F366819
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 196 | 250 | 394 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0010667|Ga0496121_0010667_2564_3880 |
| Length | 438 |
| Sequence | MAGSSVCYIVDKFRNSFCTPGCQLNKPVILSEDTVAAPIVTDTPAPSAVTAPAIGVLSAVSLSHFLNDMLQSLVPSIYPILKQNYGLDFSQIGMITFAFMVTSSLLQPVVGIYTDRHPKPFSLSIGMGFTFAGMILLGLAHRYEAILAAAALVGIGSAIFHPESARIARAASGGRFGFAQSLFQVGGNFGQALGPMLAALVVVPFGQGSVAWFSIAAAIAIIILWRLGVWYKPRIGPRKAANVASINSAGLSRGKVATVLVVLVSLVFSKAFYLAGINSYYTFFLIHRFGVSTQTAQMFLFVFLAASASGVFLGGPLGDRFGRKYVIWFSIVGSLPFTIALPYASLSWTFALSILIGFILSSAMPAIIVYAQELMPHRFGMISGIFFGFVFGIGGIGAAVLGEVADAHGIDFVYRICSFLPAIGLLALFLPRLKKARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 2 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 3 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 4 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 5 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 64 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 105 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 106 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 107 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 108 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 111 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 156 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 157 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 158 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 159 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 192 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 193 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.66 |
| Metatranscriptomes | 0 |
| Isolates | 2.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.98 |
| Nodule | 0.39 |
| Rhizoplane | 3.12 |
| Rhizosphere | 80.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10012794 | 3300003215 | Bacteria | 3594 |
| 2 | rootL2_10154046 | 3300003322 | Bacteria | 4268 |
| 3 | JGI25160J50197_1006121 | 3300003354 | Bacteria | 4908 |
| 4 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 5 | Ga0055529_1000146 | 3300003763 | Bacteria | 100947 |
| 6 | Ga0055526_1000152 | 3300003771 | Bacteria | 61430 |
| 7 | Ga0065165_1002476 | 3300005262 | Bacteria | 15530 |
| 8 | Ga0065715_10179519 | 3300005293 | Bacteria | 1486 |
| 9 | Ga0070658_10093418 | 3300005327 | Bacteria | 2481 |
| 10 | Ga0070683_100063512 | 3300005329 | Bacteria | 3435 |
| 11 | Ga0070670_100278143 | 3300005331 | Bacteria | 1461 |
| 12 | Ga0070668_100024001 | 3300005347 | Bacteria | 4618 |
| 13 | Ga0070669_100001192 | 3300005353 | Bacteria | 18941 |
| 14 | Ga0070675_100043613 | 3300005354 | Bacteria | 3666 |
| 15 | Ga0070673_100165673 | 3300005364 | Bacteria | 1883 |
| 16 | Ga0070659_100093387 | 3300005366 | Bacteria | 2414 |
| 17 | Ga0070709_10000755 | 3300005434 | Bacteria | 18278 |
| 18 | Ga0070709_10008023 | 3300005434 | Bacteria | 5793 |
| 19 | Ga0070713_100027261 | 3300005436 | Bacteria | 4496 |
| 20 | Ga0070713_100030595 | 3300005436 | Bacteria | 4277 |
| 21 | Ga0070710_10002971 | 3300005437 | Bacteria | 8051 |
| 22 | Ga0070711_100064864 | 3300005439 | Bacteria | 2553 |
| 23 | Ga0070705_100004014 | 3300005440 | Bacteria | 7187 |
| 24 | Ga0070705_100026051 | 3300005440 | Bacteria | 3179 |
| 25 | Ga0070700_100040299 | 3300005441 | Bacteria | 2859 |
| 26 | Ga0070694_100001263 | 3300005444 | Bacteria | 14687 |
| 27 | Ga0070708_100139565 | 3300005445 | Bacteria | 2247 |
| 28 | Ga0070663_100131396 | 3300005455 | Bacteria | 1902 |
| 29 | Ga0070662_100115850 | 3300005457 | Bacteria | 2047 |
| 30 | Ga0070681_10010866 | 3300005458 | Bacteria | 8998 |
| 31 | Ga0068867_100023346 | 3300005459 | Bacteria | 4428 |
| 32 | Ga0070706_100078007 | 3300005467 | Bacteria | 3067 |
| 33 | Ga0070698_100006494 | 3300005471 | Bacteria | 12684 |
| 34 | Ga0070699_100060148 | 3300005518 | Bacteria | 3291 |
| 35 | Ga0070679_100160186 | 3300005530 | Bacteria | 2225 |
| 36 | Ga0070684_100061250 | 3300005535 | Bacteria | 3293 |
| 37 | Ga0070686_100070859 | 3300005544 | Bacteria | 2281 |
| 38 | Ga0070695_100000155 | 3300005545 | Bacteria | 32258 |
| 39 | Ga0070695_100012116 | 3300005545 | Bacteria | 5168 |
| 40 | Ga0070696_100000499 | 3300005546 | Bacteria | 24777 |
| 41 | Ga0070696_100018420 | 3300005546 | Bacteria | 4719 |
| 42 | Ga0070665_100041626 | 3300005548 | Bacteria | 4619 |
| 43 | Ga0070665_100241121 | 3300005548 | Bacteria | 1808 |
| 44 | Ga0070704_100001112 | 3300005549 | Bacteria | 13983 |
| 45 | Ga0070704_100001916 | 3300005549 | Bacteria | 11493 |
| 46 | Ga0070704_100022977 | 3300005549 | Bacteria | 4065 |
| 47 | Ga0068855_100114733 | 3300005563 | Bacteria | 3088 |
| 48 | Ga0070664_100063151 | 3300005564 | Bacteria | 3158 |
