0495616_0013643 Ga0495616_0013643_2691_3908 349
165 3300046519 Ga0495632_0001158 Ga0495632_0001158_5272_6489 349
166 3300046520 Ga0495637_0001096 Ga0495637_0001096_2738_3934 349
167 3300046530 Ga0495654_0000038 Ga0495654_0000038_129062_130258 349
168 3300046648 Ga0495611_0008821 Ga0495611_0008821_689_1906 349
169 3300046810 Ga0495660_0003026 Ga0495660_0003026_8002_9219 349
170 3300047323 Ga0495683_0034743 Ga0495683_0034743_614_1831 349
171 3300047446 Ga0495679_010674 Ga0495679_010674_1932_3149 349
172 3300047470 Ga0495681_0016071 Ga0495681_0016071_1424_2641 349
173 3300049823 Ga0501044_0033359 Ga0501044_0033359_2762_4000 349
174 3300048927 Ga0496124_0056540 Ga0496124_0056540_56_1267 350
175 3300003771 Ga0055526_1000152 Ga0055526_100015228 351
176 3300025245 Ga0207425_1000536 Ga0207425_100053628 351
177 3300025294 Ga0209025_1028064 Ga0209025_10280642 351
178 3300025295 Ga0209564_1000009 Ga0209564_1000009169 351
179 3300025297 Ga0209758_1000914 Ga0209758_100091410 351
180 3300046463 Ga0495653_0000002 Ga0495653_0000002_144918_146117 351
181 3300046491 Ga0495584_0005406 Ga0495584_0005406_2048_3277 351
182 3300046501 Ga0495607_0003689 Ga0495607_0003689_5624_6853 351
183 3300046507 Ga0495606_0001845 Ga0495606_0001845_10084_11283 351
184 3300046538 Ga0495609_0000002 Ga0495609_0000002_325554_326783 351
185 3300046665 Ga0495661_0000183 Ga0495661_0000183_5825_7054 351
186 3300046794 Ga0495589_0000083 Ga0495589_0000083_64967_66196 351
187 3300047320 Ga0495672_0000168 Ga0495672_0000168_84153_85421 351
188 3300047443 Ga0495687_000197 Ga0495687_000197_20499_21728 351
189 3300047445 Ga0495677_0000030 Ga0495677_0000030_64967_66196 351
190 3300047469 Ga0495673_0000003 Ga0495673_0000003_1302150_1303349 351
191 3300048091 Ga0495626_0001324 Ga0495626_0001324_6433_7662 351
192 iso_pu_bacteria 2821131069 2821131591 351
193 3300049581 Ga0501047_0124793 Ga0501047_0124793_14_1240 352
194 iso_pu_bacteria 8054563764 8054568908 352
195 3300009036 Ga0105244_10010285 Ga0105244_100102851 353
196 3300049568 Ga0501031_0009254 Ga0501031_0009254_3061_4308 354
197 3300049569 Ga0501032_0040179 Ga0501032_0040179_263_1510 354
198 3300049570 Ga0501033_0001316 Ga0501033_0001316_5133_6380 354
199 3300049573 Ga0501037_0019268 Ga0501037_0019268_2899_4146 354
200 3300049574 Ga0501038_0053704 Ga0501038_0053704_1505_2752 354
201 3300049575 Ga0501039_0032984 Ga0501039_0032984_1863_3110 354
202 3300049578 Ga0501042_0058589 Ga0501042_0058589_1189_2436 354
203 3300049579 Ga0501043_0000980 Ga0501043_0000980_4923_6170 354
204 3300049822 Ga0501035_0018983 Ga0501035_0018983_2655_3902 354
205 3300046507 Ga0495606_0001143 Ga0495606_0001143_31705_32919 355
206 iso_pu_bacteria 2919476304 2919478447 355
207 3300060353 Ga0501082_0037175 Ga0501082_0037175_2810_4114 356
208 3300048091 Ga0495626_0000102 Ga0495626_0000102_21799_23076 357
209 3300046664 Ga0495659_0000001 Ga0495659_0000001_109386_110618 358
210 3300046694 Ga0495649_0000979 Ga0495649_0000979_20625_21842 358
211 3300047445 Ga0495677_0000615 Ga0495677_0000615_8457_9674 358
212 3300049569 Ga0501032_0147439 Ga0501032_0147439_240_1487 358
213 3300049574 Ga0501038_0007707 Ga0501038_0007707_7816_9063 358
214 3300049579 Ga0501043_0048598 Ga0501043_0048598_582_1829 358
215 3300049823 Ga0501044_0007503 Ga0501044_0007503_576_1823 358
216 3300053157 Ga0500624_000007 Ga0500624_000007_144025_145254 358
217 3300050496 nmdc:mga07m45_101865_c1 nmdc:mga07m45_101865_c1_11_1339 360
218 3300046543 Ga0495645_0071618 Ga0495645_0071618_825_2102 361
219 3300049822 Ga0501035_0038361 Ga0501035_0038361_1049_2296 361
220 3300005436 Ga0070713_100030595 Ga0070713_1000305952 362
