F366384

General Info

Members Datasets Scaffolds Average Seq Length
256 155 250 262

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100007507|Ga0068871_1000075073
Length 308
Sequence VGLFGRAQVFLTNIHDRMPVILNSEPYDLCSTGNEACEHGGILRSARMWVMFKVASWNLNSVRSRLTHVTAWLKAREPDVLLLQELKGTKFPSEVFKSLGYESVAVTQKAYNGVAILSRHPMETIAKALVGDDSDSHARFLEVIIKRIRIVNIYLPNGNPVGSDKFAYKLAWMDRLNQQMIRWKQNDVPTLIGGDFNVIPEDIDCHKPSSWEHDALFQPEPRARYLAMLDMGYTDAFRSLHVGEIGHFTFWDYFRQAFQNNRGIRIDHFLLSPTLANRLEGCEIDKGPRAQEKPSDHTPIIVTLSDLQ

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221611 Acidovorax sp. Root219 Isolate Unclassified
3 2643221717 Acidovorax sp. Root267 Isolate Unclassified
4 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
5 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
6 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
152 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
153 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.39
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0.39
Rhizoplane 3.52
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10279507 3300003323 Unclassified 1299
2 Ga0065707_10436364 3300005295 Unclassified 815
3 Ga0070658_10009223 3300005327 Bacteria 7934
4 Ga0070658_10732224 3300005327 Unclassified 859
5 Ga0070670_100067499 3300005331 Unclassified 3068
6 Ga0070670_100229609 3300005331 Bacteria 1615
7 Ga0068869_100008959 3300005334 Bacteria 6479
8 Ga0070660_100446131 3300005339 Bacteria 1073
9 Ga0070661_100017337 3300005344 Bacteria 5109
10 Ga0070659_100055612 3300005366 Bacteria 3120
11 Ga0070714_100000045 3300005435 Bacteria 113749
12 Ga0070714_100029855 3300005435 Bacteria 4535
13 Ga0070713_100001859 3300005436 Bacteria 13615
14 Ga0070713_100008082 3300005436 Bacteria 7439
15 Ga0070713_100020619 3300005436 Bacteria 5057
16 Ga0070713_100086319 3300005436 Unclassified 2690
17 Ga0070710_10035820 3300005437 Bacteria 2708
18 Ga0070710_10044859 3300005437 Bacteria 2454
19 Ga0070710_10060290 3300005437 Unclassified 2158
20 Ga0070708_100037709 3300005445 Bacteria 4219
21 Ga0070663_100146523 3300005455 Bacteria 1807
22 Ga0070678_100103426 3300005456 Unclassified 2213
23 Ga0070681_10619539 3300005458 Unclassified 997
24 Ga0070706_100075306 3300005467 Unclassified 3123
25 Ga0070699_100346948 3300005518 Bacteria 1337
26 Ga0070679_100060088 3300005530 Bacteria 3788
27 Ga0070684_100422627 3300005535 Bacteria 1230
28 Ga0068853_100036677 3300005539 Bacteria 4170
29 Ga0068853_100222026 3300005539 Bacteria 1726
30 Ga0070665_100151308 3300005548 Unclassified 2323
31 Ga0068855_100025507 3300005563 Bacteria 7071
32 Ga0068855_100109588 3300005563 Bacteria 3170
33 Ga0068855_100346599 3300005563 Bacteria 1637
34 Ga0068855_100643009 3300005563 Bacteria 1140
35 Ga0070664_100020249 3300005564 Bacteria 5478
36 Ga0068854_100054806 3300005578 Bacteria 2869
37 Ga0068856_100009987 3300005614 Bacteria 9217
38 Ga0068856_100032995 3300005614 Bacteria 5071
39 Ga0068856_100046762 3300005614 Bacteria 4262
40 Ga0068856_100122607 3300005614 Bacteria 2601
41 Ga0068856_100206549 3300005614 Bacteria 1978
42 Ga0068852_100299022 3300005616 Bacteria 1557
43 Ga0068862_100202797 3300005844 Bacteria 1789
44 Ga0081455_10011682 3300005937 Bacteria 8808
45 Ga0081540_1010968 3300005983 Bacteria 6087
46 Ga0070717_10011295 3300006028 Bacteria 6777
47 Ga0070717_10016992 3300006028 Bacteria 5652
48 Ga0075363_100024656 3300006048 Bacteria 3060
49 Ga0070712_100003711 3300006175 Bacteria 9406
50 Ga0070712_100009068 3300006175 Bacteria 6264
51 Ga0070712_100009655 3300006175 Bacteria 6081
52 Ga0097621_100006834 3300006237 Bacteria 8107
53 Ga0068871_100007507 3300006358 Bacteria 7795
54 Ga0068871_100716908 3300006358 Unclassified 917
