F366688

General Info

Members Datasets Scaffolds Average Seq Length
256 163 250 133

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_1318813|Ga0451837_1318813_116_580
Length 154
Sequence VVNHHPAGFAQLPGGDSGVGVTNIPLFSALTQKMKWHQARQGLLAENVANAETPGYRGRDLKAYGFAEDLRNTTSMATIATQATNPMHIVKAGSGAGEFGSRQLNNFEVTPEGNGVTLEDEMMKVTTNQMDYQAVTALYTRSIKMIKTALGRSS

Samples

Sample ID Description Type Environment
1 2643221580 Devosia sp. Root635 Isolate Unclassified
2 2643221591 Devosia sp. Root685 Isolate Unclassified
3 2643221629 Devosia sp. Root105 Isolate Unclassified
4 2643221662 Devosia sp. Root413D1 Isolate Unclassified
5 2643221674 Devosia sp. Root436 Isolate Unclassified
6 2932401849 Devosia sp. 2618 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
155 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
161 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 0
Rhizoplane 2.73
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10049059 3300003320 Bacteria 4544
2 rootH2_10128933 3300003320 Bacteria 1594
3 rootH1_10050065 3300003323 Bacteria 1242
4 rootH1_10201015 3300003323 Bacteria 1804
5 Ga0070658_10044765 3300005327 Bacteria 3577
6 Ga0070658_10139362 3300005327 Bacteria 2025
7 Ga0070676_10272806 3300005328 Bacteria 1137
8 Ga0070660_100016060 3300005339 Bacteria 5425
9 Ga0070660_100022472 3300005339 Bacteria 4664
10 Ga0070661_100029802 3300005344 Bacteria 3941
11 Ga0070661_100428862 3300005344 Bacteria 1049
12 Ga0070668_100200517 3300005347 Bacteria 1638
13 Ga0070668_100201805 3300005347 Bacteria 1633
14 Ga0070674_100064172 3300005356 Bacteria 2572
15 Ga0070673_100205813 3300005364 Bacteria 1697
16 Ga0070659_100091775 3300005366 Bacteria 2434
17 Ga0070659_100214873 3300005366 Bacteria 1586
18 Ga0070667_100798064 3300005367 Bacteria 876
19 Ga0070678_100011107 3300005456 Bacteria 5539
20 Ga0070662_100031683 3300005457 Bacteria 3713
21 Ga0068853_100011187 3300005539 Bacteria 7280
22 Ga0068853_100294216 3300005539 Bacteria 1499
23 Ga0070672_100039099 3300005543 Bacteria 3631
24 Ga0070665_100006088 3300005548 Bacteria 12331
25 Ga0070665_100169118 3300005548 Bacteria 2187
26 Ga0068855_100026013 3300005563 Bacteria 7000
27 Ga0068855_100049289 3300005563 Bacteria 4967
28 Ga0068855_100737251 3300005563 Bacteria 1052
29 Ga0070664_100020092 3300005564 Bacteria 5499
30 Ga0068857_100018309 3300005577 Bacteria 6144
31 Ga0068854_100032340 3300005578 Bacteria 3639
32 Ga0068856_100021957 3300005614 Bacteria 6205
33 Ga0068856_101266216 3300005614 Bacteria 753
34 Ga0068856_102680074 3300005614 Bacteria 504
35 Ga0068852_100303759 3300005616 Bacteria 1545
36 Ga0068851_10013288 3300005834 Bacteria 3896
37 Ga0075365_10460815 3300006038 Bacteria 898
38 Ga0075363_100153786 3300006048 Bacteria 1299
39 Ga0075364_10092822 3300006051 Bacteria 2004
40 Ga0075362_10051902 3300006177 Bacteria 1836
41 Ga0097621_100391266 3300006237 Bacteria 1243
42 Ga0075370_10041166 3300006353 Bacteria 2608
43 Ga0075370_10299060 3300006353 Bacteria 957
44 Ga0068871_100528895 3300006358 Bacteria 1066
45 Ga0068865_100026579 3300006881 Bacteria 3817
46 Ga0105240_10203087 3300009093 Bacteria 2321
47 Ga0105245_10446956 3300009098 Bacteria 1300
48 Ga0105243_10770545 3300009148 Bacteria 945
49 Ga0105241_10488029 3300009174 Bacteria 1096
50 Ga0105241_10759676 3300009174 Unclassified 890
51 Ga0105241_11519847 3300009174 Bacteria 645
52 Ga0105248_10457842 3300009177 Bacteria 1438
53 Ga0105248_12596288 3300009177 Bacteria 577
54 Ga0105237_10000566 3300009545 Bacteria 51699
55 Ga0105237_10490518 3300009545 Bacteria 1235
56 Ga0105238_10314102 3300009551 Bacteria 1552
57 Ga0105238_10363341 3300009551 Bacteria 1437
58 Ga0105030_111709 3300009987 Unclassified 760
59 Ga0105239_10001377 3300010375 Bacteria 32591
60 Ga0105239_10062420 3300010375 Bacteria 4090
61 Ga0105239_10713986 3300010375 Bacteria 1146
62 Ga0105239_10997300 3300010375 Bacteria 963
63 Ga0105246_10186186 3300011119 Bacteria 1603
64 Ga0105246_10794116 3300011119 Bacteria 839
65 Ga0157371_10588929 3300013102 Bacteria 827
66 Ga0157370_11176332 3300013104 Bacteria 692
67 Ga0157374_10052358 3300013296 Bacteria 3802
68 Ga0157374_10538619 3300013296 Bacteria 1175
69 Ga0157374_11716741 3300013296 Bacteria 653
70 Ga0157378_10045564 3300013297 Bacteria 3897
71 Ga0157378_10840175 3300013297 Bacteria 946
72 Ga0157372_10048447 3300013307 Bacteria 4724
73 Ga0157375_10885039 3300013308 Bacteria 1038
74 Ga0163163_11115751 3300014325 Bacteria 852
75 Ga0163163_11725691 3300014325 Unclassified 687
76 Ga0157376_10418055 3300014969 Bacteria 1300
77 Ga0207656_10097882 3300025321 Bacteria 1341
78 Ga0207688_10639188 3300025901 Bacteria 672
79 Ga0207645_10228837 3300025907 Bacteria 1227
80 Ga0207645_10399934 3300025907 Bacteria 924
81 Ga0207705_10024080 3300025909 Bacteria 4344
82 Ga0207654_10382359 3300025911 Bacteria 975
83 Ga0207671_10001629 3300025914 Bacteria 25557
84 Ga0207657_10002651 3300025919 Bacteria 19319
85 Ga0207657_10025076 3300025919 Bacteria 5507
86 Ga0207657_10251065 3300025919 Bacteria 1410
87 Ga0207649_10158523 3300025920 Bacteria 1566
88 Ga0207694_10661641 3300025924 Bacteria 880
89 Ga0207659_10371966 3300025926 Bacteria 1190
90 Ga0207687_10661069 3300025927 Unclassified 885
91 Ga0207706_10034742 3300025933 Bacteria 4486
92 Ga0207686_10585141 3300025934 Bacteria 876
93 Ga0207709_11412424 3300025935 Unclassified 576
94 Ga0207669_10093898 3300025937 Bacteria 1961
95 Ga0207704_10040457 3300025938 Bacteria 2725
96 Ga0207691_10022281 3300025940 Bacteria 5976
97 Ga0207711_10772933 3300025941 Bacteria 895
98 Ga0207679_11113550 3300025945 Bacteria 724
99 Ga0207667_10258692 3300025949 Bacteria 1780
100 Ga0207651_10347243 3300025960 Bacteria 1248
101 Ga0207668_10127893 3300025972 Bacteria 1935
102 Ga0207668_10164436 3300025972 Bacteria 1733
103 Ga0207640_10109152 3300025981 Bacteria 1957
104 Ga0207640_11377275 3300025981 Bacteria 631
105 Ga0207658_10631470 3300025986 Bacteria 964
106 Ga0207677_10155355 3300026023 Bacteria 1771
107 Ga0207639_10032082 3300026041 Bacteria 3864
108 Ga0207639_10525977 3300026041 Bacteria 1083
109 Ga0207678_10020957 3300026067 Bacteria 5729
110 Ga0207678_10315573 3300026067 Bacteria 1344
111 Ga0207678_11083725 3300026067 Bacteria 709
112 Ga0207702_10168822 3300026078 Bacteria 2004
113 Ga0207683_10189995 3300026121 Bacteria 1864
114 Ga0209974_10011310 3300027876 Bacteria 3001
115 Ga0268266_10000090 3300028379 Bacteria 195839
116 Ga0268264_11957194 3300028381 Unclassified 595
117 Ga0265327_10000163 3300031251 Bacteria 143328
118 Ga0265327_10181128 3300031251 Bacteria 963
119 Ga0307408_101222606 3300031548 Bacteria 702
120 Ga0307516_10200112 3300031730 Bacteria 1718
121 Ga0307413_10469758 3300031824 Bacteria 1003
122 Ga0307413_10531454 3300031824 Unclassified 950
123 Ga0307413_10831981 3300031824 Bacteria 778
124 Ga0307406_10353509 3300031901 Bacteria 1149
125 Ga0307407_10163047 3300031903 Bacteria 1461
126 Ga0307412_11350259 3300031911 Unclassified 643
127 Ga0307409_100317306 3300031995 Bacteria 1457
128 Ga0307416_100747832 3300032002 Bacteria 1070
129 Ga0307414_10095070 3300032004 Bacteria 2226
130 Ga0307414_10108937 3300032004 Bacteria 2103
131 Ga0307414_10188845 3300032004 Bacteria 1665
132 Ga0307414_10301101 3300032004 Bacteria 1356
133 Ga0307414_10417027 3300032004 Bacteria 1170
134 Ga0307414_10619819 3300032004 Bacteria 972
135 Ga0307414_10874434 3300032004 Bacteria 823
136 Ga0307414_11201262 3300032004 Bacteria 702
137 Ga0307414_11967942 3300032004 Bacteria 546
138 Ga0307414_12273598 3300032004 Bacteria 506
139 Ga0307411_10124344 3300032005 Bacteria 1873
140 Ga0373948_0021506 3300034817 Bacteria 1236
141 Ga0373939_0055649 3300035114 Bacteria 1243
142 Ga0395900_0196250 3300037418 Bacteria 2045
143 Ga0395898_0201124 3300037466 Bacteria 1902
144 Ga0439465_0166564 3300041413 Unclassified 792
145 Ga0451789_0141237 3300041443 Bacteria 517
146 Ga0451797_1441939 3300041453 Bacteria 997
147 Ga0451807_1691840 3300041486 Bacteria 929
148 Ga0451837_0885869 3300041494 Bacteria 770
149 Ga0451837_1318813 3300041494 Bacteria 822
150 Ga0451845_0374529 3300041501 Bacteria 670
151 Ga0451843_0383646 3300041509 Bacteria 1260
152 Ga0439445_0018888 3300042004 Bacteria 1715
153 Ga0439432_057187 3300042006 Bacteria 1207
154 Ga0466957_0127523 3300044842 Bacteria 1627
155 Ga0495628_0819333 3300046516 Bacteria 650
156 Ga0496102_0491458 3300048905 Bacteria 1149
157 Ga0496106_0856363 3300048909 Bacteria 719
158 Ga0496108_0412867 3300048911 Bacteria 1179
159 Ga0496109_1964324 3300048912 Bacteria 517
160 Ga0496116_0349169 3300048919 Bacteria 678
161 Ga0496117_0365275 3300048920 Bacteria 740
162 Ga0496118_0599839 3300048921 Bacteria 527
163 Ga0496121_0044372 3300048924 Bacteria 3836
164 Ga0496121_0116118 3300048924 Bacteria 2031
165 Ga0496121_0569531 3300048924 Bacteria 705
166 Ga0496124_0347614 3300048927 Bacteria 1050
167 Ga0496125_0005817 3300048928 Bacteria 13546
168 Ga0496126_0098556 3300048929 Bacteria 2561
169 Ga0496126_0167213 3300048929 Bacteria 1876
170 Ga0501031_0027551 3300049568 Bacteria 3704
171 Ga0501031_0554065 3300049568 Bacteria 740
172 Ga0501032_0036746 3300049569 Bacteria 3342
173 Ga0501032_0293989 3300049569 Bacteria 1051
174 Ga0501033_0052152 3300049570 Bacteria 3031
175 Ga0501033_0086686 3300049570 Bacteria 2292
176 Ga0501033_0100695 3300049570 Bacteria 2108
177 Ga0501034_0006601 3300049571 Bacteria 12446
178 Ga0501034_0117229 3300049571 Bacteria 2650
179 Ga0501034_0122525 3300049571 Bacteria 2586
180 Ga0501034_0151131 3300049571 Bacteria 2297
181 Ga0501034_0217978 3300049571 Bacteria 1861
182 Ga0501034_0240617 3300049571 Bacteria 1756
183 Ga0501034_0242920 3300049571 Bacteria 1746
184 Ga0501034_0304294 3300049571 Bacteria 1530
185 Ga0501034_0362038 3300049571 Bacteria 1377
186 Ga0501034_0405139 3300049571 Bacteria 1286
187 Ga0501034_0715350 3300049571 Bacteria 899
188 Ga0501036_0038584 3300049572 Bacteria 4042
189 Ga0501036_0103428 3300049572 Bacteria 2409
190 Ga0501036_0551455 3300049572 Bacteria 958
191 Ga0501037_0033054 3300049573 Bacteria 3821
192 Ga0501037_0061083 3300049573 Bacteria 2748
193 Ga0501037_0085849 3300049573 Bacteria 2279
194 Ga0501038_0020061 3300049574 Bacteria 6015
195 Ga0501039_0022018 3300049575 Bacteria 4891
196 Ga0501042_0469386 3300049578 Bacteria 913
197 Ga0501043_0010491 3300049579 Bacteria 7255
198 Ga0501043_0043832 3300049579 Bacteria 3517
199 Ga0501046_0138525 3300049580 Bacteria 1842
200 Ga0501046_0307426 3300049580 Bacteria 1157
201 Ga0501046_0663678 3300049580 Bacteria 736
202 Ga0501047_0139817 3300049581 Bacteria 2300
203 Ga0501047_0299589 3300049581 Bacteria 1450
204 Ga0501047_0502575 3300049581 Bacteria 1039
205 Ga0501047_0503415 3300049581 Bacteria 1038
206 Ga0501048_0147930 3300049582 Bacteria 1661
207 Ga0501070_0014605 3300049586 Bacteria 6609
208 Ga0501070_0030726 3300049586 Bacteria 4499
209 Ga0501070_0058359 3300049586 Bacteria 3199
210 Ga0501073_0066082 3300049589 Bacteria 2521
211 Ga0501073_0302470 3300049589 Bacteria 1103
212 Ga0501073_0321739 3300049589 Bacteria 1068
213 Ga0501074_0256739 3300049590 Bacteria 1243
214 Ga0501074_0532457 3300049590 Unclassified 832
215 Ga0501074_1197651 3300049590 Bacteria 533
216 Ga0501077_0584917 3300049593 Unclassified 717
217 Ga0501079_0526257 3300049741 Unclassified 930
218 Ga0501080_0065384 3300049742 Bacteria 3383
219 Ga0501080_0179800 3300049742 Bacteria 1947
220 Ga0501080_0190172 3300049742 Bacteria 1887
221 Ga0501083_0157787 3300049744 Bacteria 1485
222 Ga0501275_050400 3300049772 Bacteria 609
223 Ga0501035_0064499 3300049822 Bacteria 3255
224 Ga0501035_0202491 3300049822 Bacteria 1701
225 Ga0501035_0402526 3300049822 Bacteria 1138
226 Ga0501044_0011374 3300049823 Bacteria 9639
227 Ga0501044_0017604 3300049823 Bacteria 7664
228 Ga0501044_0072467 3300049823 Bacteria 3501
229 Ga0501044_0169540 3300049823 Bacteria 2155
230 Ga0501044_0180134 3300049823 Bacteria 2080
231 Ga0501044_0347388 3300049823 Bacteria 1404
232 nmdc:mga03683_6231_c1 3300050489 Bacteria 4072
233 nmdc:mga03n38_565212_c1 3300050490 Bacteria 645
234 nmdc:mga00v17_335256_c1 3300050491 Bacteria 983
235 nmdc:mga00v17_453513_c1 3300050491 Bacteria 832
236 nmdc:mga0k408_254928_c1 3300050493 Bacteria 1047
237 nmdc:mga06z11_693040_c1 3300050494 Bacteria 620
238 nmdc:mga07m45_35191_c1 3300050496 Bacteria 2785
239 nmdc:mga07m45_472913_c1 3300050496 Bacteria 726
240 Ga0500562_016943 3300053108 Bacteria 1875
241 Ga0500593_204089 3300053117 Bacteria 710
242 Ga0500593_205314 3300053117 Bacteria 707
243 Ga0500608_172363 3300053122 Bacteria 926
244 Ga0500568_0335514 3300053139 Bacteria 548
245 Ga0500604_0000213 3300053151 Bacteria 16675
246 Ga0500616_0027956 3300053153 Bacteria 3111
247 Ga0500624_093431 3300053157 Bacteria 611
248 Ga0500634_0142236 3300053161 Bacteria 1134
249 Ga0501082_0809643 3300060353 Bacteria 819
250 Ga0530510_0702176 3300061734 Unclassified 771

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0551455 Ga0501036_0551455_11_352 111
2 3300049581 Ga0501047_0502575 Ga0501047_0502575_668_1024 118
3 3300041443 Ga0451789_0141237 Ga0451789_0141237_130_492 120
4 3300049823 Ga0501044_0347388 Ga0501044_0347388_30_392 120
5 3300026041 Ga0207639_10525977 Ga0207639_105259772 123
6 3300049570 Ga0501033_0100695 Ga0501033_0100695_607_1002 125
7 3300049571 Ga0501034_0117229 Ga0501034_0117229_1796_2191 125
8 3300049572 Ga0501036_0103428 Ga0501036_0103428_1232_1627 125
9 3300049579 Ga0501043_0043832 Ga0501043_0043832_1350_1745 125
10 3300049581 Ga0501047_0139817 Ga0501047_0139817_1333_1728 125
11 3300049586 Ga0501070_0058359 Ga0501070_0058359_469_864 125
12 3300049590 Ga0501074_0532457 Ga0501074_0532457_334_729 125
13 3300049742 Ga0501080_0065384 Ga0501080_0065384_2537_2932 125
14 3300049744 Ga0501083_0157787 Ga0501083_0157787_928_1323 125
15 3300049822 Ga0501035_0202491 Ga0501035_0202491_733_1128 125
16 3300049823 Ga0501044_0017604 Ga0501044_0017604_6357_6752 125
17 3300014325 Ga0163163_11725691 Ga0163163_117256911 126
18 3300025981 Ga0207640_11377275 Ga0207640_113772752 126
19 iso_pu_bacteria 2643221629 2644167803 128
20 iso_pu_bacteria 2643221662 2644349262 128
21 3300031251 Ga0265327_10181128 Ga0265327_101811282 129
22 3300046516 Ga0495628_0819333 Ga0495628_0819333_130_519 129
23 3300005344 Ga0070661_100428862 Ga0070661_1004288622 130
24 3300005539 Ga0068853_100294216 Ga0068853_1002942162 130
25 3300005614 Ga0068856_102680074 Ga0068856_1026800741 130
26 3300025911 Ga0207654_10382359 Ga0207654_103823591 130
27 3300025920 Ga0207649_10158523 Ga0207649_101585232 130
28 3300026041 Ga0207639_10032082 Ga0207639_100320822 130
29 3300048912 Ga0496109_1964324 Ga0496109_1964324_73_471 130
30 3300049581 Ga0501047_0503415 Ga0501047_0503415_369_764 130
31 3300053122 Ga0500608_172363 Ga0500608_172363_520_915 130
32 3300005327 Ga0070658_10044765 Ga0070658_100447652 131
33 3300005327 Ga0070658_10139362 Ga0070658_101393622 131
34 3300005328 Ga0070676_10272806 Ga0070676_102728062 131
35 3300005339 Ga0070660_100016060 Ga0070660_1000160606 131
36 3300005339 Ga0070660_100022472 Ga0070660_1000224727 131
37 3300005344 Ga0070661_100029802 Ga0070661_1000298023 131
38 3300005347 Ga0070668_100201805 Ga0070668_1002018053 131
39 3300005356 Ga0070674_100064172 Ga0070674_1000641723 131
40 3300005364 Ga0070673_100205813 Ga0070673_1002058132 131
41 3300005366 Ga0070659_100091775 Ga0070659_1000917755 131
42 3300005366 Ga0070659_100214873 Ga0070659_1002148731 131
43 3300005456 Ga0070678_100011107 Ga0070678_1000111074 131
44 3300005457 Ga0070662_100031683 Ga0070662_1000316836 131
45 3300005539 Ga0068853_100011187 Ga0068853_1000111876 131
46 3300005543 Ga0070672_100039099 Ga0070672_1000390995 131
47 3300005548 Ga0070665_100006088 Ga0070665_1000060888 131
48 3300005548 Ga0070665_100169118 Ga0070665_1001691185 131
49 3300005563 Ga0068855_100026013 Ga0068855_1000260136 131
50 3300005563 Ga0068855_100049289 Ga0068855_1000492895 131
51 3300005563 Ga0068855_100737251 Ga0068855_1007372512 131
52 3300005564 Ga0070664_100020092 Ga0070664_1000200924 131
53 3300005577 Ga0068857_100018309 Ga0068857_1000183094 131
54 3300005578 Ga0068854_100032340 Ga0068854_1000323404 131
55 3300005614 Ga0068856_100021957 Ga0068856_1000219574 131
56 3300005614 Ga0068856_101266216 Ga0068856_1012662161 131
57 3300005616 Ga0068852_100303759 Ga0068852_1003037593 131
58 3300005834 Ga0068851_10013288 Ga0068851_100132886 131
59 3300006358 Ga0068871_100528895 Ga0068871_1005288952 131
60 3300006881 Ga0068865_100026579 Ga0068865_1000265794 131
61 3300009098 Ga0105245_10446956 Ga0105245_104469562 131
62 3300009148 Ga0105243_10770545 Ga0105243_107705452 131
63 3300009174 Ga0105241_10488029 Ga0105241_104880292 131
64 3300009174 Ga0105241_10759676 Ga0105241_107596761 131
65 3300009174 Ga0105241_11519847 Ga0105241_115198471 131
66 3300009177 Ga0105248_12596288 Ga0105248_125962881 131
67 3300009545 Ga0105237_10000566 Ga0105237_1000056639 131
68 3300009545 Ga0105237_10490518 Ga0105237_104905182 131
69 3300009551 Ga0105238_10314102 Ga0105238_103141023 131
70 3300009551 Ga0105238_10363341 Ga0105238_103633412 131
71 3300010375 Ga0105239_10001377 Ga0105239_100013774 131
72 3300010375 Ga0105239_10062420 Ga0105239_100624202 131
73 3300010375 Ga0105239_10713986 Ga0105239_107139863 131
74 3300010375 Ga0105239_10997300 Ga0105239_109973001 131
75 3300011119 Ga0105246_10186186 Ga0105246_101861862 131
76 3300013102 Ga0157371_10588929 Ga0157371_105889292 131
77 3300013104 Ga0157370_11176332 Ga0157370_111763321 131
78 3300013296 Ga0157374_10052358 Ga0157374_100523582 131
79 3300013296 Ga0157374_10538619 Ga0157374_105386192 131
80 3300013296 Ga0157374_11716741 Ga0157374_117167411 131
81 3300013297 Ga0157378_10840175 Ga0157378_108401752 131
82 3300013307 Ga0157372_10048447 Ga0157372_100484474 131
83 3300013308 Ga0157375_10885039 Ga0157375_108850392 131
84 3300014325 Ga0163163_11115751 Ga0163163_111157512 131
85 3300014969 Ga0157376_10418055 Ga0157376_104180552 131
86 3300025321 Ga0207656_10097882 Ga0207656_100978822 131
87 3300025901 Ga0207688_10639188 Ga0207688_106391881 131
88 3300025907 Ga0207645_10228837 Ga0207645_102288372 131
89 3300025907 Ga0207645_10399934 Ga0207645_103999341 131
90 3300025909 Ga0207705_10024080 Ga0207705_100240806 131
91 3300025914 Ga0207671_10001629 Ga0207671_1000162915 131
92 3300025919 Ga0207657_10002651 Ga0207657_100026513 131
93 3300025919 Ga0207657_10025076 Ga0207657_100250767 131
94 3300025919 Ga0207657_10251065 Ga0207657_102510651 131
95 3300025924 Ga0207694_10661641 Ga0207694_106616412 131
96 3300025926 Ga0207659_10371966 Ga0207659_103719662 131
97 3300025933 Ga0207706_10034742 Ga0207706_100347422 131
98 3300025934 Ga0207686_10585141 Ga0207686_105851412 131
99 3300025935 Ga0207709_11412424 Ga0207709_114124241 131
100 3300025937 Ga0207669_10093898 Ga0207669_100938983 131
101 3300025938 Ga0207704_10040457 Ga0207704_100404576 131
102 3300025940 Ga0207691_10022281 Ga0207691_100222814 131
103 3300025945 Ga0207679_11113550 Ga0207679_111135502 131
104 3300025949 Ga0207667_10258692 Ga0207667_102586922 131
105 3300025960 Ga0207651_10347243 Ga0207651_103472432 131
106 3300025972 Ga0207668_10164436 Ga0207668_101644364 131
107 3300025981 Ga0207640_10109152 Ga0207640_101091524 131
108 3300026023 Ga0207677_10155355 Ga0207677_101553551 131
109 3300026067 Ga0207678_10020957 Ga0207678_100209572 131
110 3300026067 Ga0207678_10315573 Ga0207678_103155732 131
111 3300026067 Ga0207678_11083725 Ga0207678_110837251 131
112 3300026078 Ga0207702_10168822 Ga0207702_101688224 131
113 3300026121 Ga0207683_10189995 Ga0207683_101899954 131
114 3300028379 Ga0268266_10000090 Ga0268266_1000009012 131
115 3300034817 Ga0373948_0021506 Ga0373948_0021506_626_1027 131
116 3300035114 Ga0373939_0055649 Ga0373939_0055649_727_1128 131
117 3300044842 Ga0466957_0127523 Ga0466957_0127523_472_873 131
118 3300048911 Ga0496108_0412867 Ga0496108_0412867_632_1033 131
119 3300049569 Ga0501032_0293989 Ga0501032_0293989_279_692 131
120 3300049570 Ga0501033_0086686 Ga0501033_0086686_1269_1664 131
121 3300049571 Ga0501034_0240617 Ga0501034_0240617_1001_1414 131
122 3300049571 Ga0501034_0242920 Ga0501034_0242920_719_1114 131
123 3300049573 Ga0501037_0085849 Ga0501037_0085849_1438_1851 131
124 3300049580 Ga0501046_0138525 Ga0501046_0138525_1380_1775 131
125 3300049586 Ga0501070_0030726 Ga0501070_0030726_3429_3824 131
126 3300049590 Ga0501074_0256739 Ga0501074_0256739_823_1218 131
127 3300049590 Ga0501074_1197651 Ga0501074_1197651_33_428 131
128 3300049823 Ga0501044_0011374 Ga0501044_0011374_3507_3902 131
129 iso_pu_bacteria 2643221580 2643911376 131
130 iso_pu_bacteria 2643221591 2643963085 131
131 iso_pu_bacteria 2643221674 2644411227 131
132 iso_pu_bacteria 2932401849 2932402868 131
133 3300003320 rootH2_10128933 rootH2_101289333 132
134 3300003323 rootH1_10201015 rootH1_102010153 132
135 3300006038 Ga0075365_10460815 Ga0075365_104608152 132
136 3300006048 Ga0075363_100153786 Ga0075363_1001537862 132
137 3300006051 Ga0075364_10092822 Ga0075364_100928223 132
138 3300006177 Ga0075362_10051902 Ga0075362_100519021 132
139 3300006237 Ga0097621_100391266 Ga0097621_1003912662 132
140 3300006353 Ga0075370_10041166 Ga0075370_100411665 132
141 3300006353 Ga0075370_10299060 Ga0075370_102990602 132
142 3300009177 Ga0105248_10457842 Ga0105248_104578422 132
143 3300011119 Ga0105246_10794116 Ga0105246_107941162 132
144 3300013297 Ga0157378_10045564 Ga0157378_100455641 132
145 3300025927 Ga0207687_10661069 Ga0207687_106610691 132
146 3300025941 Ga0207711_10772933 Ga0207711_107729332 132
147 3300027876 Ga0209974_10011310 Ga0209974_100113105 132
148 3300028381 Ga0268264_11957194 Ga0268264_119571941 132
149 3300031251 Ga0265327_10000163 Ga0265327_1000016365 132
150 3300031824 Ga0307413_10469758 Ga0307413_104697582 132
151 3300031824 Ga0307413_10531454 Ga0307413_105314542 132
152 3300031911 Ga0307412_11350259 Ga0307412_113502591 132
153 3300031995 Ga0307409_100317306 Ga0307409_1003173063 132
154 3300032002 Ga0307416_100747832 Ga0307416_1007478322 132
155 3300032004 Ga0307414_11201262 Ga0307414_112012622 132
156 3300032004 Ga0307414_11967942 Ga0307414_119679421 132
157 3300032005 Ga0307411_10124344 Ga0307411_101243445 132
158 3300041413 Ga0439465_0166564 Ga0439465_0166564_84_485 132
159 3300048905 Ga0496102_0491458 Ga0496102_0491458_540_938 132
160 3300048909 Ga0496106_0856363 Ga0496106_0856363_303_701 132
161 3300048920 Ga0496117_0365275 Ga0496117_0365275_103_501 132
162 3300048924 Ga0496121_0116118 Ga0496121_0116118_94_495 132
163 3300048929 Ga0496126_0098556 Ga0496126_0098556_418_816 132
164 3300049571 Ga0501034_0122525 Ga0501034_0122525_1499_1900 132
165 3300049571 Ga0501034_0304294 Ga0501034_0304294_827_1225 132
166 3300049571 Ga0501034_0405139 Ga0501034_0405139_791_1195 132
167 3300049571 Ga0501034_0715350 Ga0501034_0715350_296_697 132
168 3300050489 nmdc:mga03683_6231_c1 nmdc:mga03683_6231_c1_319_720 132
169 3300050490 nmdc:mga03n38_565212_c1 nmdc:mga03n38_565212_c1_104_505 132
170 3300050491 nmdc:mga00v17_335256_c1 nmdc:mga00v17_335256_c1_392_793 132
171 3300050493 nmdc:mga0k408_254928_c1 nmdc:mga0k408_254928_c1_418_816 132
172 3300050494 nmdc:mga06z11_693040_c1 nmdc:mga06z11_693040_c1_31_429 132
173 3300050496 nmdc:mga07m45_35191_c1 nmdc:mga07m45_35191_c1_1201_1602 132
174 3300050496 nmdc:mga07m45_472913_c1 nmdc:mga07m45_472913_c1_79_477 132
175 3300053108 Ga0500562_016943 Ga0500562_016943_43_441 132
176 3300053117 Ga0500593_205314 Ga0500593_205314_253_651 132
177 3300053139 Ga0500568_0335514 Ga0500568_0335514_125_523 132
178 3300053153 Ga0500616_0027956 Ga0500616_0027956_1256_1654 132
179 3300003323 rootH1_10050065 rootH1_100500652 133
180 3300009093 Ga0105240_10203087 Ga0105240_102030872 133
181 3300037418 Ga0395900_0196250 Ga0395900_0196250_1614_2024 133
182 3300037466 Ga0395898_0201124 Ga0395898_0201124_1432_1842 133
183 3300049568 Ga0501031_0027551 Ga0501031_0027551_1749_2156 133
184 3300049569 Ga0501032_0036746 Ga0501032_0036746_1285_1692 133
185 3300049570 Ga0501033_0052152 Ga0501033_0052152_1462_1869 133
186 3300049571 Ga0501034_0151131 Ga0501034_0151131_1571_1978 133
187 3300049572 Ga0501036_0038584 Ga0501036_0038584_1651_2058 133
188 3300049573 Ga0501037_0033054 Ga0501037_0033054_1985_2392 133
189 3300049574 Ga0501038_0020061 Ga0501038_0020061_3866_4273 133
190 3300049575 Ga0501039_0022018 Ga0501039_0022018_2740_3147 133
191 3300049578 Ga0501042_0469386 Ga0501042_0469386_361_768 133
192 3300049579 Ga0501043_0010491 Ga0501043_0010491_1823_2230 133
193 3300049580 Ga0501046_0307426 Ga0501046_0307426_313_720 133
194 3300049581 Ga0501047_0299589 Ga0501047_0299589_246_653 133
195 3300049582 Ga0501048_0147930 Ga0501048_0147930_1112_1519 133
196 3300049586 Ga0501070_0014605 Ga0501070_0014605_1186_1593 133
197 3300049742 Ga0501080_0179800 Ga0501080_0179800_1129_1536 133
198 3300049822 Ga0501035_0064499 Ga0501035_0064499_397_804 133
199 3300049823 Ga0501044_0072467 Ga0501044_0072467_1524_1931 133
200 3300049568 Ga0501031_0554065 Ga0501031_0554065_165_572 134
201 3300049571 Ga0501034_0217978 Ga0501034_0217978_494_898 134
202 3300049573 Ga0501037_0061083 Ga0501037_0061083_1876_2283 134
203 3300049589 Ga0501073_0066082 Ga0501073_0066082_1971_2381 134
204 3300049589 Ga0501073_0302470 Ga0501073_0302470_86_496 134
205 3300049593 Ga0501077_0584917 Ga0501077_0584917_270_680 134
206 3300049741 Ga0501079_0526257 Ga0501079_0526257_208_618 134
207 3300049742 Ga0501080_0190172 Ga0501080_0190172_192_602 134
208 3300060353 Ga0501082_0809643 Ga0501082_0809643_64_474 134
209 3300061734 Ga0530510_0702176 Ga0530510_0702176_322_732 134
210 3300003320 rootH2_10049059 rootH2_100490596 135
211 3300005347 Ga0070668_100200517 Ga0070668_1002005172 135
212 3300005367 Ga0070667_100798064 Ga0070667_1007980642 135
213 3300009987 Ga0105030_111709 Ga0105030_1117092 135
214 3300025972 Ga0207668_10127893 Ga0207668_101278934 135
215 3300025986 Ga0207658_10631470 Ga0207658_106314702 135
216 3300031548 Ga0307408_101222606 Ga0307408_1012226062 135
217 3300031730 Ga0307516_10200112 Ga0307516_102001122 135
218 3300031824 Ga0307413_10831981 Ga0307413_108319812 135
219 3300031901 Ga0307406_10353509 Ga0307406_103535092 135
220 3300031903 Ga0307407_10163047 Ga0307407_101630471 135
221 3300032004 Ga0307414_10095070 Ga0307414_100950703 135
222 3300032004 Ga0307414_10108937 Ga0307414_101089372 135
223 3300032004 Ga0307414_10188845 Ga0307414_101888453 135
224 3300032004 Ga0307414_10301101 Ga0307414_103011012 135
225 3300032004 Ga0307414_10417027 Ga0307414_104170271 135
226 3300032004 Ga0307414_10619819 Ga0307414_106198192 135
227 3300032004 Ga0307414_10874434 Ga0307414_108744342 135
228 3300032004 Ga0307414_12273598 Ga0307414_122735981 135
229 3300041453 Ga0451797_1441939 Ga0451797_1441939_338_745 135
230 3300041486 Ga0451807_1691840 Ga0451807_1691840_179_586 135
231 3300041494 Ga0451837_0885869 Ga0451837_0885869_19_426 135
232 3300041494 Ga0451837_1318813 Ga0451837_1318813_116_580 135
233 3300041501 Ga0451845_0374529 Ga0451845_0374529_191_598 135
234 3300041509 Ga0451843_0383646 Ga0451843_0383646_249_713 135
235 3300042004 Ga0439445_0018888 Ga0439445_0018888_1180_1641 135
236 3300042006 Ga0439432_057187 Ga0439432_057187_206_667 135
237 3300048919 Ga0496116_0349169 Ga0496116_0349169_236_643 135
238 3300048921 Ga0496118_0599839 Ga0496118_0599839_101_508 135
239 3300048924 Ga0496121_0044372 Ga0496121_0044372_2500_2910 135
240 3300048924 Ga0496121_0569531 Ga0496121_0569531_212_619 135
241 3300048927 Ga0496124_0347614 Ga0496124_0347614_232_639 135
242 3300048928 Ga0496125_0005817 Ga0496125_0005817_10517_10924 135
243 3300048929 Ga0496126_0167213 Ga0496126_0167213_1090_1497 135
244 3300049571 Ga0501034_0006601 Ga0501034_0006601_7188_7595 135
245 3300049571 Ga0501034_0362038 Ga0501034_0362038_163_570 135
246 3300049580 Ga0501046_0663678 Ga0501046_0663678_243_656 135
247 3300049589 Ga0501073_0321739 Ga0501073_0321739_366_776 135
248 3300049772 Ga0501275_050400 Ga0501275_050400_47_454 135
249 3300049822 Ga0501035_0402526 Ga0501035_0402526_539_952 135
250 3300049823 Ga0501044_0169540 Ga0501044_0169540_1532_1945 135
251 3300049823 Ga0501044_0180134 Ga0501044_0180134_665_1072 135
252 3300050491 nmdc:mga00v17_453513_c1 nmdc:mga00v17_453513_c1_367_777 135
253 3300053117 Ga0500593_204089 Ga0500593_204089_61_468 135
254 3300053151 Ga0500604_0000213 Ga0500604_0000213_12206_12613 135
255 3300053157 Ga0500624_093431 Ga0500624_093431_179_586 135
256 3300053161 Ga0500634_0142236 Ga0500634_0142236_421_828 135

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_o cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.7981 8 135
7cg0-assembly1.cif.gz_k cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.7953 8 131
7nvg-assembly1.cif.gz_T2 salmonella flagellar basal body refined in c1 map 0.7923 10 131
7cg0-assembly1.cif.gz_m cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.7921 8 131
7cgo-assembly1.cif.gz_l cryo-em structure of the flagellar motor-hook complex from salmonella 0.7913 8 131
ID Description Score Start End Superfamily
af_Q8I3Z9_646_839_1.10.132.10 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; 0.6454 1 121 1.10.132.10
af_Q4E4M8_17_118_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5775 5 134 1.10.287.370
af_Q4E4M8_17_118_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5671 5 134 1.10.287.370
af_Q54JS0_6_115_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.562 9 134 1.10.287.370
af_Q9VMH8_1_121_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5366 3 134 1.10.287.370
ID Description Score Start End GO Terms
AF-A0A2R8A9I0-F1-model_v4 Flagellar basal body rod protein FlgB 0.838 5 135
AF-A0A1I3GQX5-F1-model_v4 Flagellar basal body rod protein FlgB 0.8344 4 131 GO:0030694
GO:0071978
AF-A0A3C0TYY4-F1-model_v4 Flagellar basal body rod protein FlgB 0.8293 1 135 GO:0030694
GO:0071973
AF-A0A2G6EKB6-F1-model_v4 Flagellar basal body rod protein FlgB 0.8284 6 135 GO:0030694
GO:0071978
AF-A0A3C0TYY4-F1-model_v4 Flagellar basal body rod protein FlgB 0.8236 1 135 GO:0030694
GO:0071973

Feature Viewer

pLDDT pTM Quality
66.32 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map