221 3300048918 Ga0496115_0051798 Ga0496115_0051798_187_1440 362
222 3300049822 Ga0501035_0010172 Ga0501035_0010172_3159_4451 362
223 3300025302 Ga0207426_1001240 Ga0207426_100124011 364
224 3300046500 Ga0495596_0003786 Ga0495596_0003786_5925_7205 364
225 3300048091 Ga0495626_0013608 Ga0495626_0013608_1933_3237 364
226 3300005439 Ga0070711_100064864 Ga0070711_1000648641 365
227 3300013308 Ga0157375_10239610 Ga0157375_102396101 365
228 3300014325 Ga0163163_10032193 Ga0163163_100321932 365
229 3300031250 Ga0265331_10028745 Ga0265331_100287452 365
230 3300031712 Ga0265342_10005406 Ga0265342_100054062 365
231 3300048908 Ga0496105_0018038 Ga0496105_0018038_2331_3584 365
232 3300048909 Ga0496106_0019921 Ga0496106_0019921_258_1511 365
233 3300048910 Ga0496107_0052387 Ga0496107_0052387_1660_2913 365
234 iso_pu_bacteria 2643221651 2644289765 365
235 3300026121 Ga0207683_10065897 Ga0207683_100658972 368
236 3300048924 Ga0496121_0000624 Ga0496121_0000624_26755_28077 368
237 3300021441 Ga0213871_10005143 Ga0213871_100051431 369
238 3300038443 Ga0395901_0184659 Ga0395901_0184659_237_1484 369
239 3300039438 Ga0436360_0565042 Ga0436360_0565042_1473_2732 369
240 3300039453 Ga0436362_0340980 Ga0436362_0340980_1734_2993 369
241 3300048924 Ga0496121_0010667 Ga0496121_0010667_2564_3880 369
242 3300048929 Ga0496126_0047932 Ga0496126_0047932_1053_2369 369
243 3300049580 Ga0501046_0173582 Ga0501046_0173582_107_1351 369
244 3300053153 Ga0500616_0000028 Ga0500616_0000028_352458_353732 369
245 3300005434 Ga0070709_10008023 Ga0070709_100080232 370
246 3300025295 Ga0209564_1010366 Ga0209564_10103662 370
247 3300025297 Ga0209758_1007271 Ga0209758_10072718 370
248 3300025304 Ga0209257_1000836 Ga0209257_100083646 370
249 3300044658 Ga0466972_0000164 Ga0466972_0000164_35666_36973 370
250 3300005262 Ga0065165_1002476 Ga0065165_10024768 371
251 3300003215 JGI25153J46596_10012794 JGI25153J46596_100127942 372
252 3300005548 Ga0070665_100241121 Ga0070665_1002411211 372
253 3300025297 Ga0209758_1005881 Ga0209758_10058817 372
254 3300037418 Ga0395900_0321047 Ga0395900_0321047_152_1408 372
255 3300053731 Ga0500609_002761 Ga0500609_002761_448_1695 372
256 iso_pu_bacteria 2513237161 2514014400 372

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

263

438

0.89

PF07690

MFS_1

Major Facilitator Superfamily

60

396

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.7749 28 356
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.7489 28 352
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.7451 28 352
7yuf-assembly1.cif.gz_R apo human spns2 0.7297 25 352
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.7273 28 352
ID Description Score Start End Superfamily
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9667 28 191 1.20.1250.20
af_Q8IL62_16_233_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8357 28 197 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8328 28 191 1.20.1250.20
af_A0A1L1SUI3_3_201_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8165 25 186 1.20.1250.20
af_P9WLG3_19_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8089 28 197 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q3SMX4-F1-model_v4 deleted 0.9399 29 282
AF-A0A3D6B4J7-F1-model_v4 MFS transporter 0.9278 29 282 GO:0005886
GO:0022857
AF-W0Q9S4-F1-model_v4 Antibiotic MFS transporter 0.9014 31 354 GO:0005886
GO:0022857
AF-A0A1H5UN65-F1-model_v4 MFS transporter, FSR family, fosmidomycin resistance protein 0.8948 29 353 GO:0005886
GO:0022857
AF-A0A5C8LHY8-F1-model_v4 MFS transporter 0.8932 21 353 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
65.47 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map