55 Ga0105240_10001119 3300009093 Bacteria 47175
56 Ga0105240_10006086 3300009093 Bacteria 17808
57 Ga0105240_10055245 3300009093 Unclassified 4972
58 Ga0111539_10478347 3300009094 Unclassified 1450
59 Ga0105245_10556048 3300009098 Unclassified 1170
60 Ga0105241_10000377 3300009174 Bacteria 33964
61 Ga0105241_10005768 3300009174 Bacteria 9140
62 Ga0105241_10048120 3300009174 Unclassified 3244
63 Ga0105241_10152984 3300009174 Unclassified 1889
64 Ga0105241_10276147 3300009174 Bacteria 1433
65 Ga0105237_10001489 3300009545 Bacteria 30846
66 Ga0105237_10097833 3300009545 Bacteria 2925
67 Ga0105238_10001123 3300009551 Bacteria 27011
68 Ga0105238_10033162 3300009551 Bacteria 5255
69 Ga0105238_10039748 3300009551 Bacteria 4770
70 Ga0105238_10065567 3300009551 Bacteria 3633
71 Ga0105238_10153058 3300009551 Bacteria 2281
72 Ga0105249_10244871 3300009553 Bacteria 1774
73 Ga0105239_10000731 3300010375 Bacteria 46607
74 Ga0157373_10065121 3300013100 Bacteria 2579
75 Ga0157373_10217321 3300013100 Bacteria 1348
76 Ga0157373_10301158 3300013100 Unclassified 1138
77 Ga0157369_10000651 3300013105 Bacteria 44860
78 Ga0157369_10004856 3300013105 Bacteria 15775
79 Ga0157369_10013306 3300013105 Bacteria 9306
80 Ga0157369_10127481 3300013105 Bacteria 2697
81 Ga0157369_10289333 3300013105 Bacteria 1706
82 Ga0157374_10002262 3300013296 Bacteria 16210
83 Ga0157374_10026585 3300013296 Bacteria 5209
84 Ga0157374_10030643 3300013296 Bacteria 4886
85 Ga0157374_10056584 3300013296 Bacteria 3662
86 Ga0157374_10106095 3300013296 Bacteria 2699
87 Ga0157374_10415599 3300013296 Unclassified 1343
88 Ga0157378_10026929 3300013297 Bacteria 5070
89 Ga0163162_10035337 3300013306 Bacteria 4977
90 Ga0163162_10445838 3300013306 Bacteria 1426
91 Ga0157372_10002502 3300013307 Bacteria 19934
92 Ga0157372_10002826 3300013307 Bacteria 18759
93 Ga0157372_10007620 3300013307 Bacteria 11511
94 Ga0157372_10046699 3300013307 Bacteria 4808
95 Ga0157372_10050167 3300013307 Bacteria 4643
96 Ga0157372_10095555 3300013307 Bacteria 3386
97 Ga0157372_10125128 3300013307 Plasmid 2955
98 Ga0163163_10004269 3300014325 Bacteria 12181
99 Ga0163163_10475223 3300014325 Unclassified 1311
100 Ga0157380_10213032 3300014326 Bacteria 1723
101 Ga0157376_10012757 3300014969 Bacteria 6249
102 Ga0157376_10246840 3300014969 Unclassified 1666
103 Ga0182007_10061806 3300015262 Unclassified 1228
104 Ga0213872_10035427 3300021361 Bacteria 2282
105 Ga0213875_10000005 3300021388 Bacteria 595146
106 Ga0213875_10000024 3300021388 Bacteria 200333
107 Ga0207710_10202937 3300025900 Bacteria 980
108 Ga0207685_10010448 3300025905 Bacteria 2742
109 Ga0207699_10013797 3300025906 Bacteria 4146
110 Ga0207705_10185536 3300025909 Unclassified 1571
111 Ga0207684_10063136 3300025910 Unclassified 3145
112 Ga0207684_10242708 3300025910 Bacteria 1554
113 Ga0207654_10000196 3300025911 Bacteria 37282
114 Ga0207654_10010421 3300025911 Bacteria 4733
115 Ga0207654_10343442 3300025911 Unclassified 1026
116 Ga0207695_10000166 3300025913 Bacteria 195439
117 Ga0207695_10056657 3300025913 Unclassified 4077
118 Ga0207695_10137419 3300025913 Bacteria 2396
119 Ga0207695_10267149 3300025913 Bacteria 1607
120 Ga0207671_10000679 3300025914 Bacteria 44334
121 Ga0207671_10017966 3300025914 Bacteria 5441
122 Ga0207693_10003635 3300025915 Bacteria 13171
123 Ga0207693_10011162 3300025915 Bacteria 7275
124 Ga0207693_10021904 3300025915 Bacteria 5081
125 Ga0207657_10226378 3300025919 Bacteria 1497
126 Ga0207657_10282733 3300025919 Bacteria 1317
127 Ga0207694_10000123 3300025924 Bacteria 82152
128 Ga0207694_10020773 3300025924 Unclassified 4970
129 Ga0207687_10223330 3300025927 Bacteria 1484
130 Ga0207700_10002788 3300025928 Bacteria 10066
131 Ga0207700_10013302 3300025928 Bacteria 5348
132 Ga0207700_10013364 3300025928 Bacteria 5338
133 Ga0207700_10020173 3300025928 Unclassified 4519
134 Ga0207700_10559317 3300025928 Bacteria 1016
135 Ga0207700_10616028 3300025928 Bacteria 966
136 Ga0207664_10000063 3300025929 Bacteria 113763
137 Ga0207664_10044859 3300025929 Plasmid 3464
138 Ga0207664_10144944 3300025929 Bacteria 2013
139 Ga0207664_10189800 3300025929 Bacteria 1768
140 Ga0207690_10033451 3300025932 Bacteria 3306
141 Ga0207706_10671153 3300025933 Bacteria 887
142 Ga0207665_10061652 3300025939 Unclassified 2543
143 Ga0207661_10075352 3300025944 Unclassified 2768
144 Ga0207679_10164982 3300025945 Bacteria 1818
145 Ga0207667_10019438 3300025949 Bacteria 7584
146 Ga0207667_10369284 3300025949 Unclassified 1462
147 Ga0207712_10188237 3300025961 Bacteria 1627
148 Ga0207640_10255324 3300025981 Unclassified 1363
149 Ga0207639_10000314 3300026041 Bacteria 34249
150 Ga0207639_10160066 3300026041 Bacteria 1896
151 Ga0207678_10427260 3300026067 Unclassified 1149
152 Ga0207702_10016151 3300026078 Bacteria 6180
153 Ga0207702_10029527 3300026078 Unclassified 4563
154 Ga0207702_10101520 3300026078 Bacteria 2540
155 Ga0207702_10196327 3300026078 Bacteria 1868
156 Ga0207641_10371832 3300026088 Bacteria 1367
157 Ga0207683_10201190 3300026121 Unclassified 1811
158 Ga0207698_10000205 3300026142 Bacteria 36989
159 Ga0265356_1004405 3300028017 Bacteria 1724
160 Ga0268266_10083486 3300028379 Bacteria 2789
161 Ga0268266_10108806 3300028379 Unclassified 2453
162 Ga0265338_10058777 3300028800 Bacteria 3391
163 Ga0265760_10054931 3300031090 Bacteria 1203
164 Ga0265330_10119627 3300031235 Bacteria 1122
165 Ga0265331_10024408 3300031250 Bacteria 3059
166 Ga0307408_100000246 3300031548 Bacteria 56179
167 Ga0307408_100073879 3300031548 Bacteria 2528
168 Ga0265314_10020945 3300031711 Bacteria 5040
169 Ga0307413_10027733 3300031824 Bacteria 3143
170 Ga0307411_10146511 3300032005 Bacteria 1748
171 Ga0373936_0197131 3300035113 Unclassified 888
172 Ga0373955_0032638 3300035172 Bacteria 2735
173 Ga0373955_0034756 3300035172 Bacteria 2665
174 Ga0373955_0041699 3300035172 Unclassified 2462
175 Ga0373935_0179324 3300035692 Bacteria 1454
176 Ga0373933_0030192 3300035724 Bacteria 3138
177 Ga0373933_0135442 3300035724 Bacteria 1552
178 Ga0373947_0100790 3300035725 Bacteria 1815
179 Ga0373937_0009862 3300036401 Bacteria 8326
180 Ga0373937_0014538 3300036401 Bacteria 6952
181 Ga0373937_0611666 3300036401 Bacteria 1034
182 Ga0373925_0002359 3300037068 Bacteria 15153
183 Ga0373925_0057738 3300037068 Bacteria 2908
184 Ga0395899_0000004 3300037312 Bacteria 874267
185 Ga0436364_0157811 3300037853 Bacteria 430293
186 Ga0436364_0583704 3300037853 Bacteria 2001
187 Ga0436364_0940415 3300037853 Bacteria 6791
188 Ga0436364_0975960 3300037853 Unclassified 934
189 Ga0436364_1099111 3300037853 Unclassified 1107
190 Ga0436364_1265330 3300037853 Bacteria 89074
191 Ga0436365_0373401 3300039437 Bacteria 1551
192 Ga0436365_1264407 3300039437 Unclassified 1021
193 Ga0436365_1373190 3300039437 Unclassified 1115
194 Ga0436361_0337408 3300039447 Bacteria 2414
195 Ga0436361_0602835 3300039447 Bacteria 2083
196 Ga0436361_0755581 3300039447 Bacteria 947
197 Ga0466969_0134582 3300044656 Bacteria 1145
198 Ga0466966_0175410 3300044684 Bacteria 1302
199 Ga0466961_0318947 3300044693 Bacteria 948
200 Ga0451576_0084200 3300045051 Bacteria 3308
201 Ga0495603_0070637 3300046455 Bacteria 2052
202 Ga0495590_0000271 3300046457 Bacteria 28007
203 Ga0495650_0009362 3300046471 Bacteria 5580
204 Ga0495580_0000012 3300046472 Bacteria 97735
205 Ga0495580_0041524 3300046472 Unclassified 3281
206 Ga0495664_0082884 3300046477 Unclassified 1924
207 Ga0495630_0365468 3300046517 Unclassified 1105
208 Ga0495599_0041298 3300046678 Bacteria 2897
209 Ga0495658_0017203 3300046683 Bacteria 3732
210 Ga0495674_0540017 3300047319 Unclassified 929
211 Ga0495684_0227770 3300047471 Bacteria 1364
212 Ga0496100_0006276 3300048903 Bacteria 6473
213 Ga0496101_0069910 3300048904 Bacteria 2569
214 Ga0496102_0002184 3300048905 Bacteria 16803
215 Ga0496104_0262965 3300048907 Bacteria 1638
216 Ga0496105_0083452 3300048908 Bacteria 2639
217 Ga0496107_0157023 3300048910 Bacteria 1685
218 Ga0496111_0236804 3300048914 Bacteria 1356
219 Ga0496112_0020542 3300048915 Bacteria 6262
220 Ga0496115_0478058 3300048918 Unclassified 1004
221 Ga0496126_0004703 3300048929 Bacteria 16131
222 Ga0496126_0248051 3300048929 Bacteria 1484
223 Ga0501034_0153923 3300049571 Bacteria 2274
224 Ga0501034_0186307 3300049571 Bacteria 2039
225 Ga0501034_0499643 3300049571 Bacteria 1130
226 Ga0501034_0846839 3300049571 Unclassified 805
227 Ga0501036_0192485 3300049572 Bacteria 1716
228 Ga0501038_0144668 3300049574 Unclassified 1942
229 Ga0501041_0046176 3300049577 Bacteria 2650
230 Ga0501042_0358804 3300049578 Bacteria 1055
231 Ga0501046_0080458 3300049580 Bacteria 2518
232 Ga0501047_0007387 3300049581 Bacteria 10336
233 Ga0501047_0380355 3300049581 Bacteria 1246
234 Ga0501070_0110832 3300049586 Bacteria 2268
235 Ga0501075_0106785 3300049591 Bacteria 2128
236 Ga0501076_0051422 3300049592 Bacteria 3262
237 Ga0501249_013649 3300049679 Bacteria 1728
238 Ga0501080_0011900 3300049742 Bacteria 7971
239 Ga0501080_0135408 3300049742 Bacteria 2280
240 Ga0501035_0010475 3300049822 Bacteria 8592
241 Ga0501044_0004495 3300049823 Bacteria 15597
242 Ga0501044_0024565 3300049823 Bacteria 6394
243 Ga0501045_0418377 3300049824 Bacteria 997
244 nmdc:mga0yw44_10872_c1 3300050492 Bacteria 4667
245 nmdc:mga0qj67_419724_c1 3300050509 Bacteria 1078
246 Ga0500562_023605 3300053108 Unclassified 1606
247 Ga0500636_0001491 3300053177 Bacteria 12728
248 Ga0500645_032106 3300053730 Bacteria 1576
249 Ga0501084_0480831 3300054114 Bacteria 1050
250 Ga0501082_0279058 3300060353 Bacteria 1454

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0846839 Ga0501034_0846839_55_774 237
2 3300046472 Ga0495580_0041524 Ga0495580_0041524_297_1103 244
3 3300005458 Ga0070681_10619539 Ga0070681_106195392 245
4 3300014325 Ga0163163_10004269 Ga0163163_1000426910 248
5 3300025927 Ga0207687_10223330 Ga0207687_102233301 248
6 iso_pu_bacteria 2547132374 2548496865 248
7 iso_pu_bacteria 2643221717 2644645631 248
8 3300053108 Ga0500562_023605 Ga0500562_023605_301_1056 249
9 3300035113 Ga0373936_0197131 Ga0373936_0197131_65_817 250
10 iso_pu_bacteria 2643221611 2644076526 250
11 3300049571 Ga0501034_0186307 Ga0501034_0186307_62_820 251
12 3300049581 Ga0501047_0380355 Ga0501047_0380355_305_1081 251
13 3300050492 nmdc:mga0yw44_10872_c1 nmdc:mga0yw44_10872_c1_2123_2899 251
14 iso_pu_bacteria 2883291878 2883294589 251
15 iso_pu_bacteria 2883354860 2883356909 251
16 3300005435 Ga0070714_100000045 Ga0070714_10000004555 252
17 3300005563 Ga0068855_100346599 Ga0068855_1003465992 252
18 3300009551 Ga0105238_10039748 Ga0105238_100397485 252
19 3300025929 Ga0207664_10000063 Ga0207664_1000006358 252
20 3300031548 Ga0307408_100000246 Ga0307408_10000024640 252
21 3300046455 Ga0495603_0070637 Ga0495603_0070637_1173_1937 252
22 3300046457 Ga0495590_0000271 Ga0495590_0000271_20726_21490 252
23 3300048905 Ga0496102_0002184 Ga0496102_0002184_3754_4518 252
24 iso_pu_bacteria 2842333319 2842333619 252
25 3300005436 Ga0070713_100086319 Ga0070713_1000863192 253
26 3300005437 Ga0070710_10060290 Ga0070710_100602902 253
27 3300025928 Ga0207700_10020173 Ga0207700_100201734 253
28 3300031824 Ga0307413_10027733 Ga0307413_100277332 253
29 3300032005 Ga0307411_10146511 Ga0307411_101465112 253
30 3300046471 Ga0495650_0009362 Ga0495650_0009362_2233_3087 253
31 3300049679 Ga0501249_013649 Ga0501249_013649_642_1583 253
32 3300053177 Ga0500636_0001491 Ga0500636_0001491_7012_7788 253
33 3300053730 Ga0500645_032106 Ga0500645_032106_261_1043 253
34 3300005327 Ga0070658_10009223 Ga0070658_100092238 254
35 3300005436 Ga0070713_100020619 Ga0070713_1000206194 254
36 3300005983 Ga0081540_1010968 Ga0081540_10109684 254
37 3300006048 Ga0075363_100024656 Ga0075363_1000246564 254
38 3300009094 Ga0111539_10478347 Ga0111539_104783471 254
39 3300013307 Ga0157372_10007620 Ga0157372_1000762010 254
40 3300021361 Ga0213872_10035427 Ga0213872_100354273 254
41 3300025909 Ga0207705_10185536 Ga0207705_101855362 254
42 3300025928 Ga0207700_10013364 Ga0207700_100133644 254
43 3300025939 Ga0207665_10061652 Ga0207665_100616523 254
44 3300025944 Ga0207661_10075352 Ga0207661_100753522 254
45 3300031250 Ga0265331_10024408 Ga0265331_100244084 254
46 3300035172 Ga0373955_0034756 Ga0373955_0034756_1378_2142 254
47 3300035724 Ga0373933_0030192 Ga0373933_0030192_1544_2308 254
48 3300035724 Ga0373933_0135442 Ga0373933_0135442_620_1384 254
49 3300036401 Ga0373937_0009862 Ga0373937_0009862_2294_3058 254
50 3300037312 Ga0395899_0000004 Ga0395899_0000004_415702_416481 254
51 3300039447 Ga0436361_0337408 Ga0436361_0337408_803_1582 254
52 3300039447 Ga0436361_0602835 Ga0436361_0602835_1184_1963 254
53 3300044656 Ga0466969_0134582 Ga0466969_0134582_224_1003 254
54 3300044684 Ga0466966_0175410 Ga0466966_0175410_229_1008 254
55 3300044693 Ga0466961_0318947 Ga0466961_0318947_41_805 254
56 3300047471 Ga0495684_0227770 Ga0495684_0227770_31_795 254
57 3300048929 Ga0496126_0004703 Ga0496126_0004703_13146_13910 254
58 3300048929 Ga0496126_0248051 Ga0496126_0248051_160_1023 254
59 3300005331 Ga0070670_100229609 Ga0070670_1002296092 255
60 3300006358 Ga0068871_100716908 Ga0068871_1007169081 255
61 3300013307 Ga0157372_10050167 Ga0157372_100501672 255
62 3300014326 Ga0157380_10213032 Ga0157380_102130322 255
63 3300025929 Ga0207664_10189800 Ga0207664_101898002 255
64 3300026078 Ga0207702_10016151 Ga0207702_100161512 255
65 3300028379 Ga0268266_10083486 Ga0268266_100834863 255
66 3300031548 Ga0307408_100073879 Ga0307408_1000738793 255
67 3300037853 Ga0436364_0975960 Ga0436364_0975960_147_914 255
68 3300045051 Ga0451576_0084200 Ga0451576_0084200_2295_3098 255
69 3300046477 Ga0495664_0082884 Ga0495664_0082884_239_1030 255
70 3300046678 Ga0495599_0041298 Ga0495599_0041298_1616_2389 255
71 3300049571 Ga0501034_0153923 Ga0501034_0153923_404_1171 255
72 3300049571 Ga0501034_0499643 Ga0501034_0499643_39_848 255
73 3300049574 Ga0501038_0144668 Ga0501038_0144668_581_1348 255
74 3300049578 Ga0501042_0358804 Ga0501042_0358804_20_817 255
75 3300049580 Ga0501046_0080458 Ga0501046_0080458_1246_2013 255
76 3300049581 Ga0501047_0007387 Ga0501047_0007387_3255_4022 255
77 3300049586 Ga0501070_0110832 Ga0501070_0110832_196_963 255
78 3300049742 Ga0501080_0011900 Ga0501080_0011900_1449_2258 255
79 3300049742 Ga0501080_0135408 Ga0501080_0135408_843_1610 255
80 3300049822 Ga0501035_0010475 Ga0501035_0010475_7733_8500 255
81 3300049823 Ga0501044_0004495 Ga0501044_0004495_8087_8854 255
82 3300049824 Ga0501045_0418377 Ga0501045_0418377_163_948 255
83 3300054114 Ga0501084_0480831 Ga0501084_0480831_146_943 255
84 3300060353 Ga0501082_0279058 Ga0501082_0279058_555_1364 255
85 3300005435 Ga0070714_100029855 Ga0070714_1000298553 256
86 3300005530 Ga0070679_100060088 Ga0070679_1000600882 256
87 3300005539 Ga0068853_100222026 Ga0068853_1002220262 256
88 3300005564 Ga0070664_100020249 Ga0070664_1000202492 256
89 3300005578 Ga0068854_100054806 Ga0068854_1000548062 256
90 3300005614 Ga0068856_100009987 Ga0068856_1000099873 256
91 3300005616 Ga0068852_100299022 Ga0068852_1002990222 256
92 3300005937 Ga0081455_10011682 Ga0081455_100116824 256
93 3300009174 Ga0105241_10048120 Ga0105241_100481203 256
94 3300013105 Ga0157369_10004856 Ga0157369_100048567 256
95 3300013105 Ga0157369_10127481 Ga0157369_101274813 256
96 3300013296 Ga0157374_10002262 Ga0157374_1000226210 256
97 3300013307 Ga0157372_10125128 Ga0157372_101251283 256
98 3300025928 Ga0207700_10559317 Ga0207700_105593171 256
99 3300025945 Ga0207679_10164982 Ga0207679_101649822 256
100 3300025981 Ga0207640_10255324 Ga0207640_102553242 256
101 3300026041 Ga0207639_10160066 Ga0207639_101600662 256
102 3300026067 Ga0207678_10427260 Ga0207678_104272601 256
103 3300026078 Ga0207702_10101520 Ga0207702_101015202 256
104 3300037853 Ga0436364_1099111 Ga0436364_1099111_187_957 256
105 3300048918 Ga0496115_0478058 Ga0496115_0478058_48_872 256
106 3300049572 Ga0501036_0192485 Ga0501036_0192485_869_1675 256
107 3300049577 Ga0501041_0046176 Ga0501041_0046176_1814_2620 256
108 3300049591 Ga0501075_0106785 Ga0501075_0106785_844_1650 256
109 3300049592 Ga0501076_0051422 Ga0501076_0051422_2419_3225 256
110 3300050509 nmdc:mga0qj67_419724_c1 nmdc:mga0qj67_419724_c1_217_993 256
111 3300005327 Ga0070658_10732224 Ga0070658_107322241 257
112 3300005339 Ga0070660_100446131 Ga0070660_1004461311 257
113 3300005344 Ga0070661_100017337 Ga0070661_1000173374 257
114 3300005366 Ga0070659_100055612 Ga0070659_1000556122 257
115 3300005455 Ga0070663_100146523 Ga0070663_1001465232 257
116 3300005535 Ga0070684_100422627 Ga0070684_1004226272 257
117 3300005539 Ga0068853_100036677 Ga0068853_1000366773 257
118 3300005563 Ga0068855_100025507 Ga0068855_1000255074 257
119 3300005563 Ga0068855_100109588 Ga0068855_1001095884 257
120 3300005563 Ga0068855_100643009 Ga0068855_1006430092 257
121 3300005614 Ga0068856_100032995 Ga0068856_1000329952 257
122 3300005614 Ga0068856_100122607 Ga0068856_1001226073 257
123 3300006028 Ga0070717_10016992 Ga0070717_100169924 257
124 3300009093 Ga0105240_10001119 Ga0105240_1000111923 257
125 3300009093 Ga0105240_10055245 Ga0105240_100552452 257
126 3300009174 Ga0105241_10000377 Ga0105241_1000037712 257
127 3300009174 Ga0105241_10152984 Ga0105241_101529842 257
128 3300009174 Ga0105241_10276147 Ga0105241_102761472 257
129 3300009545 Ga0105237_10001489 Ga0105237_1000148913 257
130 3300009551 Ga0105238_10001123 Ga0105238_1000112312 257
131 3300009551 Ga0105238_10065567 Ga0105238_100655673 257
132 3300010375 Ga0105239_10000731 Ga0105239_1000073122 257
133 3300013100 Ga0157373_10217321 Ga0157373_102173211 257
134 3300013105 Ga0157369_10000651 Ga0157369_1000065112 257
135 3300013105 Ga0157369_10013306 Ga0157369_100133062 257
136 3300013105 Ga0157369_10289333 Ga0157369_102893333 257
137 3300013296 Ga0157374_10106095 Ga0157374_101060954 257
138 3300013296 Ga0157374_10415599 Ga0157374_104155992 257
139 3300013307 Ga0157372_10002502 Ga0157372_1000250214 257
140 3300013307 Ga0157372_10046699 Ga0157372_100466993 257
141 3300013307 Ga0157372_10095555 Ga0157372_100955554 257
142 3300021388 Ga0213875_10000005 Ga0213875_10000005281 257
143 3300021388 Ga0213875_10000024 Ga0213875_10000024108 257
144 3300025911 Ga0207654_10000196 Ga0207654_100001962 257
145 3300025911 Ga0207654_10343442 Ga0207654_103434422 257
146 3300025913 Ga0207695_10000166 Ga0207695_1000016682 257
147 3300025913 Ga0207695_10056657 Ga0207695_100566571 257
148 3300025914 Ga0207671_10000679 Ga0207671_100006795 257
149 3300025919 Ga0207657_10282733 Ga0207657_102827332 257
150 3300025924 Ga0207694_10000123 Ga0207694_1000012313 257
151 3300025924 Ga0207694_10020773 Ga0207694_100207737 257
152 3300025929 Ga0207664_10144944 Ga0207664_101449443 257
153 3300025932 Ga0207690_10033451 Ga0207690_100334514 257
154 3300025933 Ga0207706_10671153 Ga0207706_106711531 257
155 3300025949 Ga0207667_10019438 Ga0207667_100194382 257
156 3300025949 Ga0207667_10369284 Ga0207667_103692842 257
157 3300026041 Ga0207639_10000314 Ga0207639_100003142 257
158 3300026078 Ga0207702_10029527 Ga0207702_100295272 257
159 3300026078 Ga0207702_10196327 Ga0207702_101963273 257
160 3300026142 Ga0207698_10000205 Ga0207698_100002052 257
161 3300037853 Ga0436364_0157811 Ga0436364_0157811_264987_265760 257
162 3300037853 Ga0436364_0583704 Ga0436364_0583704_147_941 257
163 3300037853 Ga0436364_1265330 Ga0436364_1265330_10288_11070 257
164 3300039437 Ga0436365_0373401 Ga0436365_0373401_77_871 257
165 3300039437 Ga0436365_1264407 Ga0436365_1264407_22_819 257
166 3300048915 Ga0496112_0020542 Ga0496112_0020542_2316_3095 257
167 3300049823 Ga0501044_0024565 Ga0501044_0024565_946_1725 257
168 3300005295 Ga0065707_10436364 Ga0065707_104363641 258
169 3300005334 Ga0068869_100008959 Ga0068869_1000089594 258
170 3300005436 Ga0070713_100001859 Ga0070713_10000185914 258
171 3300005436 Ga0070713_100008082 Ga0070713_1000080825 258
172 3300005437 Ga0070710_10035820 Ga0070710_100358202 258
173 3300005437 Ga0070710_10044859 Ga0070710_100448593 258
174 3300005445 Ga0070708_100037709 Ga0070708_1000377094 258
175 3300005456 Ga0070678_100103426 Ga0070678_1001034263 258
176 3300005467 Ga0070706_100075306 Ga0070706_1000753062 258
177 3300005518 Ga0070699_100346948 Ga0070699_1003469481 258
178 3300005548 Ga0070665_100151308 Ga0070665_1001513082 258
179 3300005614 Ga0068856_100046762 Ga0068856_1000467624 258
180 3300005614 Ga0068856_100206549 Ga0068856_1002065492 258
181 3300005844 Ga0068862_100202797 Ga0068862_1002027972 258
182 3300006028 Ga0070717_10011295 Ga0070717_100112959 258
183 3300006175 Ga0070712_100003711 Ga0070712_1000037112 258
184 3300006175 Ga0070712_100009068 Ga0070712_1000090685 258
185 3300006175 Ga0070712_100009655 Ga0070712_1000096553 258
186 3300006237 Ga0097621_100006834 Ga0097621_1000068346 258
187 3300009098 Ga0105245_10556048 Ga0105245_105560481 258
188 3300009174 Ga0105241_10005768 Ga0105241_100057685 258
189 3300009553 Ga0105249_10244871 Ga0105249_102448712 258
190 3300013100 Ga0157373_10065121 Ga0157373_100651212 258
191 3300013296 Ga0157374_10026585 Ga0157374_100265854 258
192 3300013296 Ga0157374_10030643 Ga0157374_100306433 258
193 3300013297 Ga0157378_10026929 Ga0157378_100269298 258
194 3300013306 Ga0163162_10035337 Ga0163162_100353374 258
195 3300013306 Ga0163162_10445838 Ga0163162_104458382 258
196 3300014969 Ga0157376_10246840 Ga0157376_102468401 258
197 3300015262 Ga0182007_10061806 Ga0182007_100618061 258
198 3300025900 Ga0207710_10202937 Ga0207710_102029371 258
199 3300025905 Ga0207685_10010448 Ga0207685_100104483 258
200 3300025906 Ga0207699_10013797 Ga0207699_100137977 258
201 3300025910 Ga0207684_10063136 Ga0207684_100631362 258
202 3300025910 Ga0207684_10242708 Ga0207684_102427081 258
203 3300025913 Ga0207695_10267149 Ga0207695_102671492 258
204 3300025915 Ga0207693_10003635 Ga0207693_100036357 258
205 3300025915 Ga0207693_10011162 Ga0207693_100111622 258
206 3300025915 Ga0207693_10021904 Ga0207693_100219047 258
207 3300025919 Ga0207657_10226378 Ga0207657_102263783 258
208 3300025928 Ga0207700_10002788 Ga0207700_100027885 258
209 3300025928 Ga0207700_10013302 Ga0207700_100133026 258
210 3300025928 Ga0207700_10616028 Ga0207700_106160281 258
211 3300025929 Ga0207664_10044859 Ga0207664_100448592 258
212 3300025961 Ga0207712_10188237 Ga0207712_101882372 258
213 3300026088 Ga0207641_10371832 Ga0207641_103718321 258
214 3300026121 Ga0207683_10201190 Ga0207683_102011901 258
215 3300028017 Ga0265356_1004405 Ga0265356_10044053 258
216 3300028379 Ga0268266_10108806 Ga0268266_101088062 258
217 3300028800 Ga0265338_10058777 Ga0265338_100587775 258
218 3300031090 Ga0265760_10054931 Ga0265760_100549311 258
219 3300031235 Ga0265330_10119627 Ga0265330_101196271 258
220 3300031711 Ga0265314_10020945 Ga0265314_100209455 258
221 3300035172 Ga0373955_0032638 Ga0373955_0032638_1047_1826 258
222 3300035172 Ga0373955_0041699 Ga0373955_0041699_235_1011 258
223 3300035725 Ga0373947_0100790 Ga0373947_0100790_785_1582 258
224 3300036401 Ga0373937_0014538 Ga0373937_0014538_2379_3158 258
225 3300036401 Ga0373937_0611666 Ga0373937_0611666_84_860 258
226 3300037068 Ga0373925_0002359 Ga0373925_0002359_2967_3764 258
227 3300037853 Ga0436364_0940415 Ga0436364_0940415_1697_2521 258
228 3300039437 Ga0436365_1373190 Ga0436365_1373190_267_1043 258
229 3300039447 Ga0436361_0755581 Ga0436361_0755581_96_872 258
230 3300046472 Ga0495580_0000012 Ga0495580_0000012_92215_93012 258
231 3300046517 Ga0495630_0365468 Ga0495630_0365468_29_805 258
232 3300046683 Ga0495658_0017203 Ga0495658_0017203_2844_3641 258
233 3300047319 Ga0495674_0540017 Ga0495674_0540017_131_907 258
234 3300048907 Ga0496104_0262965 Ga0496104_0262965_158_934 258
235 3300048910 Ga0496107_0157023 Ga0496107_0157023_185_961 258
236 3300048914 Ga0496111_0236804 Ga0496111_0236804_514_1296 258
237 3300005331 Ga0070670_100067499 Ga0070670_1000674994 259
238 3300003323 rootH1_10279507 rootH1_102795072 261
239 3300006358 Ga0068871_100007507 Ga0068871_1000075073 261
240 3300009093 Ga0105240_10006086 Ga0105240_1000608624 261
241 3300009545 Ga0105237_10097833 Ga0105237_100978332 261
242 3300009551 Ga0105238_10033162 Ga0105238_100331625 261
243 3300009551 Ga0105238_10153058 Ga0105238_101530584 261
244 3300013100 Ga0157373_10301158 Ga0157373_103011582 261
245 3300013296 Ga0157374_10056584 Ga0157374_100565844 261
246 3300013307 Ga0157372_10002826 Ga0157372_1000282624 261
247 3300014325 Ga0163163_10475223 Ga0163163_104752232 261
248 3300014969 Ga0157376_10012757 Ga0157376_100127573 261
249 3300025911 Ga0207654_10010421 Ga0207654_100104213 261
250 3300025913 Ga0207695_10137419 Ga0207695_101374193 261
251 3300025914 Ga0207671_10017966 Ga0207671_100179664 261
252 3300035692 Ga0373935_0179324 Ga0373935_0179324_575_1360 261
253 3300037068 Ga0373925_0057738 Ga0373925_0057738_77_862 261
254 3300048903 Ga0496100_0006276 Ga0496100_0006276_5230_6015 261
255 3300048904 Ga0496101_0069910 Ga0496101_0069910_710_1495 261
256 3300048908 Ga0496105_0083452 Ga0496105_0083452_843_1628 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

55

297

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9598 5 259
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9525 5 259
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9512 5 259
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9421 5 260
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9405 5 259
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.964 5 259 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9563 5 259 3.60.10.10
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9533 5 257 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.953 5 259 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9393 5 260 3.60.10.10

Feature Viewer

pLDDT pTM Quality
95.45 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map