| 49 | Ga0068857_100034333 | 3300005577 | Bacteria | 4486 |
| 50 | Ga0068857_100062335 | 3300005577 | Bacteria | 3314 |
| 51 | Ga0068864_100031978 | 3300005618 | Bacteria | 4468 |
| 52 | Ga0068870_10011402 | 3300005840 | Bacteria | 4120 |
| 53 | Ga0068860_100066879 | 3300005843 | Bacteria | 3415 |
| 54 | Ga0068862_100001571 | 3300005844 | Bacteria | 20810 |
| 55 | Ga0068871_100223032 | 3300006358 | Bacteria | 1634 |
| 56 | Ga0075433_10020715 | 3300006852 | Bacteria | 5503 |
| 57 | Ga0075433_10042871 | 3300006852 | Bacteria | 3927 |
| 58 | Ga0075434_100002820 | 3300006871 | Bacteria | 15389 |
| 59 | Ga0075434_100041237 | 3300006871 | Bacteria | 4573 |
| 60 | Ga0075434_100060230 | 3300006871 | Bacteria | 3776 |
| 61 | Ga0075429_100067113 | 3300006880 | Bacteria | 3122 |
| 62 | Ga0075429_100239121 | 3300006880 | Bacteria | 1591 |
| 63 | Ga0075435_100065317 | 3300007076 | Bacteria | 2958 |
| 64 | Ga0075435_100068309 | 3300007076 | Bacteria | 2895 |
| 65 | Ga0075435_100075892 | 3300007076 | Bacteria | 2754 |
| 66 | Ga0105244_10010285 | 3300009036 | Bacteria | 5681 |
| 67 | Ga0114129_10016230 | 3300009147 | Bacteria | 10597 |
| 68 | Ga0105238_10076150 | 3300009551 | Bacteria | 3346 |
| 69 | Ga0163162_10179346 | 3300013306 | Bacteria | 2244 |
| 70 | Ga0157375_10022671 | 3300013308 | Bacteria | 5782 |
| 71 | Ga0157375_10239610 | 3300013308 | Bacteria | 1973 |
| 72 | Ga0163163_10032193 | 3300014325 | Bacteria | 5064 |
| 73 | Ga0157379_10010153 | 3300014968 | Bacteria | 8207 |
| 74 | Ga0213876_10034874 | 3300021384 | Bacteria | 2654 |
| 75 | Ga0213871_10005143 | 3300021441 | Bacteria | 2675 |
| 76 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 77 | Ga0207425_1000536 | 3300025245 | Bacteria | 22859 |
| 78 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 79 | Ga0209130_1000502 | 3300025284 | Bacteria | 39793 |
| 80 | Ga0209025_1028064 | 3300025294 | Bacteria | 2770 |
| 81 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 82 | Ga0209564_1010366 | 3300025295 | Bacteria | 4300 |
| 83 | Ga0209758_1000914 | 3300025297 | Bacteria | 39998 |
| 84 | Ga0209758_1005881 | 3300025297 | Bacteria | 9155 |
| 85 | Ga0209758_1007271 | 3300025297 | Bacteria | 7608 |
| 86 | Ga0207426_1000576 | 3300025302 | Bacteria | 49162 |
| 87 | Ga0207426_1001240 | 3300025302 | Bacteria | 22455 |
| 88 | Ga0209257_1000836 | 3300025304 | Bacteria | 44366 |
| 89 | Ga0207697_10019565 | 3300025315 | Bacteria | 2774 |
| 90 | Ga0207692_10000064 | 3300025898 | Bacteria | 31069 |
| 91 | Ga0207699_10000224 | 3300025906 | Bacteria | 32816 |
| 92 | Ga0207705_10037940 | 3300025909 | Bacteria | 3448 |
| 93 | Ga0207684_10123396 | 3300025910 | Bacteria | 2222 |
| 94 | Ga0207707_10048093 | 3300025912 | Bacteria | 3715 |
| 95 | Ga0207662_10046246 | 3300025918 | Bacteria | 2574 |
| 96 | Ga0207657_10011666 | 3300025919 | Bacteria | 8710 |
| 97 | Ga0207657_10085426 | 3300025919 | Bacteria | 2643 |
| 98 | Ga0207650_10169083 | 3300025925 | Bacteria | 1736 |
| 99 | Ga0207700_10025214 | 3300025928 | Bacteria | 4126 |
| 100 | Ga0207700_10082517 | 3300025928 | Bacteria | 2514 |
| 101 | Ga0207690_10031212 | 3300025932 | Bacteria | 3407 |
| 102 | Ga0207665_10107809 | 3300025939 | Bacteria | 1953 |
| 103 | Ga0207679_10014030 | 3300025945 | Bacteria | 5256 |
| 104 | Ga0207679_10019325 | 3300025945 | Bacteria | 4574 |
| 105 | Ga0207667_10113670 | 3300025949 | Bacteria | 2791 |
| 106 | Ga0207678_10149952 | 3300026067 | Bacteria | 1991 |
| 107 | Ga0207648_10000280 | 3300026089 | Bacteria | 55313 |
| 108 | Ga0207683_10065897 | 3300026121 | Bacteria | 3193 |
| 109 | Ga0207428_10000481 | 3300027907 | Bacteria | 48194 |
| 110 | Ga0268265_10032659 | 3300028380 | Bacteria | 3774 |
| 111 | Ga0268264_10061547 | 3300028381 | Bacteria | 3149 |
| 112 | Ga0265340_10001353 | 3300031247 | Bacteria | 14056 |
| 113 | Ga0265331_10028745 | 3300031250 | Bacteria | 2779 |
| 114 | Ga0265313_10007075 | 3300031595 | Bacteria | 7751 |
| 115 | Ga0265342_10005406 | 3300031712 | Bacteria | 9751 |
| 116 | Ga0265342_10020026 | 3300031712 | Bacteria | 4300 |
| 117 | Ga0373935_0172526 | 3300035692 | Bacteria | 1480 |
| 118 | Ga0373937_0002679 | 3300036401 | Bacteria | 14848 |
| 119 | Ga0395899_0031029 | 3300037312 | Bacteria | 4018 |
| 120 | Ga0395900_0001974 | 3300037418 | Bacteria | 23153 |
| 121 | Ga0395900_0105540 | 3300037418 | Bacteria | 2894 |
| 122 | Ga0395900_0140383 | 3300037418 | Bacteria | 2474 |
| 123 | Ga0395900_0321047 | 3300037418 | Bacteria | 1529 |
| 124 | Ga0395898_0093580 | 3300037466 | Bacteria | 2888 |
| 125 | Ga0395901_0184659 | 3300038443 | Bacteria | 2187 |
| 126 | Ga0436365_0874714 | 3300039437 | Bacteria | 8359 |
| 127 | Ga0436360_0565042 | 3300039438 | Bacteria | 4866 |
| 128 | Ga0436362_0340980 | 3300039453 | Bacteria | 3471 |
| 129 | Ga0466972_0000164 | 3300044658 | Bacteria | 53019 |
| 130 | Ga0453683_0026774 | 3300044673 | Bacteria | 3661 |
| 131 | Ga0466966_0012581 | 3300044684 | Bacteria | 5608 |
| 132 | Ga0466959_0011383 | 3300045049 | Bacteria | 6391 |
| 133 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 134 | Ga0495650_0000118 | 3300046471 | Bacteria | 187358 |
| 135 | Ga0495650_0013560 | 3300046471 | Bacteria | 4301 |
| 136 | Ga0495605_0000168 | 3300046474 | Bacteria | 82889 |
| 137 | Ga0495605_0003733 | 3300046474 | Bacteria | 9037 |
| 138 | Ga0495664_0072806 | 3300046477 | Bacteria | 2054 |
| 139 | Ga0495584_0005406 | 3300046491 | Bacteria | 6766 |
| 140 | Ga0495596_0003786 | 3300046500 | Bacteria | 7553 |
| 141 | Ga0495607_0003689 | 3300046501 | Bacteria | 11622 |
| 142 | Ga0495583_0000074 | 3300046506 | Bacteria | 177273 |
| 143 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 144 | Ga0495606_0001143 | 3300046507 | Bacteria | 37675 |
| 145 | Ga0495606_0001845 | 3300046507 | Bacteria | 26690 |
| 146 | Ga0495610_0011964 | 3300046512 | Bacteria | 5259 |
| 147 | Ga0495616_0013643 | 3300046513 | Bacteria | 4576 |
| 148 | Ga0495632_0001158 | 3300046519 | Bacteria | 22480 |
| 149 | Ga0495637_0001096 | 3300046520 | Bacteria | 16730 |
| 150 | Ga0495643_0006691 | 3300046522 | Bacteria | 7549 |
| 151 | Ga0495643_0028745 | 3300046522 | Bacteria | 3114 |
| 152 | Ga0495654_0000038 | 3300046530 | Bacteria | 185693 |
| 153 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 154 | Ga0495645_0071618 | 3300046543 | Bacteria | 2499 |
| 155 | Ga0495633_0000390 | 3300046558 | Bacteria | 46254 |
| 156 | Ga0495633_0007075 | 3300046558 | Bacteria | 6526 |
| 157 | Ga0495656_0098059 | 3300046615 | Bacteria | 1351 |
| 158 | Ga0495668_0000533 | 3300046616 | Bacteria | 47352 |
| 159 | Ga0495611_0008821 | 3300046648 | Bacteria | 4265 |
| 160 | Ga0495625_0000318 | 3300046660 | Bacteria | 73498 |
| 161 | Ga0495659_0000001 | 3300046664 | Bacteria | 325846 |
| 162 | Ga0495661_0000183 | 3300046665 | Bacteria | 72020 |
| 163 | Ga0495661_0066327 | 3300046665 | Bacteria | 2124 |
| 164 | Ga0495649_0000979 | 3300046694 | Bacteria | 22501 |
| 165 | Ga0495589_0000083 | 3300046794 | Bacteria | 87058 |
| 166 | Ga0495660_0003026 | 3300046810 | Bacteria | 10485 |
| 167 | Ga0495672_0000168 | 3300047320 | Bacteria | 95544 |
| 168 | Ga0495683_0034743 | 3300047323 | Bacteria | 2563 |
| 169 | Ga0495687_000197 | 3300047443 | Bacteria | 86694 |
| 170 | Ga0495677_0000030 | 3300047445 | Bacteria | 87817 |
| 171 | Ga0495677_0000615 | 3300047445 | Bacteria | 14515 |
| 172 | Ga0495679_010674 | 3300047446 | Bacteria | 3592 |
| 173 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 174 | Ga0495673_0000097 | 3300047469 | Bacteria | 182247 |
| 175 | Ga0495681_0016071 | 3300047470 | Bacteria | 4213 |
| 176 | Ga0495686_0006489 | 3300047472 | Bacteria | 8940 |
| 177 | Ga0495626_0000102 | 3300048091 | Bacteria | 110315 |
| 178 | Ga0495626_0001324 | 3300048091 | Bacteria | 20137 |
| 179 | Ga0495626_0013608 | 3300048091 | Bacteria | 4223 |
| 180 | Ga0496104_0150669 | 3300048907 | Bacteria | 2233 |
| 181 | Ga0496105_0018038 | 3300048908 | Bacteria | 5665 |
| 182 | Ga0496106_0019921 | 3300048909 | Bacteria | 4975 |
| 183 | Ga0496107_0052387 | 3300048910 | Bacteria | 2944 |
| 184 | Ga0496109_0083414 | 3300048912 | Bacteria | 2947 |
| 185 | Ga0496110_0003123 | 3300048913 | Bacteria | 12580 |
| 186 | Ga0496113_0004459 | 3300048916 | Bacteria | 8614 |
| 187 | Ga0496115_0051798 | 3300048918 | Bacteria | 3291 |
| 188 | Ga0496121_0000624 | 3300048924 | Bacteria | 65948 |
| 189 | Ga0496121_0010667 | 3300048924 | Bacteria | 10315 |
| 190 | Ga0496121_0034331 | 3300048924 | Bacteria | 4567 |
| 191 | Ga0496121_0185594 | 3300048924 | Bacteria | 1496 |
| 192 | Ga0496122_0008013 | 3300048925 | Bacteria | 11539 |
| 193 | Ga0496123_0044317 | 3300048926 | Bacteria | 3043 |
| 194 | Ga0496124_0056540 | 3300048927 | Bacteria | 3308 |
| 195 | Ga0496125_0138031 | 3300048928 | Bacteria | 1701 |
| 196 | Ga0496126_0047932 | 3300048929 | Bacteria | 3909 |
| 197 | Ga0501031_0009254 | 3300049568 | Bacteria | 6400 |
| 198 | Ga0501032_0040179 | 3300049569 | Bacteria | 3180 |
| 199 | Ga0501032_0147439 | 3300049569 | Bacteria | 1548 |
| 200 | Ga0501033_0001316 | 3300049570 | Bacteria | 22076 |
| 201 | Ga0501034_0168335 | 3300049571 | Bacteria | 2159 |
| 202 | Ga0501034_0409277 | 3300049571 | Bacteria | 1278 |
| 203 | Ga0501037_0019268 | 3300049573 | Bacteria | 5030 |
| 204 | Ga0501037_0160930 | 3300049573 | Bacteria | 1600 |
| 205 | Ga0501038_0007707 | 3300049574 | Bacteria | 9928 |
| 206 | Ga0501038_0053704 | 3300049574 | Bacteria | 3467 |
| 207 | Ga0501039_0032984 | 3300049575 | Bacteria | 3994 |
| 208 | Ga0501041_0133070 | 3300049577 | Bacteria | 1549 |
| 209 | Ga0501042_0058589 | 3300049578 | Bacteria | 2749 |
| 210 | Ga0501043_0000980 | 3300049579 | Bacteria | 25248 |
| 211 | Ga0501043_0048598 | 3300049579 | Bacteria | 3335 |
| 212 | Ga0501043_0127492 | 3300049579 | Bacteria | 1995 |
| 213 | Ga0501046_0173582 | 3300049580 | Bacteria | 1616 |
| 214 | Ga0501047_0124793 | 3300049581 | Bacteria | 2455 |
| 215 | Ga0501048_0042835 | 3300049582 | Bacteria | 3240 |
| 216 | Ga0501068_0026161 | 3300049584 | Bacteria | 3436 |
| 217 | Ga0501070_0044186 | 3300049586 | Bacteria | 3707 |
| 218 | Ga0501072_0262877 | 3300049588 | Bacteria | 1373 |
| 219 | Ga0501074_0066657 | 3300049590 | Bacteria | 2589 |
| 220 | Ga0501074_0138604 | 3300049590 | Bacteria | 1740 |
| 221 | Ga0501074_0170956 | 3300049590 | Bacteria | 1551 |
| 222 | Ga0501077_0010855 | 3300049593 | Bacteria | 5674 |
| 223 | Ga0501079_0104996 | 3300049741 | Bacteria | 2192 |
| 224 | Ga0501080_0077279 | 3300049742 | Bacteria | 3096 |
| 225 | Ga0501083_0044289 | 3300049744 | Bacteria | 3012 |
| 226 | Ga0501083_0131129 | 3300049744 | Bacteria | 1643 |
| 227 | Ga0501035_0010172 | 3300049822 | Bacteria | 8730 |
| 228 | Ga0501035_0018983 | 3300049822 | Bacteria | 6330 |
| 229 | Ga0501035_0038361 | 3300049822 | Bacteria | 4338 |
| 230 | Ga0501044_0007503 | 3300049823 | Bacteria | 11997 |
| 231 | Ga0501044_0033359 | 3300049823 | Bacteria | 5412 |
| 232 | Ga0501045_0044539 | 3300049824 | Bacteria | 3232 |
| 233 | nmdc:mga07m45_101865_c1 | 3300050496 | Bacteria | 1649 |
| 234 | nmdc:mga05p37_100357_c1 | 3300050507 | Bacteria | 3565 |
| 235 | nmdc:mga05p37_17501_c1 | 3300050507 | Bacteria | 8651 |
| 236 | nmdc:mga09592_17655_c1 | 3300050508 | Bacteria | 5848 |
| 237 | nmdc:mga0n895_127160_c1 | 3300050512 | Bacteria | 2573 |
| 238 | nmdc:mga0n895_14275_c1 | 3300050512 | Bacteria | 7207 |
| 239 | nmdc:mga0n895_251475_c1 | 3300050512 | Bacteria | 1794 |
| 240 | nmdc:mga0n895_31942_c1 | 3300050512 | Bacteria | 5048 |
| 241 | nmdc:mga0rr50_24440_c1 | 3300050513 | Bacteria | 4184 |
| 242 | nmdc:mga0a205_21905_c1 | 3300050515 | Bacteria | 6044 |
| 243 | nmdc:mga0a205_24177_c1 | 3300050515 | Bacteria | 5771 |
| 244 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 245 | Ga0500624_000007 | 3300053157 | Bacteria | 184487 |
| 246 | Ga0500609_002761 | 3300053731 | Bacteria | 2500 |
| 247 | Ga0501084_0066062 | 3300054114 | Bacteria | 3026 |
| 248 | Ga0501084_0075781 | 3300054114 | Bacteria | 2818 |
| 249 | Ga0501082_0037175 | 3300060353 | Bacteria | 4196 |
| 250 | Ga0501082_0105762 | 3300060353 | Bacteria | 2434 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0262877 | Ga0501072_0262877_242_1351 | 299 |
| 2 | 3300046477 | Ga0495664_0072806 | Ga0495664_0072806_36_1070 | 301 |
| 3 | 3300049571 | Ga0501034_0168335 | Ga0501034_0168335_16_1125 | 305 |
| 4 | 3300044684 | Ga0466966_0012581 | Ga0466966_0012581_1940_3151 | 308 |
| 5 | 3300045049 | Ga0466959_0011383 | Ga0466959_0011383_1424_2635 | 308 |
| 6 | 3300025939 | Ga0207665_10107809 | Ga0207665_101078092 | 309 |
| 7 | 3300048924 | Ga0496121_0185594 | Ga0496121_0185594_13_1107 | 310 |
| 8 | 3300046665 | Ga0495661_0066327 | Ga0495661_0066327_1018_2112 | 311 |
| 9 | 3300049577 | Ga0501041_0133070 | Ga0501041_0133070_19_1128 | 311 |
| 10 | 3300014968 | Ga0157379_10010153 | Ga0157379_100101531 | 314 |
| 11 | 3300048913 | Ga0496110_0003123 | Ga0496110_0003123_9685_10770 | 314 |
| 12 | 3300048928 | Ga0496125_0138031 | Ga0496125_0138031_11_1114 | 315 |
| 13 | 3300046615 | Ga0495656_0098059 | Ga0495656_0098059_237_1331 | 318 |
| 14 | 3300047469 | Ga0495673_0000097 | Ga0495673_0000097_172817_173926 | 321 |
| 15 | 3300049742 | Ga0501080_0077279 | Ga0501080_0077279_474_1691 | 321 |
| 16 | 3300046474 | Ga0495605_0003733 | Ga0495605_0003733_4222_5328 | 322 |
| 17 | 3300048925 | Ga0496122_0008013 | Ga0496122_0008013_10339_11493 | 322 |
| 18 | 3300046558 | Ga0495633_0007075 | Ga0495633_0007075_2795_3916 | 323 |
| 19 | 3300049590 | Ga0501074_0138604 | Ga0501074_0138604_10_1110 | 323 |
| 20 | 3300005327 | Ga0070658_10093418 | Ga0070658_100934182 | 324 |
| 21 | 3300005455 | Ga0070663_100131396 | Ga0070663_1001313962 | 324 |
| 22 | 3300005530 | Ga0070679_100160186 | Ga0070679_1001601861 | 324 |
| 23 | 3300005563 | Ga0068855_100114733 | Ga0068855_1001147332 | 324 |
| 24 | 3300006871 | Ga0075434_100060230 | Ga0075434_1000602302 | 324 |
| 25 | 3300009551 | Ga0105238_10076150 | Ga0105238_100761502 | 324 |
| 26 | 3300025909 | Ga0207705_10037940 | Ga0207705_100379403 | 324 |
| 27 | 3300025919 | Ga0207657_10011666 | Ga0207657_100116668 | 324 |
| 28 | 3300025949 | Ga0207667_10113670 | Ga0207667_101136701 | 324 |
| 29 | 3300026067 | Ga0207678_10149952 | Ga0207678_101499522 | 324 |
| 30 | 3300007076 | Ga0075435_100068309 | Ga0075435_1000683092 | 325 |
| 31 | 3300035692 | Ga0373935_0172526 | Ga0373935_0172526_21_1127 | 325 |
| 32 | 3300049573 | Ga0501037_0160930 | Ga0501037_0160930_464_1573 | 325 |
| 33 | 3300049593 | Ga0501077_0010855 | Ga0501077_0010855_2323_3540 | 325 |
| 34 | 3300050513 | nmdc:mga0rr50_24440_c1 | nmdc:mga0rr50_24440_c1_1146_2369 | 326 |
| 35 | 3300003354 | JGI25160J50197_1006121 | JGI25160J50197_10061215 | 327 |
| 36 | 3300025284 | Ga0209130_1000502 | Ga0209130_100050230 | 327 |
| 37 | 3300025302 | Ga0207426_1000576 | Ga0207426_100057621 | 327 |
| 38 | 3300031247 | Ga0265340_10001353 | Ga0265340_100013539 | 327 |
| 39 | 3300031595 | Ga0265313_10007075 | Ga0265313_100070751 | 327 |
| 40 | 3300031712 | Ga0265342_10020026 | Ga0265342_100200263 | 327 |
| 41 | 3300021384 | Ga0213876_10034874 | Ga0213876_100348741 | 330 |
| 42 | 3300039437 | Ga0436365_0874714 | Ga0436365_0874714_2958_4139 | 330 |
| 43 | 3300049744 | Ga0501083_0044289 | Ga0501083_0044289_1270_2484 | 330 |
| 44 | 3300054114 | Ga0501084_0075781 | Ga0501084_0075781_1270_2484 | 330 |
| 45 | 3300005347 | Ga0070668_100024001 | Ga0070668_1000240013 | 332 |
| 46 | 3300005354 | Ga0070675_100043613 | Ga0070675_1000436132 | 332 |
| 47 | 3300005441 | Ga0070700_100040299 | Ga0070700_1000402993 | 332 |
| 48 | 3300005457 | Ga0070662_100115850 | Ga0070662_1001158502 | 332 |
| 49 | 3300005459 | Ga0068867_100023346 | Ga0068867_1000233462 | 332 |
| 50 | 3300005544 | Ga0070686_100070859 | Ga0070686_1000708592 | 332 |
| 51 | 3300005549 | Ga0070704_100001112 | Ga0070704_1000011123 | 332 |
| 52 | 3300005577 | Ga0068857_100062335 | Ga0068857_1000623353 | 332 |
| 53 | 3300005840 | Ga0068870_10011402 | Ga0068870_100114022 | 332 |
| 54 | 3300005844 | Ga0068862_100001571 | Ga0068862_10000157115 | 332 |
| 55 | 3300013306 | Ga0163162_10179346 | Ga0163162_101793462 | 332 |
| 56 | 3300013308 | Ga0157375_10022671 | Ga0157375_100226715 | 332 |
| 57 | 3300026089 | Ga0207648_10000280 | Ga0207648_100002804 | 332 |
| 58 | 3300027907 | Ga0207428_10000481 | Ga0207428_100004818 | 332 |
| 59 | 3300028380 | Ga0268265_10032659 | Ga0268265_100326592 | 332 |
| 60 | 3300046507 | Ga0495606_0000064 | Ga0495606_0000064_4430_5581 | 332 |
| 61 | 3300046512 | Ga0495610_0011964 | Ga0495610_0011964_3841_4992 | 332 |
| 62 | 3300046522 | Ga0495643_0028745 | Ga0495643_0028745_571_1722 | 332 |
| 63 | 3300046616 | Ga0495668_0000533 | Ga0495668_0000533_38261_39412 | 332 |
| 64 | 3300046660 | Ga0495625_0000318 | Ga0495625_0000318_31260_32411 | 332 |
| 65 | 3300047472 | Ga0495686_0006489 | Ga0495686_0006489_4351_5502 | 332 |
| 66 | 3300005353 | Ga0070669_100001192 | Ga0070669_10000119215 | 333 |
| 67 | 3300006880 | Ga0075429_100239121 | Ga0075429_1002391212 | 333 |
| 68 | 3300025315 | Ga0207697_10019565 | Ga0207697_100195652 | 333 |
| 69 | 3300048912 | Ga0496109_0083414 | Ga0496109_0083414_1748_2905 | 333 |
| 70 | 3300005843 | Ga0068860_100066879 | Ga0068860_1000668793 | 334 |
| 71 | 3300028381 | Ga0268264_10061547 | Ga0268264_100615473 | 334 |
| 72 | 3300049579 | Ga0501043_0127492 | Ga0501043_0127492_133_1473 | 334 |
| 73 | 3300003322 | rootL2_10154046 | rootL2_101540464 | 337 |
| 74 | 3300003763 | Ga0055529_1000146 | Ga0055529_100014666 | 337 |
| 75 | 3300025272 | Ga0209455_1000037 | Ga0209455_1000037308 | 337 |
| 76 | 3300005458 | Ga0070681_10010866 | Ga0070681_100108669 | 338 |
| 77 | 3300006358 | Ga0068871_100223032 | Ga0068871_1002230322 | 339 |
| 78 | 3300037312 | Ga0395899_0031029 | Ga0395899_0031029_1796_3013 | 340 |
| 79 | 3300037418 | Ga0395900_0105540 | Ga0395900_0105540_248_1465 | 341 |
| 80 | 3300037418 | Ga0395900_0140383 | Ga0395900_0140383_868_2085 | 341 |
| 81 | 3300037466 | Ga0395898_0093580 | Ga0395898_0093580_1131_2348 | 341 |
| 82 | 3300046471 | Ga0495650_0000118 | Ga0495650_0000118_94803_96017 | 341 |
| 83 | 3300048907 | Ga0496104_0150669 | Ga0496104_0150669_433_1650 | 341 |
| 84 | 3300048916 | Ga0496113_0004459 | Ga0496113_0004459_4862_6133 | 341 |
| 85 | 3300048926 | Ga0496123_0044317 | Ga0496123_0044317_590_1861 | 341 |
| 86 | 3300003759 | Ga0055525_1000009 | Ga0055525_100000978 | 342 |
| 87 | 3300005366 | Ga0070659_100093387 | Ga0070659_1000933872 | 342 |
| 88 | 3300025230 | Ga0209563_100015 | Ga0209563_100015192 | 342 |
| 89 | 3300025919 | Ga0207657_10085426 | Ga0207657_100854262 | 342 |
| 90 | 3300025932 | Ga0207690_10031212 | Ga0207690_100312122 | 342 |
| 91 | 3300037418 | Ga0395900_0001974 | Ga0395900_0001974_6029_7246 | 342 |
| 92 | 3300048924 | Ga0496121_0034331 | Ga0496121_0034331_3082_4320 | 342 |
| 93 | 3300049571 | Ga0501034_0409277 | Ga0501034_0409277_61_1260 | 342 |
| 94 | 3300005293 | Ga0065715_10179519 | Ga0065715_101795191 | 343 |
| 95 | 3300005329 | Ga0070683_100063512 | Ga0070683_1000635122 | 343 |
| 96 | 3300005331 | Ga0070670_100278143 | Ga0070670_1002781431 | 343 |
| 97 | 3300005364 | Ga0070673_100165673 | Ga0070673_1001656732 | 343 |
| 98 | 3300005440 | Ga0070705_100004014 | Ga0070705_1000040146 | 343 |
| 99 | 3300005445 | Ga0070708_100139565 | Ga0070708_1001395652 | 343 |
| 100 | 3300005535 | Ga0070684_100061250 | Ga0070684_1000612503 | 343 |
| 101 | 3300005545 | Ga0070695_100000155 | Ga0070695_1000001559 | 343 |
| 102 | 3300005545 | Ga0070695_100012116 | Ga0070695_1000121163 | 343 |
| 103 | 3300005546 | Ga0070696_100000499 | Ga0070696_10000049925 | 343 |
| 104 | 3300005564 | Ga0070664_100063151 | Ga0070664_1000631514 | 343 |
| 105 | 3300005577 | Ga0068857_100034333 | Ga0068857_1000343332 | 343 |
| 106 | 3300005618 | Ga0068864_100031978 | Ga0068864_1000319783 | 343 |
| 107 | 3300006871 | Ga0075434_100002820 | Ga0075434_1000028204 | 343 |
| 108 | 3300006880 | Ga0075429_100067113 | Ga0075429_1000671131 | 343 |
| 109 | 3300007076 | Ga0075435_100065317 | Ga0075435_1000653171 | 343 |
| 110 | 3300009147 | Ga0114129_10016230 | Ga0114129_100162304 | 343 |
| 111 | 3300025912 | Ga0207707_10048093 | Ga0207707_100480932 | 343 |
| 112 | 3300025918 | Ga0207662_10046246 | Ga0207662_100462462 | 343 |
| 113 | 3300025925 | Ga0207650_10169083 | Ga0207650_101690831 | 343 |
| 114 | 3300025945 | Ga0207679_10014030 | Ga0207679_100140304 | 343 |
| 115 | 3300025945 | Ga0207679_10019325 | Ga0207679_100193254 | 343 |
| 116 | 3300044673 | Ga0453683_0026774 | Ga0453683_0026774_274_1494 | 343 |
| 117 | 3300046522 | Ga0495643_0006691 | Ga0495643_0006691_5807_6976 | 343 |
| 118 | 3300049582 | Ga0501048_0042835 | Ga0501048_0042835_463_1710 | 343 |
| 119 | 3300049584 | Ga0501068_0026161 | Ga0501068_0026161_1219_2466 | 343 |
| 120 | 3300049586 | Ga0501070_0044186 | Ga0501070_0044186_2130_3377 | 343 |
| 121 | 3300049590 | Ga0501074_0066657 | Ga0501074_0066657_780_2027 | 343 |
| 122 | 3300049741 | Ga0501079_0104996 | Ga0501079_0104996_92_1339 | 343 |
| 123 | 3300049744 | Ga0501083_0131129 | Ga0501083_0131129_92_1339 | 343 |
| 124 | 3300049824 | Ga0501045_0044539 | Ga0501045_0044539_1837_3084 | 343 |
| 125 | 3300050507 | nmdc:mga05p37_17501_c1 | nmdc:mga05p37_17501_c1_396_1661 | 343 |
| 126 | 3300050508 | nmdc:mga09592_17655_c1 | nmdc:mga09592_17655_c1_2760_4025 | 343 |
| 127 | 3300050512 | nmdc:mga0n895_127160_c1 | nmdc:mga0n895_127160_c1_180_1409 | 343 |
| 128 | 3300050512 | nmdc:mga0n895_14275_c1 | nmdc:mga0n895_14275_c1_4706_5926 | 343 |
| 129 | 3300050512 | nmdc:mga0n895_31942_c1 | nmdc:mga0n895_31942_c1_59_1324 | 343 |
| 130 | 3300050515 | nmdc:mga0a205_21905_c1 | nmdc:mga0a205_21905_c1_4133_5362 | 343 |
| 131 | 3300050515 | nmdc:mga0a205_24177_c1 | nmdc:mga0a205_24177_c1_416_1681 | 343 |
| 132 | 3300054114 | Ga0501084_0066062 | Ga0501084_0066062_1285_2532 | 343 |
| 133 | 3300060353 | Ga0501082_0105762 | Ga0501082_0105762_970_2217 | 343 |
| 134 | 3300046471 | Ga0495650_0013560 | Ga0495650_0013560_523_1719 | 344 |
| 135 | 3300050507 | nmdc:mga05p37_100357_c1 | nmdc:mga05p37_100357_c1_333_1565 | 344 |
| 136 | 3300050512 | nmdc:mga0n895_251475_c1 | nmdc:mga0n895_251475_c1_250_1482 | 344 |
| 137 | 3300049590 | Ga0501074_0170956 | Ga0501074_0170956_215_1429 | 345 |
| 138 | iso_pu_bacteria | 2857564685 | 2857564748 | 345 |
| 139 | 3300005434 | Ga0070709_10000755 | Ga0070709_1000075513 | 346 |
| 140 | 3300005436 | Ga0070713_100027261 | Ga0070713_1000272612 | 346 |
| 141 | 3300005437 | Ga0070710_10002971 | Ga0070710_100029718 | 346 |
| 142 | 3300005440 | Ga0070705_100026051 | Ga0070705_1000260512 | 346 |
| 143 | 3300005444 | Ga0070694_100001263 | Ga0070694_10000126311 | 346 |
| 144 | 3300005467 | Ga0070706_100078007 | Ga0070706_1000780072 | 346 |
| 145 | 3300005471 | Ga0070698_100006494 | Ga0070698_1000064947 | 346 |
| 146 | 3300005518 | Ga0070699_100060148 | Ga0070699_1000601482 | 346 |
| 147 | 3300005546 | Ga0070696_100018420 | Ga0070696_1000184204 | 346 |
| 148 | 3300005549 | Ga0070704_100001916 | Ga0070704_1000019162 | 346 |
| 149 | 3300005549 | Ga0070704_100022977 | Ga0070704_1000229772 | 346 |
| 150 | 3300006852 | Ga0075433_10020715 | Ga0075433_100207152 | 346 |
| 151 | 3300006852 | Ga0075433_10042871 | Ga0075433_100428712 | 346 |
| 152 | 3300006871 | Ga0075434_100041237 | Ga0075434_1000412373 | 346 |
| 153 | 3300007076 | Ga0075435_100075892 | Ga0075435_1000758922 | 346 |
| 154 | 3300025898 | Ga0207692_10000064 | Ga0207692_1000006431 | 346 |
| 155 | 3300025906 | Ga0207699_10000224 | Ga0207699_1000022412 | 346 |
| 156 | 3300025910 | Ga0207684_10123396 | Ga0207684_101233962 | 346 |
| 157 | 3300025928 | Ga0207700_10025214 | Ga0207700_100252143 | 346 |
| 158 | 3300025928 | Ga0207700_10082517 | Ga0207700_100825172 | 346 |
| 159 | 3300036401 | Ga0373937_0002679 | Ga0373937_0002679_2230_3468 | 346 |
| 160 | 3300046558 | Ga0495633_0000390 | Ga0495633_0000390_20152_21369 | 347 |
| 161 | 3300046474 | Ga0495605_0000168 | Ga0495605_0000168_65522_66727 | 348 |
| 162 | 3300005548 | Ga0070665_100041626 | Ga0070665_1000416264 | 349 |
| 163 | 3300046506 | Ga0495583_0000074 | Ga0495583_0000074_124956_126173 | 349 |
| 164 | 3300046513 | Ga0495616_0013643 | Ga0495616_0013643_2691_3908 | 349 |
| 165 | 3300046519 | Ga0495632_0001158 | Ga0495632_0001158_5272_6489 | 349 |
| 166 | 3300046520 | Ga0495637_0001096 | Ga0495637_0001096_2738_3934 | 349 |
| 167 | 3300046530 | Ga0495654_0000038 | Ga0495654_0000038_129062_130258 | 349 |
| 168 | 3300046648 | Ga0495611_0008821 | Ga0495611_0008821_689_1906 | 349 |
| 169 | 3300046810 | Ga0495660_0003026 | Ga0495660_0003026_8002_9219 | 349 |
| 170 | 3300047323 | Ga0495683_0034743 | Ga0495683_0034743_614_1831 | 349 |
| 171 | 3300047446 | Ga0495679_010674 | Ga0495679_010674_1932_3149 | 349 |
| 172 | 3300047470 | Ga0495681_0016071 | Ga0495681_0016071_1424_2641 | 349 |
| 173 | 3300049823 | Ga0501044_0033359 | Ga0501044_0033359_2762_4000 | 349 |
| 174 | 3300048927 | Ga0496124_0056540 | Ga0496124_0056540_56_1267 | 350 |
| 175 | 3300003771 | Ga0055526_1000152 | Ga0055526_100015228 | 351 |
| 176 | 3300025245 | Ga0207425_1000536 | Ga0207425_100053628 | 351 |
| 177 | 3300025294 | Ga0209025_1028064 | Ga0209025_10280642 | 351 |
| 178 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009169 | 351 |
| 179 | 3300025297 | Ga0209758_1000914 | Ga0209758_100091410 | 351 |
| 180 | 3300046463 | Ga0495653_0000002 | Ga0495653_0000002_144918_146117 | 351 |
| 181 | 3300046491 | Ga0495584_0005406 | Ga0495584_0005406_2048_3277 | 351 |
| 182 | 3300046501 | Ga0495607_0003689 | Ga0495607_0003689_5624_6853 | 351 |
| 183 | 3300046507 | Ga0495606_0001845 | Ga0495606_0001845_10084_11283 | 351 |
| 184 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_325554_326783 | 351 |
| 185 | 3300046665 | Ga0495661_0000183 | Ga0495661_0000183_5825_7054 | 351 |
| 186 | 3300046794 | Ga0495589_0000083 | Ga0495589_0000083_64967_66196 | 351 |
| 187 | 3300047320 | Ga0495672_0000168 | Ga0495672_0000168_84153_85421 | 351 |
| 188 | 3300047443 | Ga0495687_000197 | Ga0495687_000197_20499_21728 | 351 |
| 189 | 3300047445 | Ga0495677_0000030 | Ga0495677_0000030_64967_66196 | 351 |
| 190 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_1302150_1303349 | 351 |
| 191 | 3300048091 | Ga0495626_0001324 | Ga0495626_0001324_6433_7662 | 351 |
| 192 | iso_pu_bacteria | 2821131069 | 2821131591 | 351 |
| 193 | 3300049581 | Ga0501047_0124793 | Ga0501047_0124793_14_1240 | 352 |
| 194 | iso_pu_bacteria | 8054563764 | 8054568908 | 352 |
| 195 | 3300009036 | Ga0105244_10010285 | Ga0105244_100102851 | 353 |
| 196 | 3300049568 | Ga0501031_0009254 | Ga0501031_0009254_3061_4308 | 354 |
| 197 | 3300049569 | Ga0501032_0040179 | Ga0501032_0040179_263_1510 | 354 |
| 198 | 3300049570 | Ga0501033_0001316 | Ga0501033_0001316_5133_6380 | 354 |
| 199 | 3300049573 | Ga0501037_0019268 | Ga0501037_0019268_2899_4146 | 354 |
| 200 | 3300049574 | Ga0501038_0053704 | Ga0501038_0053704_1505_2752 | 354 |
| 201 | 3300049575 | Ga0501039_0032984 | Ga0501039_0032984_1863_3110 | 354 |
| 202 | 3300049578 | Ga0501042_0058589 | Ga0501042_0058589_1189_2436 | 354 |
| 203 | 3300049579 | Ga0501043_0000980 | Ga0501043_0000980_4923_6170 | 354 |
| 204 | 3300049822 | Ga0501035_0018983 | Ga0501035_0018983_2655_3902 | 354 |
| 205 | 3300046507 | Ga0495606_0001143 | Ga0495606_0001143_31705_32919 | 355 |
| 206 | iso_pu_bacteria | 2919476304 | 2919478447 | 355 |
| 207 | 3300060353 | Ga0501082_0037175 | Ga0501082_0037175_2810_4114 | 356 |
| 208 | 3300048091 | Ga0495626_0000102 | Ga0495626_0000102_21799_23076 | 357 |
| 209 | 3300046664 | Ga0495659_0000001 | Ga0495659_0000001_109386_110618 | 358 |
| 210 | 3300046694 | Ga0495649_0000979 | Ga0495649_0000979_20625_21842 | 358 |
| 211 | 3300047445 | Ga0495677_0000615 | Ga0495677_0000615_8457_9674 | 358 |
| 212 | 3300049569 | Ga0501032_0147439 | Ga0501032_0147439_240_1487 | 358 |
| 213 | 3300049574 | Ga0501038_0007707 | Ga0501038_0007707_7816_9063 | 358 |
| 214 | 3300049579 | Ga0501043_0048598 | Ga0501043_0048598_582_1829 | 358 |
| 215 | 3300049823 | Ga0501044_0007503 | Ga0501044_0007503_576_1823 | 358 |
| 216 | 3300053157 | Ga0500624_000007 | Ga0500624_000007_144025_145254 | 358 |
| 217 | 3300050496 | nmdc:mga07m45_101865_c1 | nmdc:mga07m45_101865_c1_11_1339 | 360 |
| 218 | 3300046543 | Ga0495645_0071618 | Ga0495645_0071618_825_2102 | 361 |
| 219 | 3300049822 | Ga0501035_0038361 | Ga0501035_0038361_1049_2296 | 361 |
| 220 | 3300005436 | Ga0070713_100030595 | Ga0070713_1000305952 | 362 |
| 221 | 3300048918 | Ga0496115_0051798 | Ga0496115_0051798_187_1440 | 362 |
| 222 | 3300049822 | Ga0501035_0010172 | Ga0501035_0010172_3159_4451 | 362 |
| 223 | 3300025302 | Ga0207426_1001240 | Ga0207426_100124011 | 364 |
| 224 | 3300046500 | Ga0495596_0003786 | Ga0495596_0003786_5925_7205 | 364 |
| 225 | 3300048091 | Ga0495626_0013608 | Ga0495626_0013608_1933_3237 | 364 |
| 226 | 3300005439 | Ga0070711_100064864 | Ga0070711_1000648641 | 365 |
| 227 | 3300013308 | Ga0157375_10239610 | Ga0157375_102396101 | 365 |
| 228 | 3300014325 | Ga0163163_10032193 | Ga0163163_100321932 | 365 |
| 229 | 3300031250 | Ga0265331_10028745 | Ga0265331_100287452 | 365 |
| 230 | 3300031712 | Ga0265342_10005406 | Ga0265342_100054062 | 365 |
| 231 | 3300048908 | Ga0496105_0018038 | Ga0496105_0018038_2331_3584 | 365 |
| 232 | 3300048909 | Ga0496106_0019921 | Ga0496106_0019921_258_1511 | 365 |
| 233 | 3300048910 | Ga0496107_0052387 | Ga0496107_0052387_1660_2913 | 365 |
| 234 | iso_pu_bacteria | 2643221651 | 2644289765 | 365 |
| 235 | 3300026121 | Ga0207683_10065897 | Ga0207683_100658972 | 368 |
| 236 | 3300048924 | Ga0496121_0000624 | Ga0496121_0000624_26755_28077 | 368 |
| 237 | 3300021441 | Ga0213871_10005143 | Ga0213871_100051431 | 369 |
| 238 | 3300038443 | Ga0395901_0184659 | Ga0395901_0184659_237_1484 | 369 |
| 239 | 3300039438 | Ga0436360_0565042 | Ga0436360_0565042_1473_2732 | 369 |
| 240 | 3300039453 | Ga0436362_0340980 | Ga0436362_0340980_1734_2993 | 369 |
| 241 | 3300048924 | Ga0496121_0010667 | Ga0496121_0010667_2564_3880 | 369 |
| 242 | 3300048929 | Ga0496126_0047932 | Ga0496126_0047932_1053_2369 | 369 |
| 243 | 3300049580 | Ga0501046_0173582 | Ga0501046_0173582_107_1351 | 369 |
| 244 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_352458_353732 | 369 |
| 245 | 3300005434 | Ga0070709_10008023 | Ga0070709_100080232 | 370 |
| 246 | 3300025295 | Ga0209564_1010366 | Ga0209564_10103662 | 370 |
| 247 | 3300025297 | Ga0209758_1007271 | Ga0209758_10072718 | 370 |
| 248 | 3300025304 | Ga0209257_1000836 | Ga0209257_100083646 | 370 |
| 249 | 3300044658 | Ga0466972_0000164 | Ga0466972_0000164_35666_36973 | 370 |
| 250 | 3300005262 | Ga0065165_1002476 | Ga0065165_10024768 | 371 |
| 251 | 3300003215 | JGI25153J46596_10012794 | JGI25153J46596_100127942 | 372 |
| 252 | 3300005548 | Ga0070665_100241121 | Ga0070665_1002411211 | 372 |
| 253 | 3300025297 | Ga0209758_1005881 | Ga0209758_10058817 | 372 |
| 254 | 3300037418 | Ga0395900_0321047 | Ga0395900_0321047_152_1408 | 372 |
| 255 | 3300053731 | Ga0500609_002761 | Ga0500609_002761_448_1695 | 372 |
| 256 | iso_pu_bacteria | 2513237161 | 2514014400 | 372 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8jtc-assembly1.cif.gz_A | human vmat2 complex with reserpine | 0.7749 | 28 | 356 |
| 8ex4-assembly1.cif.gz_A | human s1p transporter spns2 in an inward-facing open conformation (state 1) | 0.7489 | 28 | 352 |
| 8g92-assembly1.cif.gz_A | structure of inhibitor 16d-bound spns2 | 0.7451 | 28 | 352 |
| 7yuf-assembly1.cif.gz_R | apo human spns2 | 0.7297 | 25 | 352 |
| 8ex6-assembly1.cif.gz_A | human s1p transporter spns2 in an inward-facing open conformation (state 1*) | 0.7273 | 28 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9667 | 28 | 191 | 1.20.1250.20 |
| af_Q8IL62_16_233_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8357 | 28 | 197 | 1.20.1250.20 |
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8328 | 28 | 191 | 1.20.1250.20 |
| af_A0A1L1SUI3_3_201_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8165 | 25 | 186 | 1.20.1250.20 |
| af_P9WLG3_19_213_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8089 | 28 | 197 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3SMX4-F1-model_v4 | deleted | 0.9399 | 29 | 282 |
|
| AF-A0A3D6B4J7-F1-model_v4 | MFS transporter | 0.9278 | 29 | 282 |
GO:0005886
GO:0022857 |
| AF-W0Q9S4-F1-model_v4 | Antibiotic MFS transporter | 0.9014 | 31 | 354 |
GO:0005886
GO:0022857 |
| AF-A0A1H5UN65-F1-model_v4 | MFS transporter, FSR family, fosmidomycin resistance protein | 0.8948 | 29 | 353 |
GO:0005886
GO:0022857 |
| AF-A0A5C8LHY8-F1-model_v4 | MFS transporter | 0.8932 | 21 | 353 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar