F366766

General Info

Members Datasets Scaffolds Average Seq Length
256 154 512 191

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000629|Ga0495668_0000629_21642_22340
Length 232
Sequence LIARERCARRKFLRFRKRKLIQGLEFDTFLNGKANLEIFWKIMMVSVEKLVEGLRAIPEEEFTCDNVYQFLGENPVDVNTISQYFHWSDRCYTRNLIYKDERFELMAICWEKGQVSRVHNHWEQKCWMTVPVGKLRGQNFRAVETDEAKGFCKLEETDQFDLSDCLATKVELEEPIHQILNLPEFNERAVSLHIYSKPYDRCLSYCRETDTFKEVQLFYTSIDGKLCDGVTL

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
136 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
137 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
138 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
139 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
140 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
141 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
142 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
143 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
144 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
149 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
150 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
151 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
152 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.78
Rhizosphere 98.44
Stem 0
Stem Tuber 0
Unclassified 30.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0000629 3300046616 Bacteria 42412
2 LJQas_1000437 3300000549 Bacteria 6908
3 Ga0065704_10077835 3300005289 Bacteria 4588
4 Ga0070658_10395898 3300005327 Bacteria 1186
5 Ga0070676_10110613 3300005328 Bacteria 1710
6 Ga0070683_100259305 3300005329 Bacteria 1653
7 Ga0070690_100136859 3300005330 Bacteria 1659
8 Ga0070670_100081612 3300005331 Unclassified 2778
9 Ga0070670_100194869 3300005331 Bacteria 1760
10 Ga0070670_100807033 3300005331 Bacteria 848
11 Ga0070670_101121802 3300005331 Bacteria 717
12 Ga0070677_10143031 3300005333 Unclassified 1105
13 Ga0070677_10277675 3300005333 Unclassified 843
14 Ga0068869_100312132 3300005334 Archaea 1273
15 Ga0070666_10315560 3300005335 Unclassified 1114
16 Ga0070680_100920838 3300005336 Unclassified 754
17 Ga0070689_100033849 3300005340 Bacteria 3896
18 Ga0070687_100058887 3300005343 Unclassified 2020
19 Ga0070675_100167965 3300005354 Bacteria 1890
20 Ga0070671_100107842 3300005355 Bacteria 2339
21 Ga0070671_100215389 3300005355 Bacteria 1629
22 Ga0070674_100115086 3300005356 Bacteria 1982
23 Ga0070673_100114144 3300005364 Unclassified 2244
24 Ga0070667_100072586 3300005367 Bacteria 2933
25 Ga0070667_100307055 3300005367 Unclassified 1429
26 Ga0070711_100000004 3300005439 Bacteria 188789
27 Ga0070694_100359348 3300005444 Bacteria 1130
28 Ga0070708_100200349 3300005445 Unclassified 1869
29 Ga0070663_100069489 3300005455 Unclassified 2559
30 Ga0070663_100467321 3300005455 Bacteria 1042
31 Ga0070678_100887656 3300005456 Unclassified 814
32 Ga0068867_100299285 3300005459 Archaea 1326
33 Ga0068867_100594458 3300005459 Bacteria 964
34 Ga0068867_101176968 3300005459 Bacteria 703
35 Ga0070685_10166033 3300005466 Unclassified 1411
36 Ga0070706_100001373 3300005467 Bacteria 25852
37 Ga0068853_100123265 3300005539 Bacteria 2314
38 Ga0068853_100919814 3300005539 Bacteria 840
39 Ga0070672_100020292 3300005543 Bacteria 4844
40 Ga0070672_100080497 3300005543 Bacteria 2610
41 Ga0070672_100643980 3300005543 Unclassified 925
42 Ga0070686_100010820 3300005544 Bacteria 5159
43 Ga0070693_100335419 3300005547 Bacteria 1030
44 Ga0070704_100775557 3300005549 Bacteria 855
45 Ga0070664_100093407 3300005564 Unclassified 2607
46 Ga0070664_100200291 3300005564 Bacteria 1782
47 Ga0068857_100043856 3300005577 Bacteria 3967
48 Ga0068857_100208044 3300005577 Bacteria 1785
49 Ga0068854_100102372 3300005578 Unclassified 2149
50 Ga0068854_100534497 3300005578 Unclassified 992
51 Ga0068854_100998442 3300005578 Unclassified 741
52 Ga0068852_100102914 3300005616 Bacteria 2581
53 Ga0068852_100308408 3300005616 Bacteria 1534
54 Ga0068852_100708271 3300005616 Unclassified 1017
55 Ga0068859_100006539 3300005617 Bacteria 11835
56 Ga0068859_100047886 3300005617 Bacteria 4295
57 Ga0068859_100136251 3300005617 Unclassified 2528
58 Ga0068859_100140623 3300005617 Bacteria 2487
59 Ga0068864_100061992 3300005618 Bacteria 3239
60 Ga0068864_100081531 3300005618 Bacteria 2836
61 Ga0068864_100231973 3300005618 Bacteria 1707
62 Ga0068861_100267548 3300005719 Bacteria 1466
63 Ga0068851_10065647 3300005834 Bacteria 1868
64 Ga0068863_100124186 3300005841 Bacteria 2462
65 Ga0068863_100297782 3300005841 Archaea 1564
66 Ga0068858_100172755 3300005842 Bacteria 2038
67 Ga0068858_100351124 3300005842 Bacteria 1412
68 Ga0068858_100661102 3300005842 Unclassified 1015
69 Ga0068860_100051576 3300005843 Bacteria 3914
70 Ga0068862_100123713 3300005844 Bacteria 2282
71 Ga0097621_100230568 3300006237 Bacteria 1616
72 Ga0068865_100033554 3300006881 Bacteria 3438
73 Ga0068865_100415895 3300006881 Bacteria 1104
74 Ga0075436_100001837 3300006914 Bacteria 14550
75 Ga0075436_100016424 3300006914 Bacteria 5065
76 Ga0097620_100006540 3300006931 Bacteria 11835
77 Ga0097620_100047885 3300006931 Bacteria 4295
78 Ga0097620_100136246 3300006931 Unclassified 2528
79 Ga0097620_100140636 3300006931 Bacteria 2487
80 Ga0105251_10065599 3300009011 Bacteria 1699
81 Ga0105240_10330876 3300009093 Unclassified 1733
82 Ga0105245_10666780 3300009098 Bacteria 1071
83 Ga0105243_10117885 3300009148 Bacteria 2233
84 Ga0105241_10133187 3300009174 Unclassified 2015
85 Ga0105242_10010680 3300009176 Bacteria 7048
86 Ga0105242_10237387 3300009176 Bacteria 1637
87 Ga0105248_10025432 3300009177 Bacteria 6582
88 Ga0105248_10056746 3300009177 Unclassified 4394
89 Ga0105248_10333617 3300009177 Bacteria 1708
90 Ga0105237_10093807 3300009545 Unclassified 2991
91 Ga0105237_10887130 3300009545 Unclassified 899
92 Ga0105249_10020767 3300009553 Bacteria 5873
93 Ga0105249_10073880 3300009553 Bacteria 3155
94 Ga0105249_10817545 3300009553 Unclassified 996
95 Ga0105239_10065804 3300010375 Unclassified 3982
96 Ga0157373_10304373 3300013100 Bacteria 1132
97 Ga0157371_10404166 3300013102 Unclassified 1000
98 Ga0157370_10098360 3300013104 Bacteria 2744
99 Ga0157370_10530147 3300013104 Bacteria 1080
100 Ga0157369_10221895 3300013105 Bacteria 1978
101 Ga0157374_10182962 3300013296 Bacteria 2048
102 Ga0157378_10003833 3300013297 Bacteria 13299
103 Ga0163162_10067446 3300013306 Unclassified 3628
104 Ga0163162_10234462 3300013306 Bacteria 1966
105 Ga0163162_10622966 3300013306 Unclassified 1204
106 Ga0163162_10908545 3300013306 Unclassified 993
107 Ga0157372_10107076 3300013307 Bacteria 3198
108 Ga0157372_10612145 3300013307 Bacteria 1269
109 Ga0157372_10718657 3300013307 Bacteria 1162
110 Ga0157375_10102649 3300013308 Bacteria 2945
111 Ga0157375_10105526 3300013308 Bacteria 2908
112 Ga0157375_10338557 3300013308 Bacteria 1670
113 Ga0163163_10087406 3300014325 Bacteria 3128
114 Ga0163163_10092391 3300014325 Bacteria 3041
115 Ga0163163_10313898 3300014325 Bacteria 1621
116 Ga0157380_10820020 3300014326 Bacteria 949
117 Ga0157376_10061426 3300014969 Unclassified 3159
118 Ga0157376_10254082 3300014969 Bacteria 1643
119 Ga0163161_10004429 3300017792 Bacteria 9790
120 Ga0163161_10007578 3300017792 Bacteria 7506
121 Ga0213873_10080604 3300021358 Bacteria 910
122 Ga0213876_10316252 3300021384 Unclassified 830
123 Ga0207656_10197876 3300025321 Bacteria 970
124 Ga0207653_10000890 3300025885 Bacteria 9923
125 Ga0207682_10238525 3300025893 Unclassified 844
126 Ga0207710_10042531 3300025900 Bacteria 2018
127 Ga0207680_10204259 3300025903 Bacteria 1348
128 Ga0207684_10001424 3300025910 Bacteria 25878
129 Ga0207654_10220201 3300025911 Unclassified 1259
130 Ga0207707_10009278 3300025912 Bacteria 8533
131 Ga0207663_10000007 3300025916 Bacteria 208566
132 Ga0207660_10830830 3300025917 Unclassified 754
133 Ga0207649_10054675 3300025920 Bacteria 2485
134 Ga0207650_10038762 3300025925 Bacteria 3482
135 Ga0207650_10107089 3300025925 Bacteria 2159
136 Ga0207650_10202640 3300025925 Bacteria 1590
137 Ga0207650_10539678 3300025925 Unclassified 977
138 Ga0207659_10294777 3300025926 Unclassified 1330
139 Ga0207687_10496322 3300025927 Bacteria 1018
140 Ga0207644_10011066 3300025931 Bacteria 5959
141 Ga0207644_10206128 3300025931 Bacteria 1553
142 Ga0207644_10228315 3300025931 Bacteria 1478
143 Ga0207706_10222897 3300025933 Unclassified 1651
144 Ga0207686_10273522 3300025934 Bacteria 1244
145 Ga0207686_10543756 3300025934 Unclassified 907
146 Ga0207709_10771234 3300025935 Unclassified 774
147 Ga0207691_10023700 3300025940 Bacteria 5777
148 Ga0207691_10201175 3300025940 Bacteria 1734
149 Ga0207689_10405486 3300025942 Archaea 1137
150 Ga0207689_10582661 3300025942 Unclassified 941
151 Ga0207667_10345743 3300025949 Unclassified 1517
152 Ga0207651_10192506 3300025960 Bacteria 1628
153 Ga0207712_10006912 3300025961 Bacteria 7162
154 Ga0207712_10051867 3300025961 Bacteria 2871
155 Ga0207712_10174574 3300025961 Bacteria 1683
156 Ga0207640_10288111 3300025981 Unclassified 1293
157 Ga0207640_10412029 3300025981 Bacteria 1103
158 Ga0207640_10554397 3300025981 Unclassified 966
159 Ga0207658_10251656 3300025986 Unclassified 1501
160 Ga0207677_10214553 3300026023 Bacteria 1539
161 Ga0207703_10005636 3300026035 Bacteria 10056
162 Ga0207703_10184557 3300026035 Bacteria 1843
163 Ga0207703_10642529 3300026035 Bacteria 1006
164 Ga0207703_10825691 3300026035 Unclassified 886
165 Ga0207678_10021993 3300026067 Bacteria 5590
166 Ga0207708_10489637 3300026075 Bacteria 1029
167 Ga0207641_10032586 3300026088 Bacteria 4326
168 Ga0207641_10372714 3300026088 Unclassified 1365
169 Ga0207648_10514646 3300026089 Bacteria 1096
170 Ga0207648_10923757 3300026089 Unclassified 816
171 Ga0207676_10044344 3300026095 Bacteria 3430
172 Ga0207676_10114744 3300026095 Bacteria 2260
173 Ga0207674_10067483 3300026116 Bacteria 3601
174 Ga0207675_101547870 3300026118 Unclassified 684
175 Ga0207698_10253041 3300026142 Bacteria 1613
176 Ga0207698_10771920 3300026142 Bacteria 961
177 Ga0209967_1030187 3300027364 Bacteria 810
178 Ga0268265_10137373 3300028380 Bacteria 2041
179 Ga0268265_10143740 3300028380 Bacteria 2001
180 Ga0268265_10253706 3300028380 Bacteria 1560
181 Ga0268264_11215298 3300028381 Unclassified 763
182 Ga0307408_100771064 3300031548 Bacteria 870
183 Ga0307405_10003286 3300031731 Bacteria 7389
184 Ga0307405_10158746 3300031731 Bacteria 1599
185 Ga0307405_10243651 3300031731 Unclassified 1333
186 Ga0307413_10000651 3300031824 Bacteria 11754
187 Ga0307413_10144223 3300031824 Bacteria 1650
188 Ga0307410_10001514 3300031852 Bacteria 10567
189 Ga0307410_10016149 3300031852 Bacteria 4445
190 Ga0307410_10038758 3300031852 Bacteria 3124
191 Ga0307410_10305439 3300031852 Bacteria 1257
192 Ga0307410_10583166 3300031852 Unclassified 931
193 Ga0307406_10025402 3300031901 Unclassified 3547
194 Ga0307406_10118733 3300031901 Bacteria 1834
195 Ga0307406_10191126 3300031901 Bacteria 1499
196 Ga0307407_10014090 3300031903 Bacteria 3904
197 Ga0307407_10029838 3300031903 Bacteria 2934
198 Ga0307409_100062447 3300031995 Bacteria 2916
199 Ga0307409_100093060 3300031995 Unclassified 2476
200 Ga0307409_100111754 3300031995 Bacteria 2292
201 Ga0307409_100156157 3300031995 Unclassified 1988
202 Ga0307409_100283136 3300031995 Unclassified 1533
203 Ga0307409_100550028 3300031995 Bacteria 1133
204 Ga0307416_100037984 3300032002 Bacteria 3711
205 Ga0307416_100141985 3300032002 Bacteria 2185
206 Ga0307416_100257318 3300032002 Bacteria 1703
207 Ga0307416_100268950 3300032002 Bacteria 1672
208 Ga0307416_100718325 3300032002 Unclassified 1090
209 Ga0307414_10011020 3300032004 Bacteria 5283
210 Ga0307414_10184807 3300032004 Bacteria 1680
211 Ga0307411_10016241 3300032005 Bacteria 4212
212 Ga0307411_10026861 3300032005 Bacteria 3472
213 Ga0307411_10063645 3300032005 Bacteria 2466
214 Ga0307411_10130297 3300032005 Bacteria 1837
215 Ga0307411_10296368 3300032005 Bacteria 1295
216 Ga0307411_10360746 3300032005 Bacteria 1188
217 Ga0307415_100003352 3300032126 Bacteria 8137
218 Ga0307415_100200589 3300032126 Unclassified 1583
219 Ga0307415_100303982 3300032126 Unclassified 1323
220 Ga0373931_0428733 3300035691 Bacteria 842
221 Ga0373937_0084150 3300036401 Unclassified 2943
222 Ga0373937_0549829 3300036401 Unclassified 1097
223 Ga0395900_0928397 3300037418 Bacteria 793
224 Ga0395905_0581685 3300037471 Bacteria 1021
225 Ga0436365_1334583 3300039437 Bacteria 1070
226 Ga0436362_0807947 3300039453 Bacteria 1379
227 Ga0451791_0993311 3300041451 Bacteria 986
228 Ga0453683_0088392 3300044673 Unclassified 1942
229 Ga0495598_0026019 3300046537 Bacteria 1600
230 Ga0496109_0090267 3300048912 Bacteria 2834
231 Ga0501292_051161 3300049515 Unclassified 733
232 Ga0501072_0099770 3300049588 Bacteria 2308
233 Ga0501209_028796 3300049656 Unclassified 1392
234 Ga0501216_038314 3300049660 Bacteria 908
235 Ga0501223_051909 3300049663 Bacteria 796
236 Ga0501223_063602 3300049663 Unclassified 723
237 Ga0501227_047023 3300049665 Bacteria 1080
238 Ga0501228_007728 3300049666 Bacteria 1012
239 Ga0501230_070318 3300049667 Bacteria 720
240 Ga0501236_058842 3300049670 Unclassified 678
241 Ga0501239_003397 3300049672 Unclassified 1512
242 Ga0501242_010944 3300049674 Bacteria 1089
243 Ga0501242_011461 3300049674 Unclassified 1071
244 Ga0501243_063003 3300049675 Bacteria 691
245 Ga0501249_008247 3300049679 Unclassified 2161
246 Ga0501250_019778 3300049680 Unclassified 863
247 Ga0501257_083725 3300049686 Unclassified 825
248 Ga0501234_015216 3300049707 Unclassified 1210
249 Ga0501234_036757 3300049707 Unclassified 797
250 Ga0501245_016237 3300049708 Unclassified 1127
251 Ga0501263_002268 3300049760 Unclassified 1939
252 Ga0501268_002983 3300049765 Bacteria 2280
253 Ga0501272_035048 3300049769 Unclassified 652
254 nmdc:mga0n895_19226_c1 3300050512 Bacteria 6344
255 nmdc:mga08x19_11888_c1 3300050514 Bacteria 5237
256 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
257 Ga0495668_0000629
258 LJQas_1000437
259 Ga0065704_10077835
260 Ga0070658_10395898
261 Ga0070676_10110613
262 Ga0070683_100259305
263 Ga0070690_100136859
264 Ga0070670_100081612
265 Ga0070670_100194869
266 Ga0070670_100807033
267 Ga0070670_101121802
268 Ga0070677_10143031
269 Ga0070677_10277675
270 Ga0068869_100312132
271 Ga0070666_10315560
272 Ga0070680_100920838
273 Ga0070689_100033849
274 Ga0070687_100058887
275 Ga0070675_100167965
276 Ga0070671_100107842
277 Ga0070671_100215389
278 Ga0070674_100115086
279 Ga0070673_100114144
280 Ga0070667_100072586
281 Ga0070667_100307055
282 Ga0070711_100000004
283 Ga0070694_100359348
284 Ga0070708_100200349
285 Ga0070663_100069489
286 Ga0070663_100467321
287 Ga0070678_100887656
288 Ga0068867_100299285
289 Ga0068867_100594458
290 Ga0068867_101176968
291 Ga0070685_10166033
292 Ga0070706_100001373
293 Ga0068853_100123265
294 Ga0068853_100919814
295 Ga0070672_100020292
296 Ga0070672_100080497
297 Ga0070672_100643980
298 Ga0070686_100010820
299 Ga0070693_100335419
300 Ga0070704_100775557
301 Ga0070664_100093407
302 Ga0070664_100200291
303 Ga0068857_100043856
304 Ga0068857_100208044
305 Ga0068854_100102372
306 Ga0068854_100534497
307 Ga0068854_100998442
308 Ga0068852_100102914
309 Ga0068852_100308408
310 Ga0068852_100708271
311 Ga0068859_100006539
312 Ga0068859_100047886
313 Ga0068859_100136251
314 Ga0068859_100140623
315 Ga0068864_100061992
316 Ga0068864_100081531
317 Ga0068864_100231973
318 Ga0068861_100267548
319 Ga0068851_10065647
320 Ga0068863_100124186
321 Ga0068863_100297782
322 Ga0068858_100172755
323 Ga0068858_100351124
324 Ga0068858_100661102
325 Ga0068860_100051576
326 Ga0068862_100123713
327 Ga0097621_100230568
328 Ga0068865_100033554
329 Ga0068865_100415895
330 Ga0075436_100001837
331 Ga0075436_100016424
332 Ga0097620_100006540
333 Ga0097620_100047885
334 Ga0097620_100136246
335 Ga0097620_100140636
336 Ga0105251_10065599
337 Ga0105240_10330876
338 Ga0105245_10666780
339 Ga0105243_10117885
340 Ga0105241_10133187
341 Ga0105242_10010680
342 Ga0105242_10237387
343 Ga0105248_10025432
344 Ga0105248_10056746
345 Ga0105248_10333617
346 Ga0105237_10093807
347 Ga0105237_10887130
348 Ga0105249_10020767
349 Ga0105249_10073880
350 Ga0105249_10817545
351 Ga0105239_10065804
352 Ga0157373_10304373
353 Ga0157371_10404166
354 Ga0157370_10098360
355 Ga0157370_10530147
356 Ga0157369_10221895
357 Ga0157374_10182962
358 Ga0157378_10003833
359 Ga0163162_10067446
360 Ga0163162_10234462
361 Ga0163162_10622966
362 Ga0163162_10908545
363 Ga0157372_10107076
364 Ga0157372_10612145
365 Ga0157372_10718657
366 Ga0157375_10102649
367 Ga0157375_10105526
368 Ga0157375_10338557
369 Ga0163163_10087406
370 Ga0163163_10092391
371 Ga0163163_10313898
372 Ga0157380_10820020
373 Ga0157376_10061426
374 Ga0157376_10254082
375 Ga0163161_10004429
376 Ga0163161_10007578
377 Ga0213873_10080604
378 Ga0213876_10316252
379 Ga0207656_10197876
380 Ga0207653_10000890
381 Ga0207682_10238525
382 Ga0207710_10042531
383 Ga0207680_10204259
384 Ga0207684_10001424
385 Ga0207654_10220201
386 Ga0207707_10009278
387 Ga0207663_10000007
388 Ga0207660_10830830
389 Ga0207649_10054675
390 Ga0207650_10038762
391 Ga0207650_10107089
392 Ga0207650_10202640
393 Ga0207650_10539678
394 Ga0207659_10294777
395 Ga0207687_10496322
396 Ga0207644_10011066
397 Ga0207644_10206128
398 Ga0207644_10228315
399 Ga0207706_10222897
400 Ga0207686_10273522
401 Ga0207686_10543756
402 Ga0207709_10771234
403 Ga0207691_10023700
404 Ga0207691_10201175
405 Ga0207689_10405486
406 Ga0207689_10582661
407 Ga0207667_10345743
408 Ga0207651_10192506
409 Ga0207712_10006912
410 Ga0207712_10051867
411 Ga0207712_10174574
412 Ga0207640_10288111
413 Ga0207640_10412029
414 Ga0207640_10554397
415 Ga0207658_10251656
416 Ga0207677_10214553
417 Ga0207703_10005636
418 Ga0207703_10184557
419 Ga0207703_10642529
420 Ga0207703_10825691
421 Ga0207678_10021993
422 Ga0207708_10489637
423 Ga0207641_10032586
424 Ga0207641_10372714
425 Ga0207648_10514646
426 Ga0207648_10923757
427 Ga0207676_10044344
428 Ga0207676_10114744
429 Ga0207674_10067483
430 Ga0207675_101547870
431 Ga0207698_10253041
432 Ga0207698_10771920
433 Ga0209967_1030187
434 Ga0268265_10137373
435 Ga0268265_10143740
436 Ga0268265_10253706
437 Ga0268264_11215298
438 Ga0307408_100771064
439 Ga0307405_10003286
440 Ga0307405_10158746
441 Ga0307405_10243651
442 Ga0307413_10000651
443 Ga0307413_10144223
444 Ga0307410_10001514
445 Ga0307410_10016149
446 Ga0307410_10038758
447 Ga0307410_10305439
448 Ga0307410_10583166
449 Ga0307406_10025402
450 Ga0307406_10118733
451 Ga0307406_10191126
452 Ga0307407_10014090
453 Ga0307407_10029838
454 Ga0307409_100062447
455 Ga0307409_100093060
456 Ga0307409_100111754
457 Ga0307409_100156157
458 Ga0307409_100283136
459 Ga0307409_100550028
460 Ga0307416_100037984
461 Ga0307416_100141985
462 Ga0307416_100257318
463 Ga0307416_100268950
464 Ga0307416_100718325
465 Ga0307414_10011020
466 Ga0307414_10184807
467 Ga0307411_10016241
468 Ga0307411_10026861
469 Ga0307411_10063645
470 Ga0307411_10130297
471 Ga0307411_10296368
472 Ga0307411_10360746
473 Ga0307415_100003352
474 Ga0307415_100200589
475 Ga0307415_100303982
476 Ga0373931_0428733
477 Ga0373937_0084150
478 Ga0373937_0549829
479 Ga0395900_0928397
480 Ga0395905_0581685
481 Ga0436365_1334583
482 Ga0436362_0807947
483 Ga0451791_0993311
484 Ga0453683_0088392
485 Ga0495598_0026019
486 Ga0496109_0090267
487 Ga0501292_051161
488 Ga0501072_0099770
489 Ga0501209_028796
490 Ga0501216_038314
491 Ga0501223_051909
492 Ga0501223_063602
493 Ga0501227_047023
494 Ga0501228_007728
495 Ga0501230_070318
496 Ga0501236_058842
497 Ga0501239_003397
498 Ga0501242_010944
499 Ga0501242_011461
500 Ga0501243_063003
501 Ga0501249_008247
502 Ga0501250_019778
503 Ga0501257_083725
504 Ga0501234_015216
505 Ga0501234_036757
506 Ga0501245_016237
507 Ga0501263_002268
508 Ga0501268_002983
509 Ga0501272_035048
510 nmdc:mga0n895_19226_c1
511 nmdc:mga08x19_11888_c1
512 nmdc:mga08x19_2_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05995

CDO_I

Cysteine dioxygenase type I

43

208

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u1m-assembly1.cif.gz_A resting state of rat cysteine dioxygenase r60e variant 0.9183 2 184
5efu-assembly1.cif.gz_A resting state of rat cysteine dioxygenase h155q variant 0.901 2 184
5fdb-assembly1.cif.gz_A iron free rat cysteine dioxygenase r60qc164r variant 0.8997 2 184
4ubg-assembly1.cif.gz_A resting state of rat cysteine dioxygenase c93g variant 0.8989 2 184
4ysf-assembly1.cif.gz_A resting state of rat cysteine dioxygenase h155n variant 0.896 2 184
ID Description Score Start End Superfamily
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8954 3 184 2.60.120.10
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8594 4 188 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8545 3 184 2.60.120.10
3eqeB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8506 3 157 2.60.120.10
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8381 4 188 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7T9G8A0-F1-model_v4 deleted 0.9954 2 189
AF-A0A7W1DEA1-F1-model_v4 Cysteine dioxygenase 0.9921 69 189 GO:0008198
GO:0017172
GO:0019448
AF-A0A2V9BAU7-F1-model_v4 Cysteine dioxygenase 0.988 2 189 GO:0008198
GO:0017172
GO:0019448
AF-A0A2V8YXT1-F1-model_v4 Cysteine dioxygenase 0.9872 2 189 GO:0008198
GO:0017172
GO:0019448
AF-A0A2V8XMH1-F1-model_v4 Cysteine dioxygenase 0.9866 2 189 GO:0008198
GO:0017172
GO:0019448

Map