F366688
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 163 | 250 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300041494|Ga0451837_1318813|Ga0451837_1318813_116_580 |
| Length | 154 |
| Sequence | VVNHHPAGFAQLPGGDSGVGVTNIPLFSALTQKMKWHQARQGLLAENVANAETPGYRGRDLKAYGFAEDLRNTTSMATIATQATNPMHIVKAGSGAGEFGSRQLNNFEVTPEGNGVTLEDEMMKVTTNQMDYQAVTALYTRSIKMIKTALGRSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 2 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 3 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 4 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 5 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 6 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 90 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 91 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 92 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 93 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 94 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 98 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 99 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 100 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 104 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 106 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 107 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 108 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 109 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 110 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 111 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 115 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 116 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 119 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 120 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 121 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 122 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 123 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 124 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 125 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 146 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 149 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 150 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 151 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 152 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 153 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 154 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 155 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 156 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 157 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 158 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 159 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 160 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 161 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 162 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.66 |
| Metatranscriptomes | 0 |
| Isolates | 2.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.98 |
| Nodule | 0 |
| Rhizoplane | 2.73 |
| Rhizosphere | 78.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10049059 | 3300003320 | Bacteria | 4544 |
| 2 | rootH2_10128933 | 3300003320 | Bacteria | 1594 |
| 3 | rootH1_10050065 | 3300003323 | Bacteria | 1242 |
| 4 | rootH1_10201015 | 3300003323 | Bacteria | 1804 |
| 5 | Ga0070658_10044765 | 3300005327 | Bacteria | 3577 |
| 6 | Ga0070658_10139362 | 3300005327 | Bacteria | 2025 |
| 7 | Ga0070676_10272806 | 3300005328 | Bacteria | 1137 |
| 8 | Ga0070660_100016060 | 3300005339 | Bacteria | 5425 |
| 9 | Ga0070660_100022472 | 3300005339 | Bacteria | 4664 |
| 10 | Ga0070661_100029802 | 3300005344 | Bacteria | 3941 |
| 11 | Ga0070661_100428862 | 3300005344 | Bacteria | 1049 |
| 12 | Ga0070668_100200517 | 3300005347 | Bacteria | 1638 |
| 13 | Ga0070668_100201805 | 3300005347 | Bacteria | 1633 |
| 14 | Ga0070674_100064172 | 3300005356 | Bacteria | 2572 |
| 15 | Ga0070673_100205813 | 3300005364 | Bacteria | 1697 |
| 16 | Ga0070659_100091775 | 3300005366 | Bacteria | 2434 |
| 17 | Ga0070659_100214873 | 3300005366 | Bacteria | 1586 |
| 18 | Ga0070667_100798064 | 3300005367 | Bacteria | 876 |
| 19 | Ga0070678_100011107 | 3300005456 | Bacteria | 5539 |
| 20 | Ga0070662_100031683 | 3300005457 | Bacteria | 3713 |
| 21 | Ga0068853_100011187 | 3300005539 | Bacteria | 7280 |
| 22 | Ga0068853_100294216 | 3300005539 | Bacteria | 1499 |
| 23 | Ga0070672_100039099 | 3300005543 | Bacteria | 3631 |
| 24 | Ga0070665_100006088 | 3300005548 | Bacteria | 12331 |
| 25 | Ga0070665_100169118 | 3300005548 | Bacteria | 2187 |
| 26 | Ga0068855_100026013 | 3300005563 | Bacteria | 7000 |
| 27 | Ga0068855_100049289 | 3300005563 | Bacteria | 4967 |
| 28 | Ga0068855_100737251 | 3300005563 | Bacteria | 1052 |
| 29 | Ga0070664_100020092 | 3300005564 | Bacteria | 5499 |
| 30 | Ga0068857_100018309 | 3300005577 | Bacteria | 6144 |
| 31 | Ga0068854_100032340 | 3300005578 | Bacteria | 3639 |
| 32 | Ga0068856_100021957 | 3300005614 | Bacteria | 6205 |
| 33 | Ga0068856_101266216 | 3300005614 | Bacteria | 753 |
| 34 | Ga0068856_102680074 | 3300005614 | Bacteria | 504 |
| 35 | Ga0068852_100303759 | 3300005616 | Bacteria | 1545 |
| 36 | Ga0068851_10013288 | 3300005834 | Bacteria | 3896 |
| 37 | Ga0075365_10460815 | 3300006038 | Bacteria | 898 |
| 38 | Ga0075363_100153786 | 3300006048 | Bacteria | 1299 |
| 39 | Ga0075364_10092822 | 3300006051 | Bacteria | 2004 |
| 40 | Ga0075362_10051902 | 3300006177 | Bacteria | 1836 |
| 41 | Ga0097621_100391266 | 3300006237 | Bacteria | 1243 |
| 42 | Ga0075370_10041166 | 3300006353 | Bacteria | 2608 |
| 43 | Ga0075370_10299060 | 3300006353 | Bacteria | 957 |
| 44 | Ga0068871_100528895 | 3300006358 | Bacteria | 1066 |
| 45 | Ga0068865_100026579 | 3300006881 | Bacteria | 3817 |
| 46 | Ga0105240_10203087 | 3300009093 | Bacteria | 2321 |
| 47 | Ga0105245_10446956 | 3300009098 | Bacteria | 1300 |
| 48 | Ga0105243_10770545 | 3300009148 | Bacteria | 945 |
| 49 | Ga0105241_10488029 | 3300009174 | Bacteria | 1096 |
| 50 | Ga0105241_10759676 | 3300009174 | Unclassified | 890 |
| 51 | Ga0105241_11519847 | 3300009174 | Bacteria | 645 |
| 52 | Ga0105248_10457842 | 3300009177 | Bacteria | 1438 |
| 53 | Ga0105248_12596288 | 3300009177 | Bacteria | 577 |
| 54 | Ga0105237_10000566 | 3300009545 | Bacteria | 51699 |
| 55 | Ga0105237_10490518 | 3300009545 | Bacteria | 1235 |
| 56 | Ga0105238_10314102 | 3300009551 | Bacteria | 1552 |
| 57 | Ga0105238_10363341 | 3300009551 | Bacteria | 1437 |
| 58 | Ga0105030_111709 | 3300009987 | Unclassified | 760 |
| 59 | Ga0105239_10001377 | 3300010375 | Bacteria | 32591 |
| 60 | Ga0105239_10062420 | 3300010375 | Bacteria | 4090 |
| 61 | Ga0105239_10713986 | 3300010375 | Bacteria | 1146 |
| 62 | Ga0105239_10997300 | 3300010375 | Bacteria | 963 |
| 63 | Ga0105246_10186186 | 3300011119 | Bacteria | 1603 |
| 64 | Ga0105246_10794116 | 3300011119 | Bacteria | 839 |
| 65 | Ga0157371_10588929 | 3300013102 | Bacteria | 827 |
| 66 | Ga0157370_11176332 | 3300013104 | Bacteria | 692 |
| 67 | Ga0157374_10052358 | 3300013296 | Bacteria | 3802 |
| 68 | Ga0157374_10538619 | 3300013296 | Bacteria | 1175 |
| 69 | Ga0157374_11716741 | 3300013296 | Bacteria | 653 |
| 70 | Ga0157378_10045564 | 3300013297 | Bacteria | 3897 |
| 71 | Ga0157378_10840175 | 3300013297 | Bacteria | 946 |
| 72 | Ga0157372_10048447 | 3300013307 | Bacteria | 4724 |
| 73 | Ga0157375_10885039 | 3300013308 | Bacteria | 1038 |
| 74 | Ga0163163_11115751 | 3300014325 | Bacteria | 852 |
| 75 | Ga0163163_11725691 | 3300014325 | Unclassified | 687 |
| 76 | Ga0157376_10418055 | 3300014969 | Bacteria | 1300 |
| 77 | Ga0207656_10097882 | 3300025321 | Bacteria | 1341 |
| 78 | Ga0207688_10639188 | 3300025901 | Bacteria | 672 |
| 79 | Ga0207645_10228837 | 3300025907 | Bacteria | 1227 |
| 80 | Ga0207645_10399934 | 3300025907 | Bacteria | 924 |
| 81 | Ga0207705_10024080 | 3300025909 | Bacteria | 4344 |
| 82 | Ga0207654_10382359 | 3300025911 | Bacteria | 975 |
| 83 | Ga0207671_10001629 | 3300025914 | Bacteria | 25557 |
| 84 | Ga0207657_10002651 | 3300025919 | Bacteria | 19319 |
| 85 | Ga0207657_10025076 | 3300025919 | Bacteria | 5507 |
| 86 | Ga0207657_10251065 | 3300025919 | Bacteria | 1410 |
| 87 | Ga0207649_10158523 | 3300025920 | Bacteria | 1566 |
| 88 | Ga0207694_10661641 | 3300025924 | Bacteria | 880 |
| 89 | Ga0207659_10371966 | 3300025926 | Bacteria | 1190 |
| 90 | Ga0207687_10661069 | 3300025927 | Unclassified | 885 |
| 91 | Ga0207706_10034742 | 3300025933 | Bacteria | 4486 |
| 92 | Ga0207686_10585141 | 3300025934 | Bacteria | 876 |
| 93 | Ga0207709_11412424 | 3300025935 | Unclassified | 576 |
| 94 | Ga0207669_10093898 | 3300025937 | Bacteria | 1961 |
| 95 | Ga0207704_10040457 | 3300025938 | Bacteria | 2725 |
| 96 | Ga0207691_10022281 | 3300025940 | Bacteria | 5976 |
| 97 | Ga0207711_10772933 | 3300025941 | Bacteria | 895 |
| 98 | Ga0207679_11113550 | 3300025945 | Bacteria | 724 |
| 99 | Ga0207667_10258692 | 3300025949 | Bacteria | 1780 |
| 100 | Ga0207651_10347243 | 3300025960 | Bacteria | 1248 |
| 101 | Ga0207668_10127893 | 3300025972 | Bacteria | 1935 |
| 102 | Ga0207668_10164436 | 3300025972 | Bacteria | 1733 |
| 103 | Ga0207640_10109152 | 3300025981 | Bacteria | 1957 |
| 104 | Ga0207640_11377275 | 3300025981 | Bacteria | 631 |
| 105 | Ga0207658_10631470 | 3300025986 | Bacteria | 964 |
| 106 | Ga0207677_10155355 | 3300026023 | Bacteria | 1771 |
| 107 | Ga0207639_10032082 | 3300026041 | Bacteria | 3864 |
| 108 | Ga0207639_10525977 | 3300026041 | Bacteria | 1083 |
| 109 | Ga0207678_10020957 | 3300026067 | Bacteria | 5729 |
| 110 | Ga0207678_10315573 | 3300026067 | Bacteria | 1344 |
| 111 | Ga0207678_11083725 | 3300026067 | Bacteria | 709 |
| 112 | Ga0207702_10168822 | 3300026078 | Bacteria | 2004 |
| 113 | Ga0207683_10189995 | 3300026121 | Bacteria | 1864 |
| 114 | Ga0209974_10011310 | 3300027876 | Bacteria | 3001 |
| 115 | Ga0268266_10000090 | 3300028379 | Bacteria | 195839 |
| 116 | Ga0268264_11957194 | 3300028381 | Unclassified | 595 |
| 117 | Ga0265327_10000163 | 3300031251 | Bacteria | 143328 |
| 118 | Ga0265327_10181128 | 3300031251 | Bacteria | 963 |
| 119 | Ga0307408_101222606 | 3300031548 | Bacteria | 702 |
| 120 | Ga0307516_10200112 | 3300031730 | Bacteria | 1718 |
| 121 | Ga0307413_10469758 | 3300031824 | Bacteria | 1003 |
| 122 | Ga0307413_10531454 | 3300031824 | Unclassified | 950 |
| 123 | Ga0307413_10831981 | 3300031824 | Bacteria | 778 |
| 124 | Ga0307406_10353509 | 3300031901 | Bacteria | 1149 |
| 125 | Ga0307407_10163047 | 3300031903 | Bacteria | 1461 |
| 126 | Ga0307412_11350259 | 3300031911 | Unclassified | 643 |
| 127 | Ga0307409_100317306 | 3300031995 | Bacteria | 1457 |
| 128 | Ga0307416_100747832 | 3300032002 | Bacteria | 1070 |
| 129 | Ga0307414_10095070 | 3300032004 | Bacteria | 2226 |
| 130 | Ga0307414_10108937 | 3300032004 | Bacteria | 2103 |
| 131 | Ga0307414_10188845 | 3300032004 | Bacteria | 1665 |
| 132 | Ga0307414_10301101 | 3300032004 | Bacteria | 1356 |
| 133 | Ga0307414_10417027 | 3300032004 | Bacteria | 1170 |
| 134 | Ga0307414_10619819 | 3300032004 | Bacteria | 972 |
| 135 | Ga0307414_10874434 | 3300032004 | Bacteria | 823 |
| 136 | Ga0307414_11201262 | 3300032004 | Bacteria | 702 |
| 137 | Ga0307414_11967942 | 3300032004 | Bacteria | 546 |
| 138 | Ga0307414_12273598 | 3300032004 | Bacteria | 506 |
| 139 | Ga0307411_10124344 | 3300032005 | Bacteria | 1873 |
| 140 | Ga0373948_0021506 | 3300034817 | Bacteria | 1236 |
| 141 | Ga0373939_0055649 | 3300035114 | Bacteria | 1243 |
| 142 | Ga0395900_0196250 | 3300037418 | Bacteria | 2045 |
| 143 | Ga0395898_0201124 | 3300037466 | Bacteria | 1902 |
| 144 | Ga0439465_0166564 | 3300041413 | Unclassified | 792 |
| 145 | Ga0451789_0141237 | 3300041443 | Bacteria | 517 |
| 146 | Ga0451797_1441939 | 3300041453 | Bacteria | 997 |
| 147 | Ga0451807_1691840 | 3300041486 | Bacteria | 929 |
| 148 | Ga0451837_0885869 | 3300041494 | Bacteria | 770 |
| 149 | Ga0451837_1318813 | 3300041494 | Bacteria | 822 |
| 150 | Ga0451845_0374529 | 3300041501 | Bacteria | 670 |
| 151 | Ga0451843_0383646 | 3300041509 | Bacteria | 1260 |
| 152 | Ga0439445_0018888 | 3300042004 | Bacteria | 1715 |
| 153 | Ga0439432_057187 | 3300042006 | Bacteria | 1207 |
| 154 | Ga0466957_0127523 | 3300044842 | Bacteria | 1627 |
| 155 | Ga0495628_0819333 | 3300046516 | Bacteria | 650 |
| 156 | Ga0496102_0491458 | 3300048905 | Bacteria | 1149 |
| 157 | Ga0496106_0856363 | 3300048909 | Bacteria | 719 |
| 158 | Ga0496108_0412867 | 3300048911 | Bacteria | 1179 |
| 159 | Ga0496109_1964324 | 3300048912 | Bacteria | 517 |
| 160 | Ga0496116_0349169 | 3300048919 | Bacteria | 678 |
| 161 | Ga0496117_0365275 | 3300048920 | Bacteria | 740 |
| 162 | Ga0496118_0599839 | 3300048921 | Bacteria | 527 |
| 163 | Ga0496121_0044372 | 3300048924 | Bacteria | 3836 |
| 164 | Ga0496121_0116118 | 3300048924 | Bacteria | 2031 |
| 165 | Ga0496121_0569531 | 3300048924 | Bacteria | 705 |
| 166 | Ga0496124_0347614 | 3300048927 | Bacteria | 1050 |
| 167 | Ga0496125_0005817 | 3300048928 | Bacteria | 13546 |
| 168 | Ga0496126_0098556 | 3300048929 | Bacteria | 2561 |
| 169 | Ga0496126_0167213 | 3300048929 | Bacteria | 1876 |
| 170 | Ga0501031_0027551 | 3300049568 | Bacteria | 3704 |
| 171 | Ga0501031_0554065 | 3300049568 | Bacteria | 740 |
| 172 | Ga0501032_0036746 | 3300049569 | Bacteria | 3342 |
| 173 | Ga0501032_0293989 | 3300049569 | Bacteria | 1051 |
| 174 | Ga0501033_0052152 | 3300049570 | Bacteria | 3031 |
| 175 | Ga0501033_0086686 | 3300049570 | Bacteria | 2292 |
| 176 | Ga0501033_0100695 | 3300049570 | Bacteria | 2108 |
| 177 | Ga0501034_0006601 | 3300049571 | Bacteria | 12446 |
| 178 | Ga0501034_0117229 | 3300049571 | Bacteria | 2650 |
| 179 | Ga0501034_0122525 | 3300049571 | Bacteria | 2586 |
| 180 | Ga0501034_0151131 | 3300049571 | Bacteria | 2297 |
| 181 | Ga0501034_0217978 | 3300049571 | Bacteria | 1861 |
| 182 | Ga0501034_0240617 | 3300049571 | Bacteria | 1756 |
| 183 | Ga0501034_0242920 | 3300049571 | Bacteria | 1746 |
| 184 | Ga0501034_0304294 | 3300049571 | Bacteria | 1530 |
| 185 | Ga0501034_0362038 | 3300049571 | Bacteria | 1377 |
| 186 | Ga0501034_0405139 | 3300049571 | Bacteria | 1286 |
| 187 | Ga0501034_0715350 | 3300049571 | Bacteria | 899 |
| 188 | Ga0501036_0038584 | 3300049572 | Bacteria | 4042 |
| 189 | Ga0501036_0103428 | 3300049572 | Bacteria | 2409 |
| 190 | Ga0501036_0551455 | 3300049572 | Bacteria | 958 |
| 191 | Ga0501037_0033054 | 3300049573 | Bacteria | 3821 |
| 192 | Ga0501037_0061083 | 3300049573 | Bacteria | 2748 |
| 193 | Ga0501037_0085849 | 3300049573 | Bacteria | 2279 |
| 194 | Ga0501038_0020061 | 3300049574 | Bacteria | 6015 |
| 195 | Ga0501039_0022018 | 3300049575 | Bacteria | 4891 |
| 196 | Ga0501042_0469386 | 3300049578 | Bacteria | 913 |
| 197 | Ga0501043_0010491 | 3300049579 | Bacteria | 7255 |
| 198 | Ga0501043_0043832 | 3300049579 | Bacteria | 3517 |
| 199 | Ga0501046_0138525 | 3300049580 | Bacteria | 1842 |
| 200 | Ga0501046_0307426 | 3300049580 | Bacteria | 1157 |
| 201 | Ga0501046_0663678 | 3300049580 | Bacteria | 736 |
| 202 | Ga0501047_0139817 | 3300049581 | Bacteria | 2300 |
| 203 | Ga0501047_0299589 | 3300049581 | Bacteria | 1450 |
| 204 | Ga0501047_0502575 | 3300049581 | Bacteria | 1039 |
| 205 | Ga0501047_0503415 | 3300049581 | Bacteria | 1038 |
| 206 | Ga0501048_0147930 | 3300049582 | Bacteria | 1661 |
| 207 | Ga0501070_0014605 | 3300049586 | Bacteria | 6609 |
| 208 | Ga0501070_0030726 | 3300049586 | Bacteria | 4499 |
| 209 | Ga0501070_0058359 | 3300049586 | Bacteria | 3199 |
| 210 | Ga0501073_0066082 | 3300049589 | Bacteria | 2521 |
| 211 | Ga0501073_0302470 | 3300049589 | Bacteria | 1103 |
| 212 | Ga0501073_0321739 | 3300049589 | Bacteria | 1068 |
| 213 | Ga0501074_0256739 | 3300049590 | Bacteria | 1243 |
| 214 | Ga0501074_0532457 | 3300049590 | Unclassified | 832 |
| 215 | Ga0501074_1197651 | 3300049590 | Bacteria | 533 |
| 216 | Ga0501077_0584917 | 3300049593 | Unclassified | 717 |
| 217 | Ga0501079_0526257 | 3300049741 | Unclassified | 930 |
| 218 | Ga0501080_0065384 | 3300049742 | Bacteria | 3383 |
| 219 | Ga0501080_0179800 | 3300049742 | Bacteria | 1947 |
| 220 | Ga0501080_0190172 | 3300049742 | Bacteria | 1887 |
| 221 | Ga0501083_0157787 | 3300049744 | Bacteria | 1485 |
| 222 | Ga0501275_050400 | 3300049772 | Bacteria | 609 |
| 223 | Ga0501035_0064499 | 3300049822 | Bacteria | 3255 |
| 224 | Ga0501035_0202491 | 3300049822 | Bacteria | 1701 |
| 225 | Ga0501035_0402526 | 3300049822 | Bacteria | 1138 |
| 226 | Ga0501044_0011374 | 3300049823 | Bacteria | 9639 |
| 227 | Ga0501044_0017604 | 3300049823 | Bacteria | 7664 |
| 228 | Ga0501044_0072467 | 3300049823 | Bacteria | 3501 |
| 229 | Ga0501044_0169540 | 3300049823 | Bacteria | 2155 |
| 230 | Ga0501044_0180134 | 3300049823 | Bacteria | 2080 |
| 231 | Ga0501044_0347388 | 3300049823 | Bacteria | 1404 |
| 232 | nmdc:mga03683_6231_c1 | 3300050489 | Bacteria | 4072 |
| 233 | nmdc:mga03n38_565212_c1 | 3300050490 | Bacteria | 645 |
| 234 | nmdc:mga00v17_335256_c1 | 3300050491 | Bacteria | 983 |
| 235 | nmdc:mga00v17_453513_c1 | 3300050491 | Bacteria | 832 |
| 236 | nmdc:mga0k408_254928_c1 | 3300050493 | Bacteria | 1047 |
| 237 | nmdc:mga06z11_693040_c1 | 3300050494 | Bacteria | 620 |
| 238 | nmdc:mga07m45_35191_c1 | 3300050496 | Bacteria | 2785 |
| 239 | nmdc:mga07m45_472913_c1 | 3300050496 | Bacteria | 726 |
| 240 | Ga0500562_016943 | 3300053108 | Bacteria | 1875 |
| 241 | Ga0500593_204089 | 3300053117 | Bacteria | 710 |
| 242 | Ga0500593_205314 | 3300053117 | Bacteria | 707 |
| 243 | Ga0500608_172363 | 3300053122 | Bacteria | 926 |
| 244 | Ga0500568_0335514 | 3300053139 | Bacteria | 548 |
| 245 | Ga0500604_0000213 | 3300053151 | Bacteria | 16675 |
| 246 | Ga0500616_0027956 | 3300053153 | Bacteria | 3111 |
| 247 | Ga0500624_093431 | 3300053157 | Bacteria | 611 |
| 248 | Ga0500634_0142236 | 3300053161 | Bacteria | 1134 |
| 249 | Ga0501082_0809643 | 3300060353 | Bacteria | 819 |
| 250 | Ga0530510_0702176 | 3300061734 | Unclassified | 771 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049572 | Ga0501036_0551455 | Ga0501036_0551455_11_352 | 111 |
| 2 | 3300049581 | Ga0501047_0502575 | Ga0501047_0502575_668_1024 | 118 |
| 3 | 3300041443 | Ga0451789_0141237 | Ga0451789_0141237_130_492 | 120 |
| 4 | 3300049823 | Ga0501044_0347388 | Ga0501044_0347388_30_392 | 120 |
| 5 | 3300026041 | Ga0207639_10525977 | Ga0207639_105259772 | 123 |
| 6 | 3300049570 | Ga0501033_0100695 | Ga0501033_0100695_607_1002 | 125 |
| 7 | 3300049571 | Ga0501034_0117229 | Ga0501034_0117229_1796_2191 | 125 |
| 8 | 3300049572 | Ga0501036_0103428 | Ga0501036_0103428_1232_1627 | 125 |
| 9 | 3300049579 | Ga0501043_0043832 | Ga0501043_0043832_1350_1745 | 125 |
| 10 | 3300049581 | Ga0501047_0139817 | Ga0501047_0139817_1333_1728 | 125 |
| 11 | 3300049586 | Ga0501070_0058359 | Ga0501070_0058359_469_864 | 125 |
| 12 | 3300049590 | Ga0501074_0532457 | Ga0501074_0532457_334_729 | 125 |
| 13 | 3300049742 | Ga0501080_0065384 | Ga0501080_0065384_2537_2932 | 125 |
| 14 | 3300049744 | Ga0501083_0157787 | Ga0501083_0157787_928_1323 | 125 |
| 15 | 3300049822 | Ga0501035_0202491 | Ga0501035_0202491_733_1128 | 125 |
| 16 | 3300049823 | Ga0501044_0017604 | Ga0501044_0017604_6357_6752 | 125 |
| 17 | 3300014325 | Ga0163163_11725691 | Ga0163163_117256911 | 126 |
| 18 | 3300025981 | Ga0207640_11377275 | Ga0207640_113772752 | 126 |
| 19 | iso_pu_bacteria | 2643221629 | 2644167803 | 128 |
| 20 | iso_pu_bacteria | 2643221662 | 2644349262 | 128 |
| 21 | 3300031251 | Ga0265327_10181128 | Ga0265327_101811282 | 129 |
| 22 | 3300046516 | Ga0495628_0819333 | Ga0495628_0819333_130_519 | 129 |
| 23 | 3300005344 | Ga0070661_100428862 | Ga0070661_1004288622 | 130 |
| 24 | 3300005539 | Ga0068853_100294216 | Ga0068853_1002942162 | 130 |
| 25 | 3300005614 | Ga0068856_102680074 | Ga0068856_1026800741 | 130 |
| 26 | 3300025911 | Ga0207654_10382359 | Ga0207654_103823591 | 130 |
| 27 | 3300025920 | Ga0207649_10158523 | Ga0207649_101585232 | 130 |
| 28 | 3300026041 | Ga0207639_10032082 | Ga0207639_100320822 | 130 |
| 29 | 3300048912 | Ga0496109_1964324 | Ga0496109_1964324_73_471 | 130 |
| 30 | 3300049581 | Ga0501047_0503415 | Ga0501047_0503415_369_764 | 130 |
| 31 | 3300053122 | Ga0500608_172363 | Ga0500608_172363_520_915 | 130 |
| 32 | 3300005327 | Ga0070658_10044765 | Ga0070658_100447652 | 131 |
| 33 | 3300005327 | Ga0070658_10139362 | Ga0070658_101393622 | 131 |
| 34 | 3300005328 | Ga0070676_10272806 | Ga0070676_102728062 | 131 |
| 35 | 3300005339 | Ga0070660_100016060 | Ga0070660_1000160606 | 131 |
| 36 | 3300005339 | Ga0070660_100022472 | Ga0070660_1000224727 | 131 |
| 37 | 3300005344 | Ga0070661_100029802 | Ga0070661_1000298023 | 131 |
| 38 | 3300005347 | Ga0070668_100201805 | Ga0070668_1002018053 | 131 |
| 39 | 3300005356 | Ga0070674_100064172 | Ga0070674_1000641723 | 131 |
| 40 | 3300005364 | Ga0070673_100205813 | Ga0070673_1002058132 | 131 |
| 41 | 3300005366 | Ga0070659_100091775 | Ga0070659_1000917755 | 131 |
| 42 | 3300005366 | Ga0070659_100214873 | Ga0070659_1002148731 | 131 |
| 43 | 3300005456 | Ga0070678_100011107 | Ga0070678_1000111074 | 131 |
| 44 | 3300005457 | Ga0070662_100031683 | Ga0070662_1000316836 | 131 |
| 45 | 3300005539 | Ga0068853_100011187 | Ga0068853_1000111876 | 131 |
| 46 | 3300005543 | Ga0070672_100039099 | Ga0070672_1000390995 | 131 |
| 47 | 3300005548 | Ga0070665_100006088 | Ga0070665_1000060888 | 131 |
| 48 | 3300005548 | Ga0070665_100169118 | Ga0070665_1001691185 | 131 |
| 49 | 3300005563 | Ga0068855_100026013 | Ga0068855_1000260136 | 131 |
| 50 | 3300005563 | Ga0068855_100049289 | Ga0068855_1000492895 | 131 |
| 51 | 3300005563 | Ga0068855_100737251 | Ga0068855_1007372512 | 131 |
| 52 | 3300005564 | Ga0070664_100020092 | Ga0070664_1000200924 | 131 |
| 53 | 3300005577 | Ga0068857_100018309 | Ga0068857_1000183094 | 131 |
| 54 | 3300005578 | Ga0068854_100032340 | Ga0068854_1000323404 | 131 |
| 55 | 3300005614 | Ga0068856_100021957 | Ga0068856_1000219574 | 131 |
| 56 | 3300005614 | Ga0068856_101266216 | Ga0068856_1012662161 | 131 |
| 57 | 3300005616 | Ga0068852_100303759 | Ga0068852_1003037593 | 131 |
| 58 | 3300005834 | Ga0068851_10013288 | Ga0068851_100132886 | 131 |
| 59 | 3300006358 | Ga0068871_100528895 | Ga0068871_1005288952 | 131 |
| 60 | 3300006881 | Ga0068865_100026579 | Ga0068865_1000265794 | 131 |
| 61 | 3300009098 | Ga0105245_10446956 | Ga0105245_104469562 | 131 |
| 62 | 3300009148 | Ga0105243_10770545 | Ga0105243_107705452 | 131 |
| 63 | 3300009174 | Ga0105241_10488029 | Ga0105241_104880292 | 131 |
| 64 | 3300009174 | Ga0105241_10759676 | Ga0105241_107596761 | 131 |
| 65 | 3300009174 | Ga0105241_11519847 | Ga0105241_115198471 | 131 |
| 66 | 3300009177 | Ga0105248_12596288 | Ga0105248_125962881 | 131 |
| 67 | 3300009545 | Ga0105237_10000566 | Ga0105237_1000056639 | 131 |
| 68 | 3300009545 | Ga0105237_10490518 | Ga0105237_104905182 | 131 |
| 69 | 3300009551 | Ga0105238_10314102 | Ga0105238_103141023 | 131 |
| 70 | 3300009551 | Ga0105238_10363341 | Ga0105238_103633412 | 131 |
| 71 | 3300010375 | Ga0105239_10001377 | Ga0105239_100013774 | 131 |
| 72 | 3300010375 | Ga0105239_10062420 | Ga0105239_100624202 | 131 |
| 73 | 3300010375 | Ga0105239_10713986 | Ga0105239_107139863 | 131 |
| 74 | 3300010375 | Ga0105239_10997300 | Ga0105239_109973001 | 131 |
| 75 | 3300011119 | Ga0105246_10186186 | Ga0105246_101861862 | 131 |
| 76 | 3300013102 | Ga0157371_10588929 | Ga0157371_105889292 | 131 |
| 77 | 3300013104 | Ga0157370_11176332 | Ga0157370_111763321 | 131 |
| 78 | 3300013296 | Ga0157374_10052358 | Ga0157374_100523582 | 131 |
| 79 | 3300013296 | Ga0157374_10538619 | Ga0157374_105386192 | 131 |
| 80 | 3300013296 | Ga0157374_11716741 | Ga0157374_117167411 | 131 |
| 81 | 3300013297 | Ga0157378_10840175 | Ga0157378_108401752 | 131 |
| 82 | 3300013307 | Ga0157372_10048447 | Ga0157372_100484474 | 131 |
| 83 | 3300013308 | Ga0157375_10885039 | Ga0157375_108850392 | 131 |
| 84 | 3300014325 | Ga0163163_11115751 | Ga0163163_111157512 | 131 |
| 85 | 3300014969 | Ga0157376_10418055 | Ga0157376_104180552 | 131 |
| 86 | 3300025321 | Ga0207656_10097882 | Ga0207656_100978822 | 131 |
| 87 | 3300025901 | Ga0207688_10639188 | Ga0207688_106391881 | 131 |
| 88 | 3300025907 | Ga0207645_10228837 | Ga0207645_102288372 | 131 |
| 89 | 3300025907 | Ga0207645_10399934 | Ga0207645_103999341 | 131 |
| 90 | 3300025909 | Ga0207705_10024080 | Ga0207705_100240806 | 131 |
| 91 | 3300025914 | Ga0207671_10001629 | Ga0207671_1000162915 | 131 |
| 92 | 3300025919 | Ga0207657_10002651 | Ga0207657_100026513 | 131 |
| 93 | 3300025919 | Ga0207657_10025076 | Ga0207657_100250767 | 131 |
| 94 | 3300025919 | Ga0207657_10251065 | Ga0207657_102510651 | 131 |
| 95 | 3300025924 | Ga0207694_10661641 | Ga0207694_106616412 | 131 |
| 96 | 3300025926 | Ga0207659_10371966 | Ga0207659_103719662 | 131 |
| 97 | 3300025933 | Ga0207706_10034742 | Ga0207706_100347422 | 131 |
| 98 | 3300025934 | Ga0207686_10585141 | Ga0207686_105851412 | 131 |
| 99 | 3300025935 | Ga0207709_11412424 | Ga0207709_114124241 | 131 |
| 100 | 3300025937 | Ga0207669_10093898 | Ga0207669_100938983 | 131 |
| 101 | 3300025938 | Ga0207704_10040457 | Ga0207704_100404576 | 131 |
| 102 | 3300025940 | Ga0207691_10022281 | Ga0207691_100222814 | 131 |
| 103 | 3300025945 | Ga0207679_11113550 | Ga0207679_111135502 | 131 |
| 104 | 3300025949 | Ga0207667_10258692 | Ga0207667_102586922 | 131 |
| 105 | 3300025960 | Ga0207651_10347243 | Ga0207651_103472432 | 131 |
| 106 | 3300025972 | Ga0207668_10164436 | Ga0207668_101644364 | 131 |
| 107 | 3300025981 | Ga0207640_10109152 | Ga0207640_101091524 | 131 |
| 108 | 3300026023 | Ga0207677_10155355 | Ga0207677_101553551 | 131 |
| 109 | 3300026067 | Ga0207678_10020957 | Ga0207678_100209572 | 131 |
| 110 | 3300026067 | Ga0207678_10315573 | Ga0207678_103155732 | 131 |
| 111 | 3300026067 | Ga0207678_11083725 | Ga0207678_110837251 | 131 |
| 112 | 3300026078 | Ga0207702_10168822 | Ga0207702_101688224 | 131 |
| 113 | 3300026121 | Ga0207683_10189995 | Ga0207683_101899954 | 131 |
| 114 | 3300028379 | Ga0268266_10000090 | Ga0268266_1000009012 | 131 |
| 115 | 3300034817 | Ga0373948_0021506 | Ga0373948_0021506_626_1027 | 131 |
| 116 | 3300035114 | Ga0373939_0055649 | Ga0373939_0055649_727_1128 | 131 |
| 117 | 3300044842 | Ga0466957_0127523 | Ga0466957_0127523_472_873 | 131 |
| 118 | 3300048911 | Ga0496108_0412867 | Ga0496108_0412867_632_1033 | 131 |
| 119 | 3300049569 | Ga0501032_0293989 | Ga0501032_0293989_279_692 | 131 |
| 120 | 3300049570 | Ga0501033_0086686 | Ga0501033_0086686_1269_1664 | 131 |
| 121 | 3300049571 | Ga0501034_0240617 | Ga0501034_0240617_1001_1414 | 131 |
| 122 | 3300049571 | Ga0501034_0242920 | Ga0501034_0242920_719_1114 | 131 |
| 123 | 3300049573 | Ga0501037_0085849 | Ga0501037_0085849_1438_1851 | 131 |
| 124 | 3300049580 | Ga0501046_0138525 | Ga0501046_0138525_1380_1775 | 131 |
| 125 | 3300049586 | Ga0501070_0030726 | Ga0501070_0030726_3429_3824 | 131 |
| 126 | 3300049590 | Ga0501074_0256739 | Ga0501074_0256739_823_1218 | 131 |
| 127 | 3300049590 | Ga0501074_1197651 | Ga0501074_1197651_33_428 | 131 |
| 128 | 3300049823 | Ga0501044_0011374 | Ga0501044_0011374_3507_3902 | 131 |
| 129 | iso_pu_bacteria | 2643221580 | 2643911376 | 131 |
| 130 | iso_pu_bacteria | 2643221591 | 2643963085 | 131 |
| 131 | iso_pu_bacteria | 2643221674 | 2644411227 | 131 |
| 132 | iso_pu_bacteria | 2932401849 | 2932402868 | 131 |
| 133 | 3300003320 | rootH2_10128933 | rootH2_101289333 | 132 |
| 134 | 3300003323 | rootH1_10201015 | rootH1_102010153 | 132 |
| 135 | 3300006038 | Ga0075365_10460815 | Ga0075365_104608152 | 132 |
| 136 | 3300006048 | Ga0075363_100153786 | Ga0075363_1001537862 | 132 |
| 137 | 3300006051 | Ga0075364_10092822 | Ga0075364_100928223 | 132 |
| 138 | 3300006177 | Ga0075362_10051902 | Ga0075362_100519021 | 132 |
| 139 | 3300006237 | Ga0097621_100391266 | Ga0097621_1003912662 | 132 |
| 140 | 3300006353 | Ga0075370_10041166 | Ga0075370_100411665 | 132 |
| 141 | 3300006353 | Ga0075370_10299060 | Ga0075370_102990602 | 132 |
| 142 | 3300009177 | Ga0105248_10457842 | Ga0105248_104578422 | 132 |
| 143 | 3300011119 | Ga0105246_10794116 | Ga0105246_107941162 | 132 |
| 144 | 3300013297 | Ga0157378_10045564 | Ga0157378_100455641 | 132 |
| 145 | 3300025927 | Ga0207687_10661069 | Ga0207687_106610691 | 132 |
| 146 | 3300025941 | Ga0207711_10772933 | Ga0207711_107729332 | 132 |
| 147 | 3300027876 | Ga0209974_10011310 | Ga0209974_100113105 | 132 |
| 148 | 3300028381 | Ga0268264_11957194 | Ga0268264_119571941 | 132 |
| 149 | 3300031251 | Ga0265327_10000163 | Ga0265327_1000016365 | 132 |
| 150 | 3300031824 | Ga0307413_10469758 | Ga0307413_104697582 | 132 |
| 151 | 3300031824 | Ga0307413_10531454 | Ga0307413_105314542 | 132 |
| 152 | 3300031911 | Ga0307412_11350259 | Ga0307412_113502591 | 132 |
| 153 | 3300031995 | Ga0307409_100317306 | Ga0307409_1003173063 | 132 |
| 154 | 3300032002 | Ga0307416_100747832 | Ga0307416_1007478322 | 132 |
| 155 | 3300032004 | Ga0307414_11201262 | Ga0307414_112012622 | 132 |
| 156 | 3300032004 | Ga0307414_11967942 | Ga0307414_119679421 | 132 |
| 157 | 3300032005 | Ga0307411_10124344 | Ga0307411_101243445 | 132 |
| 158 | 3300041413 | Ga0439465_0166564 | Ga0439465_0166564_84_485 | 132 |
| 159 | 3300048905 | Ga0496102_0491458 | Ga0496102_0491458_540_938 | 132 |
| 160 | 3300048909 | Ga0496106_0856363 | Ga0496106_0856363_303_701 | 132 |
| 161 | 3300048920 | Ga0496117_0365275 | Ga0496117_0365275_103_501 | 132 |
| 162 | 3300048924 | Ga0496121_0116118 | Ga0496121_0116118_94_495 | 132 |
| 163 | 3300048929 | Ga0496126_0098556 | Ga0496126_0098556_418_816 | 132 |
| 164 | 3300049571 | Ga0501034_0122525 | Ga0501034_0122525_1499_1900 | 132 |
| 165 | 3300049571 | Ga0501034_0304294 | Ga0501034_0304294_827_1225 | 132 |
| 166 | 3300049571 | Ga0501034_0405139 | Ga0501034_0405139_791_1195 | 132 |
| 167 | 3300049571 | Ga0501034_0715350 | Ga0501034_0715350_296_697 | 132 |
| 168 | 3300050489 | nmdc:mga03683_6231_c1 | nmdc:mga03683_6231_c1_319_720 | 132 |
| 169 | 3300050490 | nmdc:mga03n38_565212_c1 | nmdc:mga03n38_565212_c1_104_505 | 132 |
| 170 | 3300050491 | nmdc:mga00v17_335256_c1 | nmdc:mga00v17_335256_c1_392_793 | 132 |
| 171 | 3300050493 | nmdc:mga0k408_254928_c1 | nmdc:mga0k408_254928_c1_418_816 | 132 |
| 172 | 3300050494 | nmdc:mga06z11_693040_c1 | nmdc:mga06z11_693040_c1_31_429 | 132 |
| 173 | 3300050496 | nmdc:mga07m45_35191_c1 | nmdc:mga07m45_35191_c1_1201_1602 | 132 |
| 174 | 3300050496 | nmdc:mga07m45_472913_c1 | nmdc:mga07m45_472913_c1_79_477 | 132 |
| 175 | 3300053108 | Ga0500562_016943 | Ga0500562_016943_43_441 | 132 |
| 176 | 3300053117 | Ga0500593_205314 | Ga0500593_205314_253_651 | 132 |
| 177 | 3300053139 | Ga0500568_0335514 | Ga0500568_0335514_125_523 | 132 |
| 178 | 3300053153 | Ga0500616_0027956 | Ga0500616_0027956_1256_1654 | 132 |
| 179 | 3300003323 | rootH1_10050065 | rootH1_100500652 | 133 |
| 180 | 3300009093 | Ga0105240_10203087 | Ga0105240_102030872 | 133 |
| 181 | 3300037418 | Ga0395900_0196250 | Ga0395900_0196250_1614_2024 | 133 |
| 182 | 3300037466 | Ga0395898_0201124 | Ga0395898_0201124_1432_1842 | 133 |
| 183 | 3300049568 | Ga0501031_0027551 | Ga0501031_0027551_1749_2156 | 133 |
| 184 | 3300049569 | Ga0501032_0036746 | Ga0501032_0036746_1285_1692 | 133 |
| 185 | 3300049570 | Ga0501033_0052152 | Ga0501033_0052152_1462_1869 | 133 |
| 186 | 3300049571 | Ga0501034_0151131 | Ga0501034_0151131_1571_1978 | 133 |
| 187 | 3300049572 | Ga0501036_0038584 | Ga0501036_0038584_1651_2058 | 133 |
| 188 | 3300049573 | Ga0501037_0033054 | Ga0501037_0033054_1985_2392 | 133 |
| 189 | 3300049574 | Ga0501038_0020061 | Ga0501038_0020061_3866_4273 | 133 |
| 190 | 3300049575 | Ga0501039_0022018 | Ga0501039_0022018_2740_3147 | 133 |
| 191 | 3300049578 | Ga0501042_0469386 | Ga0501042_0469386_361_768 | 133 |
| 192 | 3300049579 | Ga0501043_0010491 | Ga0501043_0010491_1823_2230 | 133 |
| 193 | 3300049580 | Ga0501046_0307426 | Ga0501046_0307426_313_720 | 133 |
| 194 | 3300049581 | Ga0501047_0299589 | Ga0501047_0299589_246_653 | 133 |
| 195 | 3300049582 | Ga0501048_0147930 | Ga0501048_0147930_1112_1519 | 133 |
| 196 | 3300049586 | Ga0501070_0014605 | Ga0501070_0014605_1186_1593 | 133 |
| 197 | 3300049742 | Ga0501080_0179800 | Ga0501080_0179800_1129_1536 | 133 |
| 198 | 3300049822 | Ga0501035_0064499 | Ga0501035_0064499_397_804 | 133 |
| 199 | 3300049823 | Ga0501044_0072467 | Ga0501044_0072467_1524_1931 | 133 |
| 200 | 3300049568 | Ga0501031_0554065 | Ga0501031_0554065_165_572 | 134 |
| 201 | 3300049571 | Ga0501034_0217978 | Ga0501034_0217978_494_898 | 134 |
| 202 | 3300049573 | Ga0501037_0061083 | Ga0501037_0061083_1876_2283 | 134 |
| 203 | 3300049589 | Ga0501073_0066082 | Ga0501073_0066082_1971_2381 | 134 |
| 204 | 3300049589 | Ga0501073_0302470 | Ga0501073_0302470_86_496 | 134 |
| 205 | 3300049593 | Ga0501077_0584917 | Ga0501077_0584917_270_680 | 134 |
| 206 | 3300049741 | Ga0501079_0526257 | Ga0501079_0526257_208_618 | 134 |
| 207 | 3300049742 | Ga0501080_0190172 | Ga0501080_0190172_192_602 | 134 |
| 208 | 3300060353 | Ga0501082_0809643 | Ga0501082_0809643_64_474 | 134 |
| 209 | 3300061734 | Ga0530510_0702176 | Ga0530510_0702176_322_732 | 134 |
| 210 | 3300003320 | rootH2_10049059 | rootH2_100490596 | 135 |
| 211 | 3300005347 | Ga0070668_100200517 | Ga0070668_1002005172 | 135 |
| 212 | 3300005367 | Ga0070667_100798064 | Ga0070667_1007980642 | 135 |
| 213 | 3300009987 | Ga0105030_111709 | Ga0105030_1117092 | 135 |
| 214 | 3300025972 | Ga0207668_10127893 | Ga0207668_101278934 | 135 |
| 215 | 3300025986 | Ga0207658_10631470 | Ga0207658_106314702 | 135 |
| 216 | 3300031548 | Ga0307408_101222606 | Ga0307408_1012226062 | 135 |
| 217 | 3300031730 | Ga0307516_10200112 | Ga0307516_102001122 | 135 |
| 218 | 3300031824 | Ga0307413_10831981 | Ga0307413_108319812 | 135 |
| 219 | 3300031901 | Ga0307406_10353509 | Ga0307406_103535092 | 135 |
| 220 | 3300031903 | Ga0307407_10163047 | Ga0307407_101630471 | 135 |
| 221 | 3300032004 | Ga0307414_10095070 | Ga0307414_100950703 | 135 |
| 222 | 3300032004 | Ga0307414_10108937 | Ga0307414_101089372 | 135 |
| 223 | 3300032004 | Ga0307414_10188845 | Ga0307414_101888453 | 135 |
| 224 | 3300032004 | Ga0307414_10301101 | Ga0307414_103011012 | 135 |
| 225 | 3300032004 | Ga0307414_10417027 | Ga0307414_104170271 | 135 |
| 226 | 3300032004 | Ga0307414_10619819 | Ga0307414_106198192 | 135 |
| 227 | 3300032004 | Ga0307414_10874434 | Ga0307414_108744342 | 135 |
| 228 | 3300032004 | Ga0307414_12273598 | Ga0307414_122735981 | 135 |
| 229 | 3300041453 | Ga0451797_1441939 | Ga0451797_1441939_338_745 | 135 |
| 230 | 3300041486 | Ga0451807_1691840 | Ga0451807_1691840_179_586 | 135 |
| 231 | 3300041494 | Ga0451837_0885869 | Ga0451837_0885869_19_426 | 135 |
| 232 | 3300041494 | Ga0451837_1318813 | Ga0451837_1318813_116_580 | 135 |
| 233 | 3300041501 | Ga0451845_0374529 | Ga0451845_0374529_191_598 | 135 |
| 234 | 3300041509 | Ga0451843_0383646 | Ga0451843_0383646_249_713 | 135 |
| 235 | 3300042004 | Ga0439445_0018888 | Ga0439445_0018888_1180_1641 | 135 |
| 236 | 3300042006 | Ga0439432_057187 | Ga0439432_057187_206_667 | 135 |
| 237 | 3300048919 | Ga0496116_0349169 | Ga0496116_0349169_236_643 | 135 |
| 238 | 3300048921 | Ga0496118_0599839 | Ga0496118_0599839_101_508 | 135 |
| 239 | 3300048924 | Ga0496121_0044372 | Ga0496121_0044372_2500_2910 | 135 |
| 240 | 3300048924 | Ga0496121_0569531 | Ga0496121_0569531_212_619 | 135 |
| 241 | 3300048927 | Ga0496124_0347614 | Ga0496124_0347614_232_639 | 135 |
| 242 | 3300048928 | Ga0496125_0005817 | Ga0496125_0005817_10517_10924 | 135 |
| 243 | 3300048929 | Ga0496126_0167213 | Ga0496126_0167213_1090_1497 | 135 |
| 244 | 3300049571 | Ga0501034_0006601 | Ga0501034_0006601_7188_7595 | 135 |
| 245 | 3300049571 | Ga0501034_0362038 | Ga0501034_0362038_163_570 | 135 |
| 246 | 3300049580 | Ga0501046_0663678 | Ga0501046_0663678_243_656 | 135 |
| 247 | 3300049589 | Ga0501073_0321739 | Ga0501073_0321739_366_776 | 135 |
| 248 | 3300049772 | Ga0501275_050400 | Ga0501275_050400_47_454 | 135 |
| 249 | 3300049822 | Ga0501035_0402526 | Ga0501035_0402526_539_952 | 135 |
| 250 | 3300049823 | Ga0501044_0169540 | Ga0501044_0169540_1532_1945 | 135 |
| 251 | 3300049823 | Ga0501044_0180134 | Ga0501044_0180134_665_1072 | 135 |
| 252 | 3300050491 | nmdc:mga00v17_453513_c1 | nmdc:mga00v17_453513_c1_367_777 | 135 |
| 253 | 3300053117 | Ga0500593_204089 | Ga0500593_204089_61_468 | 135 |
| 254 | 3300053151 | Ga0500604_0000213 | Ga0500604_0000213_12206_12613 | 135 |
| 255 | 3300053157 | Ga0500624_093431 | Ga0500624_093431_179_586 | 135 |
| 256 | 3300053161 | Ga0500634_0142236 | Ga0500634_0142236_421_828 | 135 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cg0-assembly1.cif.gz_o | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.7981 | 8 | 135 |
| 7cg0-assembly1.cif.gz_k | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.7953 | 8 | 131 |
| 7nvg-assembly1.cif.gz_T2 | salmonella flagellar basal body refined in c1 map | 0.7923 | 10 | 131 |
| 7cg0-assembly1.cif.gz_m | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.7921 | 8 | 131 |
| 7cgo-assembly1.cif.gz_l | cryo-em structure of the flagellar motor-hook complex from salmonella | 0.7913 | 8 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I3Z9_646_839_1.10.132.10 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; | 0.6454 | 1 | 121 | 1.10.132.10 |
| af_Q4E4M8_17_118_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.5775 | 5 | 134 | 1.10.287.370 |
| af_Q4E4M8_17_118_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.5671 | 5 | 134 | 1.10.287.370 |
| af_Q54JS0_6_115_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.562 | 9 | 134 | 1.10.287.370 |
| af_Q9VMH8_1_121_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.5366 | 3 | 134 | 1.10.287.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R8A9I0-F1-model_v4 | Flagellar basal body rod protein FlgB | 0.838 | 5 | 135 |
|
| AF-A0A1I3GQX5-F1-model_v4 | Flagellar basal body rod protein FlgB | 0.8344 | 4 | 131 |
GO:0030694
GO:0071978 |
| AF-A0A3C0TYY4-F1-model_v4 | Flagellar basal body rod protein FlgB | 0.8293 | 1 | 135 |
GO:0030694
GO:0071973 |
| AF-A0A2G6EKB6-F1-model_v4 | Flagellar basal body rod protein FlgB | 0.8284 | 6 | 135 |
GO:0030694
GO:0071978 |
| AF-A0A3C0TYY4-F1-model_v4 | Flagellar basal body rod protein FlgB | 0.8236 | 1 | 135 |
GO:0030694
GO:0071973 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar