F366384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 155 | 250 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100007507|Ga0068871_1000075073 |
| Length | 308 |
| Sequence | VGLFGRAQVFLTNIHDRMPVILNSEPYDLCSTGNEACEHGGILRSARMWVMFKVASWNLNSVRSRLTHVTAWLKAREPDVLLLQELKGTKFPSEVFKSLGYESVAVTQKAYNGVAILSRHPMETIAKALVGDDSDSHARFLEVIIKRIRIVNIYLPNGNPVGSDKFAYKLAWMDRLNQQMIRWKQNDVPTLIGGDFNVIPEDIDCHKPSSWEHDALFQPEPRARYLAMLDMGYTDAFRSLHVGEIGHFTFWDYFRQAFQNNRGIRIDHFLLSPTLANRLEGCEIDKGPRAQEKPSDHTPIIVTLSDLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 3 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 4 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 5 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 6 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 61 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 99 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 100 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 101 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 102 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 103 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 109 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 110 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 111 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 112 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 129 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 130 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 131 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 134 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 145 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 150 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 152 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 153 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 154 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.27 |
| Metatranscriptomes | 0.39 |
| Isolates | 2.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.95 |
| Nodule | 0.39 |
| Rhizoplane | 3.52 |
| Rhizosphere | 87.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10279507 | 3300003323 | Unclassified | 1299 |
| 2 | Ga0065707_10436364 | 3300005295 | Unclassified | 815 |
| 3 | Ga0070658_10009223 | 3300005327 | Bacteria | 7934 |
| 4 | Ga0070658_10732224 | 3300005327 | Unclassified | 859 |
| 5 | Ga0070670_100067499 | 3300005331 | Unclassified | 3068 |
| 6 | Ga0070670_100229609 | 3300005331 | Bacteria | 1615 |
| 7 | Ga0068869_100008959 | 3300005334 | Bacteria | 6479 |
| 8 | Ga0070660_100446131 | 3300005339 | Bacteria | 1073 |
| 9 | Ga0070661_100017337 | 3300005344 | Bacteria | 5109 |
| 10 | Ga0070659_100055612 | 3300005366 | Bacteria | 3120 |
| 11 | Ga0070714_100000045 | 3300005435 | Bacteria | 113749 |
| 12 | Ga0070714_100029855 | 3300005435 | Bacteria | 4535 |
| 13 | Ga0070713_100001859 | 3300005436 | Bacteria | 13615 |
| 14 | Ga0070713_100008082 | 3300005436 | Bacteria | 7439 |
| 15 | Ga0070713_100020619 | 3300005436 | Bacteria | 5057 |
| 16 | Ga0070713_100086319 | 3300005436 | Unclassified | 2690 |
| 17 | Ga0070710_10035820 | 3300005437 | Bacteria | 2708 |
| 18 | Ga0070710_10044859 | 3300005437 | Bacteria | 2454 |
| 19 | Ga0070710_10060290 | 3300005437 | Unclassified | 2158 |
| 20 | Ga0070708_100037709 | 3300005445 | Bacteria | 4219 |
| 21 | Ga0070663_100146523 | 3300005455 | Bacteria | 1807 |
| 22 | Ga0070678_100103426 | 3300005456 | Unclassified | 2213 |
| 23 | Ga0070681_10619539 | 3300005458 | Unclassified | 997 |
| 24 | Ga0070706_100075306 | 3300005467 | Unclassified | 3123 |
| 25 | Ga0070699_100346948 | 3300005518 | Bacteria | 1337 |
| 26 | Ga0070679_100060088 | 3300005530 | Bacteria | 3788 |
| 27 | Ga0070684_100422627 | 3300005535 | Bacteria | 1230 |
| 28 | Ga0068853_100036677 | 3300005539 | Bacteria | 4170 |
| 29 | Ga0068853_100222026 | 3300005539 | Bacteria | 1726 |
| 30 | Ga0070665_100151308 | 3300005548 | Unclassified | 2323 |
| 31 | Ga0068855_100025507 | 3300005563 | Bacteria | 7071 |
| 32 | Ga0068855_100109588 | 3300005563 | Bacteria | 3170 |
| 33 | Ga0068855_100346599 | 3300005563 | Bacteria | 1637 |
| 34 | Ga0068855_100643009 | 3300005563 | Bacteria | 1140 |
| 35 | Ga0070664_100020249 | 3300005564 | Bacteria | 5478 |
| 36 | Ga0068854_100054806 | 3300005578 | Bacteria | 2869 |
| 37 | Ga0068856_100009987 | 3300005614 | Bacteria | 9217 |
| 38 | Ga0068856_100032995 | 3300005614 | Bacteria | 5071 |
| 39 | Ga0068856_100046762 | 3300005614 | Bacteria | 4262 |
| 40 | Ga0068856_100122607 | 3300005614 | Bacteria | 2601 |
| 41 | Ga0068856_100206549 | 3300005614 | Bacteria | 1978 |
| 42 | Ga0068852_100299022 | 3300005616 | Bacteria | 1557 |
| 43 | Ga0068862_100202797 | 3300005844 | Bacteria | 1789 |
| 44 | Ga0081455_10011682 | 3300005937 | Bacteria | 8808 |
| 45 | Ga0081540_1010968 | 3300005983 | Bacteria | 6087 |
| 46 | Ga0070717_10011295 | 3300006028 | Bacteria | 6777 |
| 47 | Ga0070717_10016992 | 3300006028 | Bacteria | 5652 |
| 48 | Ga0075363_100024656 | 3300006048 | Bacteria | 3060 |
| 49 | Ga0070712_100003711 | 3300006175 | Bacteria | 9406 |
| 50 | Ga0070712_100009068 | 3300006175 | Bacteria | 6264 |
| 51 | Ga0070712_100009655 | 3300006175 | Bacteria | 6081 |
| 52 | Ga0097621_100006834 | 3300006237 | Bacteria | 8107 |
| 53 | Ga0068871_100007507 | 3300006358 | Bacteria | 7795 |
| 54 | Ga0068871_100716908 | 3300006358 | Unclassified | 917 |
| 55 | Ga0105240_10001119 | 3300009093 | Bacteria | 47175 |
| 56 | Ga0105240_10006086 | 3300009093 | Bacteria | 17808 |
| 57 | Ga0105240_10055245 | 3300009093 | Unclassified | 4972 |
| 58 | Ga0111539_10478347 | 3300009094 | Unclassified | 1450 |
| 59 | Ga0105245_10556048 | 3300009098 | Unclassified | 1170 |
| 60 | Ga0105241_10000377 | 3300009174 | Bacteria | 33964 |
| 61 | Ga0105241_10005768 | 3300009174 | Bacteria | 9140 |
| 62 | Ga0105241_10048120 | 3300009174 | Unclassified | 3244 |
| 63 | Ga0105241_10152984 | 3300009174 | Unclassified | 1889 |
| 64 | Ga0105241_10276147 | 3300009174 | Bacteria | 1433 |
| 65 | Ga0105237_10001489 | 3300009545 | Bacteria | 30846 |
| 66 | Ga0105237_10097833 | 3300009545 | Bacteria | 2925 |
| 67 | Ga0105238_10001123 | 3300009551 | Bacteria | 27011 |
| 68 | Ga0105238_10033162 | 3300009551 | Bacteria | 5255 |
| 69 | Ga0105238_10039748 | 3300009551 | Bacteria | 4770 |
| 70 | Ga0105238_10065567 | 3300009551 | Bacteria | 3633 |
| 71 | Ga0105238_10153058 | 3300009551 | Bacteria | 2281 |
| 72 | Ga0105249_10244871 | 3300009553 | Bacteria | 1774 |
| 73 | Ga0105239_10000731 | 3300010375 | Bacteria | 46607 |
| 74 | Ga0157373_10065121 | 3300013100 | Bacteria | 2579 |
| 75 | Ga0157373_10217321 | 3300013100 | Bacteria | 1348 |
| 76 | Ga0157373_10301158 | 3300013100 | Unclassified | 1138 |
| 77 | Ga0157369_10000651 | 3300013105 | Bacteria | 44860 |
| 78 | Ga0157369_10004856 | 3300013105 | Bacteria | 15775 |
| 79 | Ga0157369_10013306 | 3300013105 | Bacteria | 9306 |
| 80 | Ga0157369_10127481 | 3300013105 | Bacteria | 2697 |
| 81 | Ga0157369_10289333 | 3300013105 | Bacteria | 1706 |
| 82 | Ga0157374_10002262 | 3300013296 | Bacteria | 16210 |
| 83 | Ga0157374_10026585 | 3300013296 | Bacteria | 5209 |
| 84 | Ga0157374_10030643 | 3300013296 | Bacteria | 4886 |
| 85 | Ga0157374_10056584 | 3300013296 | Bacteria | 3662 |
| 86 | Ga0157374_10106095 | 3300013296 | Bacteria | 2699 |
| 87 | Ga0157374_10415599 | 3300013296 | Unclassified | 1343 |
| 88 | Ga0157378_10026929 | 3300013297 | Bacteria | 5070 |
| 89 | Ga0163162_10035337 | 3300013306 | Bacteria | 4977 |
| 90 | Ga0163162_10445838 | 3300013306 | Bacteria | 1426 |
| 91 | Ga0157372_10002502 | 3300013307 | Bacteria | 19934 |
| 92 | Ga0157372_10002826 | 3300013307 | Bacteria | 18759 |
| 93 | Ga0157372_10007620 | 3300013307 | Bacteria | 11511 |
| 94 | Ga0157372_10046699 | 3300013307 | Bacteria | 4808 |
| 95 | Ga0157372_10050167 | 3300013307 | Bacteria | 4643 |
| 96 | Ga0157372_10095555 | 3300013307 | Bacteria | 3386 |
| 97 | Ga0157372_10125128 | 3300013307 | Plasmid | 2955 |
| 98 | Ga0163163_10004269 | 3300014325 | Bacteria | 12181 |
| 99 | Ga0163163_10475223 | 3300014325 | Unclassified | 1311 |
| 100 | Ga0157380_10213032 | 3300014326 | Bacteria | 1723 |
| 101 | Ga0157376_10012757 | 3300014969 | Bacteria | 6249 |
| 102 | Ga0157376_10246840 | 3300014969 | Unclassified | 1666 |
| 103 | Ga0182007_10061806 | 3300015262 | Unclassified | 1228 |
| 104 | Ga0213872_10035427 | 3300021361 | Bacteria | 2282 |
| 105 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 106 | Ga0213875_10000024 | 3300021388 | Bacteria | 200333 |
| 107 | Ga0207710_10202937 | 3300025900 | Bacteria | 980 |
| 108 | Ga0207685_10010448 | 3300025905 | Bacteria | 2742 |
| 109 | Ga0207699_10013797 | 3300025906 | Bacteria | 4146 |
| 110 | Ga0207705_10185536 | 3300025909 | Unclassified | 1571 |
| 111 | Ga0207684_10063136 | 3300025910 | Unclassified | 3145 |
| 112 | Ga0207684_10242708 | 3300025910 | Bacteria | 1554 |
| 113 | Ga0207654_10000196 | 3300025911 | Bacteria | 37282 |
| 114 | Ga0207654_10010421 | 3300025911 | Bacteria | 4733 |
| 115 | Ga0207654_10343442 | 3300025911 | Unclassified | 1026 |
| 116 | Ga0207695_10000166 | 3300025913 | Bacteria | 195439 |
| 117 | Ga0207695_10056657 | 3300025913 | Unclassified | 4077 |
| 118 | Ga0207695_10137419 | 3300025913 | Bacteria | 2396 |
| 119 | Ga0207695_10267149 | 3300025913 | Bacteria | 1607 |
| 120 | Ga0207671_10000679 | 3300025914 | Bacteria | 44334 |
| 121 | Ga0207671_10017966 | 3300025914 | Bacteria | 5441 |
| 122 | Ga0207693_10003635 | 3300025915 | Bacteria | 13171 |
| 123 | Ga0207693_10011162 | 3300025915 | Bacteria | 7275 |
| 124 | Ga0207693_10021904 | 3300025915 | Bacteria | 5081 |
| 125 | Ga0207657_10226378 | 3300025919 | Bacteria | 1497 |
| 126 | Ga0207657_10282733 | 3300025919 | Bacteria | 1317 |
| 127 | Ga0207694_10000123 | 3300025924 | Bacteria | 82152 |
| 128 | Ga0207694_10020773 | 3300025924 | Unclassified | 4970 |
| 129 | Ga0207687_10223330 | 3300025927 | Bacteria | 1484 |
| 130 | Ga0207700_10002788 | 3300025928 | Bacteria | 10066 |
| 131 | Ga0207700_10013302 | 3300025928 | Bacteria | 5348 |
| 132 | Ga0207700_10013364 | 3300025928 | Bacteria | 5338 |
| 133 | Ga0207700_10020173 | 3300025928 | Unclassified | 4519 |
| 134 | Ga0207700_10559317 | 3300025928 | Bacteria | 1016 |
| 135 | Ga0207700_10616028 | 3300025928 | Bacteria | 966 |
| 136 | Ga0207664_10000063 | 3300025929 | Bacteria | 113763 |
| 137 | Ga0207664_10044859 | 3300025929 | Plasmid | 3464 |
| 138 | Ga0207664_10144944 | 3300025929 | Bacteria | 2013 |
| 139 | Ga0207664_10189800 | 3300025929 | Bacteria | 1768 |
| 140 | Ga0207690_10033451 | 3300025932 | Bacteria | 3306 |
| 141 | Ga0207706_10671153 | 3300025933 | Bacteria | 887 |
| 142 | Ga0207665_10061652 | 3300025939 | Unclassified | 2543 |
| 143 | Ga0207661_10075352 | 3300025944 | Unclassified | 2768 |
| 144 | Ga0207679_10164982 | 3300025945 | Bacteria | 1818 |
| 145 | Ga0207667_10019438 | 3300025949 | Bacteria | 7584 |
| 146 | Ga0207667_10369284 | 3300025949 | Unclassified | 1462 |
| 147 | Ga0207712_10188237 | 3300025961 | Bacteria | 1627 |
| 148 | Ga0207640_10255324 | 3300025981 | Unclassified | 1363 |
| 149 | Ga0207639_10000314 | 3300026041 | Bacteria | 34249 |
| 150 | Ga0207639_10160066 | 3300026041 | Bacteria | 1896 |
| 151 | Ga0207678_10427260 | 3300026067 | Unclassified | 1149 |
| 152 | Ga0207702_10016151 | 3300026078 | Bacteria | 6180 |
| 153 | Ga0207702_10029527 | 3300026078 | Unclassified | 4563 |
| 154 | Ga0207702_10101520 | 3300026078 | Bacteria | 2540 |
| 155 | Ga0207702_10196327 | 3300026078 | Bacteria | 1868 |
| 156 | Ga0207641_10371832 | 3300026088 | Bacteria | 1367 |
| 157 | Ga0207683_10201190 | 3300026121 | Unclassified | 1811 |
| 158 | Ga0207698_10000205 | 3300026142 | Bacteria | 36989 |
| 159 | Ga0265356_1004405 | 3300028017 | Bacteria | 1724 |
| 160 | Ga0268266_10083486 | 3300028379 | Bacteria | 2789 |
| 161 | Ga0268266_10108806 | 3300028379 | Unclassified | 2453 |
| 162 | Ga0265338_10058777 | 3300028800 | Bacteria | 3391 |
| 163 | Ga0265760_10054931 | 3300031090 | Bacteria | 1203 |
| 164 | Ga0265330_10119627 | 3300031235 | Bacteria | 1122 |
| 165 | Ga0265331_10024408 | 3300031250 | Bacteria | 3059 |
| 166 | Ga0307408_100000246 | 3300031548 | Bacteria | 56179 |
| 167 | Ga0307408_100073879 | 3300031548 | Bacteria | 2528 |
| 168 | Ga0265314_10020945 | 3300031711 | Bacteria | 5040 |
| 169 | Ga0307413_10027733 | 3300031824 | Bacteria | 3143 |
| 170 | Ga0307411_10146511 | 3300032005 | Bacteria | 1748 |
| 171 | Ga0373936_0197131 | 3300035113 | Unclassified | 888 |
| 172 | Ga0373955_0032638 | 3300035172 | Bacteria | 2735 |
| 173 | Ga0373955_0034756 | 3300035172 | Bacteria | 2665 |
| 174 | Ga0373955_0041699 | 3300035172 | Unclassified | 2462 |
| 175 | Ga0373935_0179324 | 3300035692 | Bacteria | 1454 |
| 176 | Ga0373933_0030192 | 3300035724 | Bacteria | 3138 |
| 177 | Ga0373933_0135442 | 3300035724 | Bacteria | 1552 |
| 178 | Ga0373947_0100790 | 3300035725 | Bacteria | 1815 |
| 179 | Ga0373937_0009862 | 3300036401 | Bacteria | 8326 |
| 180 | Ga0373937_0014538 | 3300036401 | Bacteria | 6952 |
| 181 | Ga0373937_0611666 | 3300036401 | Bacteria | 1034 |
| 182 | Ga0373925_0002359 | 3300037068 | Bacteria | 15153 |
| 183 | Ga0373925_0057738 | 3300037068 | Bacteria | 2908 |
| 184 | Ga0395899_0000004 | 3300037312 | Bacteria | 874267 |
| 185 | Ga0436364_0157811 | 3300037853 | Bacteria | 430293 |
| 186 | Ga0436364_0583704 | 3300037853 | Bacteria | 2001 |
| 187 | Ga0436364_0940415 | 3300037853 | Bacteria | 6791 |
| 188 | Ga0436364_0975960 | 3300037853 | Unclassified | 934 |
| 189 | Ga0436364_1099111 | 3300037853 | Unclassified | 1107 |
| 190 | Ga0436364_1265330 | 3300037853 | Bacteria | 89074 |
| 191 | Ga0436365_0373401 | 3300039437 | Bacteria | 1551 |
| 192 | Ga0436365_1264407 | 3300039437 | Unclassified | 1021 |
| 193 | Ga0436365_1373190 | 3300039437 | Unclassified | 1115 |
| 194 | Ga0436361_0337408 | 3300039447 | Bacteria | 2414 |
| 195 | Ga0436361_0602835 | 3300039447 | Bacteria | 2083 |
| 196 | Ga0436361_0755581 | 3300039447 | Bacteria | 947 |
| 197 | Ga0466969_0134582 | 3300044656 | Bacteria | 1145 |
| 198 | Ga0466966_0175410 | 3300044684 | Bacteria | 1302 |
| 199 | Ga0466961_0318947 | 3300044693 | Bacteria | 948 |
| 200 | Ga0451576_0084200 | 3300045051 | Bacteria | 3308 |
| 201 | Ga0495603_0070637 | 3300046455 | Bacteria | 2052 |
| 202 | Ga0495590_0000271 | 3300046457 | Bacteria | 28007 |
| 203 | Ga0495650_0009362 | 3300046471 | Bacteria | 5580 |
| 204 | Ga0495580_0000012 | 3300046472 | Bacteria | 97735 |
| 205 | Ga0495580_0041524 | 3300046472 | Unclassified | 3281 |
| 206 | Ga0495664_0082884 | 3300046477 | Unclassified | 1924 |
| 207 | Ga0495630_0365468 | 3300046517 | Unclassified | 1105 |
| 208 | Ga0495599_0041298 | 3300046678 | Bacteria | 2897 |
| 209 | Ga0495658_0017203 | 3300046683 | Bacteria | 3732 |
| 210 | Ga0495674_0540017 | 3300047319 | Unclassified | 929 |
| 211 | Ga0495684_0227770 | 3300047471 | Bacteria | 1364 |
| 212 | Ga0496100_0006276 | 3300048903 | Bacteria | 6473 |
| 213 | Ga0496101_0069910 | 3300048904 | Bacteria | 2569 |
| 214 | Ga0496102_0002184 | 3300048905 | Bacteria | 16803 |
| 215 | Ga0496104_0262965 | 3300048907 | Bacteria | 1638 |
| 216 | Ga0496105_0083452 | 3300048908 | Bacteria | 2639 |
| 217 | Ga0496107_0157023 | 3300048910 | Bacteria | 1685 |
| 218 | Ga0496111_0236804 | 3300048914 | Bacteria | 1356 |
| 219 | Ga0496112_0020542 | 3300048915 | Bacteria | 6262 |
| 220 | Ga0496115_0478058 | 3300048918 | Unclassified | 1004 |
| 221 | Ga0496126_0004703 | 3300048929 | Bacteria | 16131 |
| 222 | Ga0496126_0248051 | 3300048929 | Bacteria | 1484 |
| 223 | Ga0501034_0153923 | 3300049571 | Bacteria | 2274 |
| 224 | Ga0501034_0186307 | 3300049571 | Bacteria | 2039 |
| 225 | Ga0501034_0499643 | 3300049571 | Bacteria | 1130 |
| 226 | Ga0501034_0846839 | 3300049571 | Unclassified | 805 |
| 227 | Ga0501036_0192485 | 3300049572 | Bacteria | 1716 |
| 228 | Ga0501038_0144668 | 3300049574 | Unclassified | 1942 |
| 229 | Ga0501041_0046176 | 3300049577 | Bacteria | 2650 |
| 230 | Ga0501042_0358804 | 3300049578 | Bacteria | 1055 |
| 231 | Ga0501046_0080458 | 3300049580 | Bacteria | 2518 |
| 232 | Ga0501047_0007387 | 3300049581 | Bacteria | 10336 |
| 233 | Ga0501047_0380355 | 3300049581 | Bacteria | 1246 |
| 234 | Ga0501070_0110832 | 3300049586 | Bacteria | 2268 |
| 235 | Ga0501075_0106785 | 3300049591 | Bacteria | 2128 |
| 236 | Ga0501076_0051422 | 3300049592 | Bacteria | 3262 |
| 237 | Ga0501249_013649 | 3300049679 | Bacteria | 1728 |
| 238 | Ga0501080_0011900 | 3300049742 | Bacteria | 7971 |
| 239 | Ga0501080_0135408 | 3300049742 | Bacteria | 2280 |
| 240 | Ga0501035_0010475 | 3300049822 | Bacteria | 8592 |
| 241 | Ga0501044_0004495 | 3300049823 | Bacteria | 15597 |
| 242 | Ga0501044_0024565 | 3300049823 | Bacteria | 6394 |
| 243 | Ga0501045_0418377 | 3300049824 | Bacteria | 997 |
| 244 | nmdc:mga0yw44_10872_c1 | 3300050492 | Bacteria | 4667 |
| 245 | nmdc:mga0qj67_419724_c1 | 3300050509 | Bacteria | 1078 |
| 246 | Ga0500562_023605 | 3300053108 | Unclassified | 1606 |
| 247 | Ga0500636_0001491 | 3300053177 | Bacteria | 12728 |
| 248 | Ga0500645_032106 | 3300053730 | Bacteria | 1576 |
| 249 | Ga0501084_0480831 | 3300054114 | Bacteria | 1050 |
| 250 | Ga0501082_0279058 | 3300060353 | Bacteria | 1454 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0846839 | Ga0501034_0846839_55_774 | 237 |
| 2 | 3300046472 | Ga0495580_0041524 | Ga0495580_0041524_297_1103 | 244 |
| 3 | 3300005458 | Ga0070681_10619539 | Ga0070681_106195392 | 245 |
| 4 | 3300014325 | Ga0163163_10004269 | Ga0163163_1000426910 | 248 |
| 5 | 3300025927 | Ga0207687_10223330 | Ga0207687_102233301 | 248 |
| 6 | iso_pu_bacteria | 2547132374 | 2548496865 | 248 |
| 7 | iso_pu_bacteria | 2643221717 | 2644645631 | 248 |
| 8 | 3300053108 | Ga0500562_023605 | Ga0500562_023605_301_1056 | 249 |
| 9 | 3300035113 | Ga0373936_0197131 | Ga0373936_0197131_65_817 | 250 |
| 10 | iso_pu_bacteria | 2643221611 | 2644076526 | 250 |
| 11 | 3300049571 | Ga0501034_0186307 | Ga0501034_0186307_62_820 | 251 |
| 12 | 3300049581 | Ga0501047_0380355 | Ga0501047_0380355_305_1081 | 251 |
| 13 | 3300050492 | nmdc:mga0yw44_10872_c1 | nmdc:mga0yw44_10872_c1_2123_2899 | 251 |
| 14 | iso_pu_bacteria | 2883291878 | 2883294589 | 251 |
| 15 | iso_pu_bacteria | 2883354860 | 2883356909 | 251 |
| 16 | 3300005435 | Ga0070714_100000045 | Ga0070714_10000004555 | 252 |
| 17 | 3300005563 | Ga0068855_100346599 | Ga0068855_1003465992 | 252 |
| 18 | 3300009551 | Ga0105238_10039748 | Ga0105238_100397485 | 252 |
| 19 | 3300025929 | Ga0207664_10000063 | Ga0207664_1000006358 | 252 |
| 20 | 3300031548 | Ga0307408_100000246 | Ga0307408_10000024640 | 252 |
| 21 | 3300046455 | Ga0495603_0070637 | Ga0495603_0070637_1173_1937 | 252 |
| 22 | 3300046457 | Ga0495590_0000271 | Ga0495590_0000271_20726_21490 | 252 |
| 23 | 3300048905 | Ga0496102_0002184 | Ga0496102_0002184_3754_4518 | 252 |
| 24 | iso_pu_bacteria | 2842333319 | 2842333619 | 252 |
| 25 | 3300005436 | Ga0070713_100086319 | Ga0070713_1000863192 | 253 |
| 26 | 3300005437 | Ga0070710_10060290 | Ga0070710_100602902 | 253 |
| 27 | 3300025928 | Ga0207700_10020173 | Ga0207700_100201734 | 253 |
| 28 | 3300031824 | Ga0307413_10027733 | Ga0307413_100277332 | 253 |
| 29 | 3300032005 | Ga0307411_10146511 | Ga0307411_101465112 | 253 |
| 30 | 3300046471 | Ga0495650_0009362 | Ga0495650_0009362_2233_3087 | 253 |
| 31 | 3300049679 | Ga0501249_013649 | Ga0501249_013649_642_1583 | 253 |
| 32 | 3300053177 | Ga0500636_0001491 | Ga0500636_0001491_7012_7788 | 253 |
| 33 | 3300053730 | Ga0500645_032106 | Ga0500645_032106_261_1043 | 253 |
| 34 | 3300005327 | Ga0070658_10009223 | Ga0070658_100092238 | 254 |
| 35 | 3300005436 | Ga0070713_100020619 | Ga0070713_1000206194 | 254 |
| 36 | 3300005983 | Ga0081540_1010968 | Ga0081540_10109684 | 254 |
| 37 | 3300006048 | Ga0075363_100024656 | Ga0075363_1000246564 | 254 |
| 38 | 3300009094 | Ga0111539_10478347 | Ga0111539_104783471 | 254 |
| 39 | 3300013307 | Ga0157372_10007620 | Ga0157372_1000762010 | 254 |
| 40 | 3300021361 | Ga0213872_10035427 | Ga0213872_100354273 | 254 |
| 41 | 3300025909 | Ga0207705_10185536 | Ga0207705_101855362 | 254 |
| 42 | 3300025928 | Ga0207700_10013364 | Ga0207700_100133644 | 254 |
| 43 | 3300025939 | Ga0207665_10061652 | Ga0207665_100616523 | 254 |
| 44 | 3300025944 | Ga0207661_10075352 | Ga0207661_100753522 | 254 |
| 45 | 3300031250 | Ga0265331_10024408 | Ga0265331_100244084 | 254 |
| 46 | 3300035172 | Ga0373955_0034756 | Ga0373955_0034756_1378_2142 | 254 |
| 47 | 3300035724 | Ga0373933_0030192 | Ga0373933_0030192_1544_2308 | 254 |
| 48 | 3300035724 | Ga0373933_0135442 | Ga0373933_0135442_620_1384 | 254 |
| 49 | 3300036401 | Ga0373937_0009862 | Ga0373937_0009862_2294_3058 | 254 |
| 50 | 3300037312 | Ga0395899_0000004 | Ga0395899_0000004_415702_416481 | 254 |
| 51 | 3300039447 | Ga0436361_0337408 | Ga0436361_0337408_803_1582 | 254 |
| 52 | 3300039447 | Ga0436361_0602835 | Ga0436361_0602835_1184_1963 | 254 |
| 53 | 3300044656 | Ga0466969_0134582 | Ga0466969_0134582_224_1003 | 254 |
| 54 | 3300044684 | Ga0466966_0175410 | Ga0466966_0175410_229_1008 | 254 |
| 55 | 3300044693 | Ga0466961_0318947 | Ga0466961_0318947_41_805 | 254 |
| 56 | 3300047471 | Ga0495684_0227770 | Ga0495684_0227770_31_795 | 254 |
| 57 | 3300048929 | Ga0496126_0004703 | Ga0496126_0004703_13146_13910 | 254 |
| 58 | 3300048929 | Ga0496126_0248051 | Ga0496126_0248051_160_1023 | 254 |
| 59 | 3300005331 | Ga0070670_100229609 | Ga0070670_1002296092 | 255 |
| 60 | 3300006358 | Ga0068871_100716908 | Ga0068871_1007169081 | 255 |
| 61 | 3300013307 | Ga0157372_10050167 | Ga0157372_100501672 | 255 |
| 62 | 3300014326 | Ga0157380_10213032 | Ga0157380_102130322 | 255 |
| 63 | 3300025929 | Ga0207664_10189800 | Ga0207664_101898002 | 255 |
| 64 | 3300026078 | Ga0207702_10016151 | Ga0207702_100161512 | 255 |
| 65 | 3300028379 | Ga0268266_10083486 | Ga0268266_100834863 | 255 |
| 66 | 3300031548 | Ga0307408_100073879 | Ga0307408_1000738793 | 255 |
| 67 | 3300037853 | Ga0436364_0975960 | Ga0436364_0975960_147_914 | 255 |
| 68 | 3300045051 | Ga0451576_0084200 | Ga0451576_0084200_2295_3098 | 255 |
| 69 | 3300046477 | Ga0495664_0082884 | Ga0495664_0082884_239_1030 | 255 |
| 70 | 3300046678 | Ga0495599_0041298 | Ga0495599_0041298_1616_2389 | 255 |
| 71 | 3300049571 | Ga0501034_0153923 | Ga0501034_0153923_404_1171 | 255 |
| 72 | 3300049571 | Ga0501034_0499643 | Ga0501034_0499643_39_848 | 255 |
| 73 | 3300049574 | Ga0501038_0144668 | Ga0501038_0144668_581_1348 | 255 |
| 74 | 3300049578 | Ga0501042_0358804 | Ga0501042_0358804_20_817 | 255 |
| 75 | 3300049580 | Ga0501046_0080458 | Ga0501046_0080458_1246_2013 | 255 |
| 76 | 3300049581 | Ga0501047_0007387 | Ga0501047_0007387_3255_4022 | 255 |
| 77 | 3300049586 | Ga0501070_0110832 | Ga0501070_0110832_196_963 | 255 |
| 78 | 3300049742 | Ga0501080_0011900 | Ga0501080_0011900_1449_2258 | 255 |
| 79 | 3300049742 | Ga0501080_0135408 | Ga0501080_0135408_843_1610 | 255 |
| 80 | 3300049822 | Ga0501035_0010475 | Ga0501035_0010475_7733_8500 | 255 |
| 81 | 3300049823 | Ga0501044_0004495 | Ga0501044_0004495_8087_8854 | 255 |
| 82 | 3300049824 | Ga0501045_0418377 | Ga0501045_0418377_163_948 | 255 |
| 83 | 3300054114 | Ga0501084_0480831 | Ga0501084_0480831_146_943 | 255 |
| 84 | 3300060353 | Ga0501082_0279058 | Ga0501082_0279058_555_1364 | 255 |
| 85 | 3300005435 | Ga0070714_100029855 | Ga0070714_1000298553 | 256 |
| 86 | 3300005530 | Ga0070679_100060088 | Ga0070679_1000600882 | 256 |
| 87 | 3300005539 | Ga0068853_100222026 | Ga0068853_1002220262 | 256 |
| 88 | 3300005564 | Ga0070664_100020249 | Ga0070664_1000202492 | 256 |
| 89 | 3300005578 | Ga0068854_100054806 | Ga0068854_1000548062 | 256 |
| 90 | 3300005614 | Ga0068856_100009987 | Ga0068856_1000099873 | 256 |
| 91 | 3300005616 | Ga0068852_100299022 | Ga0068852_1002990222 | 256 |
| 92 | 3300005937 | Ga0081455_10011682 | Ga0081455_100116824 | 256 |
| 93 | 3300009174 | Ga0105241_10048120 | Ga0105241_100481203 | 256 |
| 94 | 3300013105 | Ga0157369_10004856 | Ga0157369_100048567 | 256 |
| 95 | 3300013105 | Ga0157369_10127481 | Ga0157369_101274813 | 256 |
| 96 | 3300013296 | Ga0157374_10002262 | Ga0157374_1000226210 | 256 |
| 97 | 3300013307 | Ga0157372_10125128 | Ga0157372_101251283 | 256 |
| 98 | 3300025928 | Ga0207700_10559317 | Ga0207700_105593171 | 256 |
| 99 | 3300025945 | Ga0207679_10164982 | Ga0207679_101649822 | 256 |
| 100 | 3300025981 | Ga0207640_10255324 | Ga0207640_102553242 | 256 |
| 101 | 3300026041 | Ga0207639_10160066 | Ga0207639_101600662 | 256 |
| 102 | 3300026067 | Ga0207678_10427260 | Ga0207678_104272601 | 256 |
| 103 | 3300026078 | Ga0207702_10101520 | Ga0207702_101015202 | 256 |
| 104 | 3300037853 | Ga0436364_1099111 | Ga0436364_1099111_187_957 | 256 |
| 105 | 3300048918 | Ga0496115_0478058 | Ga0496115_0478058_48_872 | 256 |
| 106 | 3300049572 | Ga0501036_0192485 | Ga0501036_0192485_869_1675 | 256 |
| 107 | 3300049577 | Ga0501041_0046176 | Ga0501041_0046176_1814_2620 | 256 |
| 108 | 3300049591 | Ga0501075_0106785 | Ga0501075_0106785_844_1650 | 256 |
| 109 | 3300049592 | Ga0501076_0051422 | Ga0501076_0051422_2419_3225 | 256 |
| 110 | 3300050509 | nmdc:mga0qj67_419724_c1 | nmdc:mga0qj67_419724_c1_217_993 | 256 |
| 111 | 3300005327 | Ga0070658_10732224 | Ga0070658_107322241 | 257 |
| 112 | 3300005339 | Ga0070660_100446131 | Ga0070660_1004461311 | 257 |
| 113 | 3300005344 | Ga0070661_100017337 | Ga0070661_1000173374 | 257 |
| 114 | 3300005366 | Ga0070659_100055612 | Ga0070659_1000556122 | 257 |
| 115 | 3300005455 | Ga0070663_100146523 | Ga0070663_1001465232 | 257 |
| 116 | 3300005535 | Ga0070684_100422627 | Ga0070684_1004226272 | 257 |
| 117 | 3300005539 | Ga0068853_100036677 | Ga0068853_1000366773 | 257 |
| 118 | 3300005563 | Ga0068855_100025507 | Ga0068855_1000255074 | 257 |
| 119 | 3300005563 | Ga0068855_100109588 | Ga0068855_1001095884 | 257 |
| 120 | 3300005563 | Ga0068855_100643009 | Ga0068855_1006430092 | 257 |
| 121 | 3300005614 | Ga0068856_100032995 | Ga0068856_1000329952 | 257 |
| 122 | 3300005614 | Ga0068856_100122607 | Ga0068856_1001226073 | 257 |
| 123 | 3300006028 | Ga0070717_10016992 | Ga0070717_100169924 | 257 |
| 124 | 3300009093 | Ga0105240_10001119 | Ga0105240_1000111923 | 257 |
| 125 | 3300009093 | Ga0105240_10055245 | Ga0105240_100552452 | 257 |
| 126 | 3300009174 | Ga0105241_10000377 | Ga0105241_1000037712 | 257 |
| 127 | 3300009174 | Ga0105241_10152984 | Ga0105241_101529842 | 257 |
| 128 | 3300009174 | Ga0105241_10276147 | Ga0105241_102761472 | 257 |
| 129 | 3300009545 | Ga0105237_10001489 | Ga0105237_1000148913 | 257 |
| 130 | 3300009551 | Ga0105238_10001123 | Ga0105238_1000112312 | 257 |
| 131 | 3300009551 | Ga0105238_10065567 | Ga0105238_100655673 | 257 |
| 132 | 3300010375 | Ga0105239_10000731 | Ga0105239_1000073122 | 257 |
| 133 | 3300013100 | Ga0157373_10217321 | Ga0157373_102173211 | 257 |
| 134 | 3300013105 | Ga0157369_10000651 | Ga0157369_1000065112 | 257 |
| 135 | 3300013105 | Ga0157369_10013306 | Ga0157369_100133062 | 257 |
| 136 | 3300013105 | Ga0157369_10289333 | Ga0157369_102893333 | 257 |
| 137 | 3300013296 | Ga0157374_10106095 | Ga0157374_101060954 | 257 |
| 138 | 3300013296 | Ga0157374_10415599 | Ga0157374_104155992 | 257 |
| 139 | 3300013307 | Ga0157372_10002502 | Ga0157372_1000250214 | 257 |
| 140 | 3300013307 | Ga0157372_10046699 | Ga0157372_100466993 | 257 |
| 141 | 3300013307 | Ga0157372_10095555 | Ga0157372_100955554 | 257 |
| 142 | 3300021388 | Ga0213875_10000005 | Ga0213875_10000005281 | 257 |
| 143 | 3300021388 | Ga0213875_10000024 | Ga0213875_10000024108 | 257 |
| 144 | 3300025911 | Ga0207654_10000196 | Ga0207654_100001962 | 257 |
| 145 | 3300025911 | Ga0207654_10343442 | Ga0207654_103434422 | 257 |
| 146 | 3300025913 | Ga0207695_10000166 | Ga0207695_1000016682 | 257 |
| 147 | 3300025913 | Ga0207695_10056657 | Ga0207695_100566571 | 257 |
| 148 | 3300025914 | Ga0207671_10000679 | Ga0207671_100006795 | 257 |
| 149 | 3300025919 | Ga0207657_10282733 | Ga0207657_102827332 | 257 |
| 150 | 3300025924 | Ga0207694_10000123 | Ga0207694_1000012313 | 257 |
| 151 | 3300025924 | Ga0207694_10020773 | Ga0207694_100207737 | 257 |
| 152 | 3300025929 | Ga0207664_10144944 | Ga0207664_101449443 | 257 |
| 153 | 3300025932 | Ga0207690_10033451 | Ga0207690_100334514 | 257 |
| 154 | 3300025933 | Ga0207706_10671153 | Ga0207706_106711531 | 257 |
| 155 | 3300025949 | Ga0207667_10019438 | Ga0207667_100194382 | 257 |
| 156 | 3300025949 | Ga0207667_10369284 | Ga0207667_103692842 | 257 |
| 157 | 3300026041 | Ga0207639_10000314 | Ga0207639_100003142 | 257 |
| 158 | 3300026078 | Ga0207702_10029527 | Ga0207702_100295272 | 257 |
| 159 | 3300026078 | Ga0207702_10196327 | Ga0207702_101963273 | 257 |
| 160 | 3300026142 | Ga0207698_10000205 | Ga0207698_100002052 | 257 |
| 161 | 3300037853 | Ga0436364_0157811 | Ga0436364_0157811_264987_265760 | 257 |
| 162 | 3300037853 | Ga0436364_0583704 | Ga0436364_0583704_147_941 | 257 |
| 163 | 3300037853 | Ga0436364_1265330 | Ga0436364_1265330_10288_11070 | 257 |
| 164 | 3300039437 | Ga0436365_0373401 | Ga0436365_0373401_77_871 | 257 |
| 165 | 3300039437 | Ga0436365_1264407 | Ga0436365_1264407_22_819 | 257 |
| 166 | 3300048915 | Ga0496112_0020542 | Ga0496112_0020542_2316_3095 | 257 |
| 167 | 3300049823 | Ga0501044_0024565 | Ga0501044_0024565_946_1725 | 257 |
| 168 | 3300005295 | Ga0065707_10436364 | Ga0065707_104363641 | 258 |
| 169 | 3300005334 | Ga0068869_100008959 | Ga0068869_1000089594 | 258 |
| 170 | 3300005436 | Ga0070713_100001859 | Ga0070713_10000185914 | 258 |
| 171 | 3300005436 | Ga0070713_100008082 | Ga0070713_1000080825 | 258 |
| 172 | 3300005437 | Ga0070710_10035820 | Ga0070710_100358202 | 258 |
| 173 | 3300005437 | Ga0070710_10044859 | Ga0070710_100448593 | 258 |
| 174 | 3300005445 | Ga0070708_100037709 | Ga0070708_1000377094 | 258 |
| 175 | 3300005456 | Ga0070678_100103426 | Ga0070678_1001034263 | 258 |
| 176 | 3300005467 | Ga0070706_100075306 | Ga0070706_1000753062 | 258 |
| 177 | 3300005518 | Ga0070699_100346948 | Ga0070699_1003469481 | 258 |
| 178 | 3300005548 | Ga0070665_100151308 | Ga0070665_1001513082 | 258 |
| 179 | 3300005614 | Ga0068856_100046762 | Ga0068856_1000467624 | 258 |
| 180 | 3300005614 | Ga0068856_100206549 | Ga0068856_1002065492 | 258 |
| 181 | 3300005844 | Ga0068862_100202797 | Ga0068862_1002027972 | 258 |
| 182 | 3300006028 | Ga0070717_10011295 | Ga0070717_100112959 | 258 |
| 183 | 3300006175 | Ga0070712_100003711 | Ga0070712_1000037112 | 258 |
| 184 | 3300006175 | Ga0070712_100009068 | Ga0070712_1000090685 | 258 |
| 185 | 3300006175 | Ga0070712_100009655 | Ga0070712_1000096553 | 258 |
| 186 | 3300006237 | Ga0097621_100006834 | Ga0097621_1000068346 | 258 |
| 187 | 3300009098 | Ga0105245_10556048 | Ga0105245_105560481 | 258 |
| 188 | 3300009174 | Ga0105241_10005768 | Ga0105241_100057685 | 258 |
| 189 | 3300009553 | Ga0105249_10244871 | Ga0105249_102448712 | 258 |
| 190 | 3300013100 | Ga0157373_10065121 | Ga0157373_100651212 | 258 |
| 191 | 3300013296 | Ga0157374_10026585 | Ga0157374_100265854 | 258 |
| 192 | 3300013296 | Ga0157374_10030643 | Ga0157374_100306433 | 258 |
| 193 | 3300013297 | Ga0157378_10026929 | Ga0157378_100269298 | 258 |
| 194 | 3300013306 | Ga0163162_10035337 | Ga0163162_100353374 | 258 |
| 195 | 3300013306 | Ga0163162_10445838 | Ga0163162_104458382 | 258 |
| 196 | 3300014969 | Ga0157376_10246840 | Ga0157376_102468401 | 258 |
| 197 | 3300015262 | Ga0182007_10061806 | Ga0182007_100618061 | 258 |
| 198 | 3300025900 | Ga0207710_10202937 | Ga0207710_102029371 | 258 |
| 199 | 3300025905 | Ga0207685_10010448 | Ga0207685_100104483 | 258 |
| 200 | 3300025906 | Ga0207699_10013797 | Ga0207699_100137977 | 258 |
| 201 | 3300025910 | Ga0207684_10063136 | Ga0207684_100631362 | 258 |
| 202 | 3300025910 | Ga0207684_10242708 | Ga0207684_102427081 | 258 |
| 203 | 3300025913 | Ga0207695_10267149 | Ga0207695_102671492 | 258 |
| 204 | 3300025915 | Ga0207693_10003635 | Ga0207693_100036357 | 258 |
| 205 | 3300025915 | Ga0207693_10011162 | Ga0207693_100111622 | 258 |
| 206 | 3300025915 | Ga0207693_10021904 | Ga0207693_100219047 | 258 |
| 207 | 3300025919 | Ga0207657_10226378 | Ga0207657_102263783 | 258 |
| 208 | 3300025928 | Ga0207700_10002788 | Ga0207700_100027885 | 258 |
| 209 | 3300025928 | Ga0207700_10013302 | Ga0207700_100133026 | 258 |
| 210 | 3300025928 | Ga0207700_10616028 | Ga0207700_106160281 | 258 |
| 211 | 3300025929 | Ga0207664_10044859 | Ga0207664_100448592 | 258 |
| 212 | 3300025961 | Ga0207712_10188237 | Ga0207712_101882372 | 258 |
| 213 | 3300026088 | Ga0207641_10371832 | Ga0207641_103718321 | 258 |
| 214 | 3300026121 | Ga0207683_10201190 | Ga0207683_102011901 | 258 |
| 215 | 3300028017 | Ga0265356_1004405 | Ga0265356_10044053 | 258 |
| 216 | 3300028379 | Ga0268266_10108806 | Ga0268266_101088062 | 258 |
| 217 | 3300028800 | Ga0265338_10058777 | Ga0265338_100587775 | 258 |
| 218 | 3300031090 | Ga0265760_10054931 | Ga0265760_100549311 | 258 |
| 219 | 3300031235 | Ga0265330_10119627 | Ga0265330_101196271 | 258 |
| 220 | 3300031711 | Ga0265314_10020945 | Ga0265314_100209455 | 258 |
| 221 | 3300035172 | Ga0373955_0032638 | Ga0373955_0032638_1047_1826 | 258 |
| 222 | 3300035172 | Ga0373955_0041699 | Ga0373955_0041699_235_1011 | 258 |
| 223 | 3300035725 | Ga0373947_0100790 | Ga0373947_0100790_785_1582 | 258 |
| 224 | 3300036401 | Ga0373937_0014538 | Ga0373937_0014538_2379_3158 | 258 |
| 225 | 3300036401 | Ga0373937_0611666 | Ga0373937_0611666_84_860 | 258 |
| 226 | 3300037068 | Ga0373925_0002359 | Ga0373925_0002359_2967_3764 | 258 |
| 227 | 3300037853 | Ga0436364_0940415 | Ga0436364_0940415_1697_2521 | 258 |
| 228 | 3300039437 | Ga0436365_1373190 | Ga0436365_1373190_267_1043 | 258 |
| 229 | 3300039447 | Ga0436361_0755581 | Ga0436361_0755581_96_872 | 258 |
| 230 | 3300046472 | Ga0495580_0000012 | Ga0495580_0000012_92215_93012 | 258 |
| 231 | 3300046517 | Ga0495630_0365468 | Ga0495630_0365468_29_805 | 258 |
| 232 | 3300046683 | Ga0495658_0017203 | Ga0495658_0017203_2844_3641 | 258 |
| 233 | 3300047319 | Ga0495674_0540017 | Ga0495674_0540017_131_907 | 258 |
| 234 | 3300048907 | Ga0496104_0262965 | Ga0496104_0262965_158_934 | 258 |
| 235 | 3300048910 | Ga0496107_0157023 | Ga0496107_0157023_185_961 | 258 |
| 236 | 3300048914 | Ga0496111_0236804 | Ga0496111_0236804_514_1296 | 258 |
| 237 | 3300005331 | Ga0070670_100067499 | Ga0070670_1000674994 | 259 |
| 238 | 3300003323 | rootH1_10279507 | rootH1_102795072 | 261 |
| 239 | 3300006358 | Ga0068871_100007507 | Ga0068871_1000075073 | 261 |
| 240 | 3300009093 | Ga0105240_10006086 | Ga0105240_1000608624 | 261 |
| 241 | 3300009545 | Ga0105237_10097833 | Ga0105237_100978332 | 261 |
| 242 | 3300009551 | Ga0105238_10033162 | Ga0105238_100331625 | 261 |
| 243 | 3300009551 | Ga0105238_10153058 | Ga0105238_101530584 | 261 |
| 244 | 3300013100 | Ga0157373_10301158 | Ga0157373_103011582 | 261 |
| 245 | 3300013296 | Ga0157374_10056584 | Ga0157374_100565844 | 261 |
| 246 | 3300013307 | Ga0157372_10002826 | Ga0157372_1000282624 | 261 |
| 247 | 3300014325 | Ga0163163_10475223 | Ga0163163_104752232 | 261 |
| 248 | 3300014969 | Ga0157376_10012757 | Ga0157376_100127573 | 261 |
| 249 | 3300025911 | Ga0207654_10010421 | Ga0207654_100104213 | 261 |
| 250 | 3300025913 | Ga0207695_10137419 | Ga0207695_101374193 | 261 |
| 251 | 3300025914 | Ga0207671_10017966 | Ga0207671_100179664 | 261 |
| 252 | 3300035692 | Ga0373935_0179324 | Ga0373935_0179324_575_1360 | 261 |
| 253 | 3300037068 | Ga0373925_0057738 | Ga0373925_0057738_77_862 | 261 |
| 254 | 3300048903 | Ga0496100_0006276 | Ga0496100_0006276_5230_6015 | 261 |
| 255 | 3300048904 | Ga0496101_0069910 | Ga0496101_0069910_710_1495 | 261 |
| 256 | 3300048908 | Ga0496105_0083452 | Ga0496105_0083452_843_1628 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9598 | 5 | 259 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9525 | 5 | 259 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9512 | 5 | 259 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9421 | 5 | 260 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9405 | 5 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.964 | 5 | 259 | 3.60.10.10 |
| af_P09030_1_268_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9563 | 5 | 259 | 3.60.10.10 |
| af_P96273_24_289_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9533 | 5 | 257 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.953 | 5 | 259 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9393 | 5 | 260 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A812Y423-F1-model_v4 | ExoA protein | 0.9933 | 5 | 239 |
GO:0003677
GO:0004252 GO:0004519 GO:0006281 GO:0008311 GO:0016020 GO:0016491 GO:0046872 |
| AF-A0A4V2BB30-F1-model_v4 | deleted | 0.9927 | 5 | 189 |
|
| AF-A0A357FWS3-F1-model_v4 | Exodeoxyribonuclease III | 0.9911 | 3 | 259 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-Q2W488-F1-model_v4 | Exonuclease III | 0.9899 | 2 | 258 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A178M7R2-F1-model_v4 | Exodeoxyribonuclease III | 0.9892 | 5 | 258 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar