F366364

General Info

Members Datasets Scaffolds Average Seq Length
256 143 512 275

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10399152|Ga0070717_103991522
Length 284
Sequence VRVRLPTLRKQSAVALGDLEELHTRSQRTALVRVVLALALVGTLALLYQAARSAGAGRAAVFPEGTSTGVVSLDMSASISGPTYARVATTLRGIVNANQSIGLVMFSDSAYELLPPNSPPGALLQFIPFFTPLRYYGGTPVFAQTPWDTFSGGTKASSGLDMARKALIRAKVRHGAILIVSDLDDASSDQGALANEALLLRTEHIPVRIVPLFAAPVDVRLFAALFGQDAFVDPSVFTHTAKRHAAAVAAPAPWELLLFGGLLIVLLAGNERWNGRLEVEGVTA

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
54 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.86
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 8.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10399152 3300006028 Unclassified 1235
2 rootH2_10099477 3300003320 Bacteria 1534
3 Ga0070658_10027625 3300005327 Bacteria 4552
4 Ga0070658_10032298 3300005327 Bacteria 4209
5 Ga0070658_10133081 3300005327 Bacteria 2073
6 Ga0070658_10146036 3300005327 Bacteria 1978
7 Ga0070683_100047266 3300005329 Bacteria 3976
8 Ga0070680_100075838 3300005336 Bacteria 2768
9 Ga0070680_100323633 3300005336 Bacteria 1309
10 Ga0070682_100367088 3300005337 Bacteria 1078
11 Ga0070660_100005522 3300005339 Bacteria 8760
12 Ga0070660_100017032 3300005339 Bacteria 5289
13 Ga0070660_100309938 3300005339 Bacteria 1295
14 Ga0070661_100052216 3300005344 Bacteria 2992
15 Ga0070659_100106935 3300005366 Bacteria 2255
16 Ga0070709_10050740 3300005434 Bacteria 2600
17 Ga0070714_100004524 3300005435 Bacteria 10479
18 Ga0070714_100026582 3300005435 Bacteria 4784
19 Ga0070714_100056636 3300005435 Bacteria 3354
20 Ga0070714_100075038 3300005435 Bacteria 2933
21 Ga0070713_100020524 3300005436 Bacteria 5067
22 Ga0070710_10007856 3300005437 Bacteria 5179
23 Ga0070711_100292972 3300005439 Bacteria 1291
24 Ga0070681_10024312 3300005458 Bacteria 6098
25 Ga0070681_10155624 3300005458 Bacteria 2211
26 Ga0070707_100614052 3300005468 Unclassified 1050
27 Ga0070698_100123543 3300005471 Bacteria 2546
28 Ga0070698_100144059 3300005471 Bacteria 2333
29 Ga0070679_100066283 3300005530 Bacteria 3599
30 Ga0070679_100177462 3300005530 Bacteria 2103
31 Ga0070679_100200862 3300005530 Bacteria 1960
32 Ga0070679_100395403 3300005530 Bacteria 1328
33 Ga0070684_100104634 3300005535 Bacteria 2532
34 Ga0070695_100080406 3300005545 Bacteria 2154
35 Ga0068855_100033156 3300005563 Bacteria 6165
36 Ga0068855_100071900 3300005563 Bacteria 4021
37 Ga0068856_100580612 3300005614 Bacteria 1142
38 Ga0068852_100233329 3300005616 Bacteria 1755
39 Ga0070717_10032960 3300006028 Bacteria 4177
40 Ga0070717_10071990 3300006028 Bacteria 2885
41 Ga0070716_100250871 3300006173 Bacteria 1206
42 Ga0075436_100072964 3300006914 Bacteria 2375
43 Ga0105240_10014437 3300009093 Bacteria 10785
44 Ga0105240_10170023 3300009093 Bacteria 2582
45 Ga0157370_10011996 3300013104 Bacteria 9028
46 Ga0157370_10015958 3300013104 Bacteria 7621
47 Ga0157370_10198938 3300013104 Bacteria 1859
48 Ga0157370_10268076 3300013104 Bacteria 1578
49 Ga0157369_10018844 3300013105 Bacteria 7733
50 Ga0157369_10033003 3300013105 Bacteria 5690
51 Ga0157369_10047116 3300013105 Bacteria 4683
52 Ga0157369_10083477 3300013105 Unclassified 3417
53 Ga0157369_10217685 3300013105 Bacteria 2000
54 Ga0157372_10140543 3300013307 Bacteria 2781
55 Ga0157372_10497585 3300013307 Unclassified 1421
56 Ga0182008_10008297 3300014497 Bacteria 5676
57 Ga0182006_1019929 3300015261 Bacteria 2816
58 Ga0197907_10320177 3300020069 Bacteria 1324
59 Ga0206356_10309015 3300020070 Bacteria 4058
60 Ga0206354_11211303 3300020081 Bacteria 1787
61 Ga0206354_11619780 3300020081 Bacteria 2351
62 Ga0206353_11631854 3300020082 Unclassified 1235
63 Ga0207692_10008495 3300025898 Bacteria 4250
64 Ga0207699_10038449 3300025906 Bacteria 2742
65 Ga0207699_10120914 3300025906 Bacteria 1693
66 Ga0207705_10018662 3300025909 Bacteria 4961
67 Ga0207705_10072799 3300025909 Bacteria 2493
68 Ga0207705_10181274 3300025909 Unclassified 1589
69 Ga0207707_10126699 3300025912 Bacteria 2233
70 Ga0207695_10115796 3300025913 Bacteria 2655
71 Ga0207695_10129382 3300025913 Bacteria 2483
72 Ga0207693_10003137 3300025915 Bacteria 14210
73 Ga0207693_10388222 3300025915 Bacteria 1092
74 Ga0207660_10140234 3300025917 Unclassified 1848
75 Ga0207657_10003817 3300025919 Bacteria 16014
76 Ga0207657_10004902 3300025919 Bacteria 14074
77 Ga0207657_10007726 3300025919 Bacteria 10982
78 Ga0207657_10035319 3300025919 Bacteria 4484
79 Ga0207649_10037883 3300025920 Bacteria 2916
80 Ga0207649_10124553 3300025920 Bacteria 1742
81 Ga0207652_10094933 3300025921 Unclassified 2627
82 Ga0207652_10122018 3300025921 Bacteria 2319
83 Ga0207652_10187044 3300025921 Bacteria 1862
84 Ga0207664_10007120 3300025929 Bacteria 7754
85 Ga0207664_10023630 3300025929 Bacteria 4608
86 Ga0207664_10033568 3300025929 Bacteria 3943
87 Ga0207664_10062751 3300025929 Unclassified 2968
88 Ga0207664_10098915 3300025929 Bacteria 2406
89 Ga0207665_10219848 3300025939 Bacteria 1392
90 Ga0207661_10032026 3300025944 Bacteria 4069
91 Ga0207661_10519707 3300025944 Bacteria 1089
92 Ga0207667_10187314 3300025949 Unclassified 2124
93 Ga0207667_10200853 3300025949 Bacteria 2045
94 Ga0207639_10246949 3300026041 Unclassified 1555
95 Ga0207639_10533848 3300026041 Bacteria 1075
96 Ga0207702_10567532 3300026078 Bacteria 1111
97 Ga0207698_10163651 3300026142 Unclassified 1949
98 Ga0207698_10749107 3300026142 Bacteria 975
99 Ga0265337_1020581 3300028556 Bacteria 2066
100 Ga0265319_1000329 3300028563 Bacteria 34971
101 Ga0265319_1008096 3300028563 Bacteria 4642
102 Ga0265318_10003884 3300028577 Bacteria 7377
103 Ga0265322_10007489 3300028654 Bacteria 3186
104 Ga0265338_10000705 3300028800 Bacteria 57138
105 Ga0265338_10009048 3300028800 Bacteria 11977
106 Ga0265338_10014823 3300028800 Bacteria 8626
107 Ga0265338_10017004 3300028800 Bacteria 7868
108 Ga0265338_10074371 3300028800 Bacteria 2890
109 Ga0265338_10162351 3300028800 Unclassified 1724
110 Ga0265330_10065420 3300031235 Bacteria 1578
111 Ga0265320_10050949 3300031240 Bacteria 2010
112 Ga0265320_10199137 3300031240 Bacteria 894
113 Ga0265325_10003644 3300031241 Bacteria 9994
114 Ga0265325_10030359 3300031241 Bacteria 2899
115 Ga0265325_10053313 3300031241 Bacteria 2074
116 Ga0265329_10005056 3300031242 Bacteria 5383
117 Ga0265340_10058431 3300031247 Bacteria 1852
118 Ga0265340_10081000 3300031247 Bacteria 1528
119 Ga0265331_10071856 3300031250 Unclassified 1617
120 Ga0265331_10072981 3300031250 Bacteria 1603
121 Ga0265327_10014252 3300031251 Bacteria 5209
122 Ga0265327_10015067 3300031251 Bacteria 5018
123 Ga0265327_10117790 3300031251 Bacteria 1262
124 Ga0265316_10050932 3300031344 Bacteria 3254
125 Ga0265313_10007116 3300031595 Bacteria 7713
126 Ga0265313_10033206 3300031595 Bacteria 2626
127 Ga0265313_10035742 3300031595 Bacteria 2499
128 Ga0265314_10014927 3300031711 Bacteria 6187
129 Ga0265314_10017982 3300031711 Bacteria 5531
130 Ga0265314_10018190 3300031711 Bacteria 5487
131 Ga0265342_10078862 3300031712 Bacteria 1905
132 Ga0265342_10157248 3300031712 Bacteria 1258
133 Ga0265342_10250307 3300031712 Bacteria 946
134 Ga0373934_0134116 3300035086 Bacteria 1010
135 Ga0373955_0019206 3300035172 Bacteria 3412
136 Ga0373933_0037705 3300035724 Bacteria 2837
137 Ga0373933_0280150 3300035724 Bacteria 1077
138 Ga0373937_0001027 3300036401 Bacteria 23612
139 Ga0373937_0007398 3300036401 Bacteria 9500
140 Ga0395899_0148519 3300037312 Bacteria 1662
141 Ga0395899_0230854 3300037312 Bacteria 1278
142 Ga0395900_0508662 3300037418 Bacteria 1154
143 Ga0395898_0058949 3300037466 Bacteria 3736
144 Ga0395898_0178330 3300037466 Bacteria 2030
145 Ga0395898_0376112 3300037466 Bacteria 1355
146 Ga0395905_0070967 3300037471 Bacteria 3265
147 Ga0395901_0435051 3300038443 Bacteria 1344
148 Ga0395901_0716177 3300038443 Bacteria 997
149 Ga0436360_0577753 3300039438 Unclassified 1685
150 Ga0436360_0955524 3300039438 Bacteria 5336
151 Ga0466972_0063053 3300044658 Bacteria 1776
152 Ga0466966_0015781 3300044684 Bacteria 4992
153 Ga0466963_0003253 3300044694 Bacteria 9260
154 Ga0466963_0006007 3300044694 Bacteria 7156
155 Ga0466963_0040685 3300044694 Bacteria 3047
156 Ga0466963_0147013 3300044694 Bacteria 1635
157 Ga0466963_0300017 3300044694 Bacteria 1130
158 Ga0466964_0009785 3300044706 Bacteria 3612
159 Ga0466971_0098505 3300044719 Unclassified 1342
160 Ga0466971_0107162 3300044719 Unclassified 1288
161 Ga0466957_0027157 3300044842 Bacteria 3400
162 Ga0466957_0089755 3300044842 Bacteria 1924
163 Ga0466957_0427490 3300044842 Bacteria 909
164 Ga0466960_0189703 3300044901 Bacteria 1118
165 Ga0466958_0016734 3300045836 Bacteria 4228
166 Ga0466958_0040010 3300045836 Bacteria 2818
167 Ga0466958_0084227 3300045836 Bacteria 1960
168 Ga0466967_0000990 3300045976 Bacteria 15466
169 Ga0466967_0001633 3300045976 Bacteria 13232
170 Ga0466967_0012376 3300045976 Bacteria 6521
171 Ga0466967_0020284 3300045976 Bacteria 5367
172 Ga0466967_0020860 3300045976 Bacteria 5308
173 Ga0466967_0035920 3300045976 Bacteria 4224
174 Ga0466967_0042964 3300045976 Bacteria 3911
175 Ga0466967_0098941 3300045976 Bacteria 2663
176 Ga0466967_0130299 3300045976 Bacteria 2334
177 Ga0466967_0209138 3300045976 Bacteria 1850
178 Ga0466967_0489515 3300045976 Bacteria 1206
179 Ga0495592_0000314 3300046454 Bacteria 40742
180 Ga0495592_0243622 3300046454 Bacteria 1192
181 Ga0495651_0000258 3300046462 Bacteria 41081
182 Ga0495651_0100091 3300046462 Bacteria 2160
183 Ga0495653_0007739 3300046463 Bacteria 8793
184 Ga0495653_0164652 3300046463 Bacteria 1536
185 Ga0495639_0133003 3300046475 Bacteria 1192
186 Ga0495608_0002507 3300046511 Bacteria 13170
187 Ga0495608_0014685 3300046511 Bacteria 5433
188 Ga0495608_0034711 3300046511 Bacteria 3404
189 Ga0495618_0002370 3300046514 Bacteria 12147
190 Ga0495618_0120549 3300046514 Unclassified 1680
191 Ga0495628_0000585 3300046516 Bacteria 33544
192 Ga0495630_0256151 3300046517 Bacteria 1337
193 Ga0495630_0324197 3300046517 Bacteria 1178
194 Ga0495652_0000187 3300046529 Bacteria 70410
195 Ga0495652_0098073 3300046529 Bacteria 2383
196 Ga0495640_0006450 3300046533 Bacteria 9276
197 Ga0495640_0429465 3300046533 Bacteria 809
198 Ga0495587_0000366 3300046536 Bacteria 32329
199 Ga0495645_0000103 3300046543 Bacteria 58974
200 Ga0495667_0051444 3300046559 Bacteria 2718
201 Ga0495635_0041053 3300046663 Bacteria 3197
202 Ga0495635_0204614 3300046663 Bacteria 1338
203 Ga0495657_0004349 3300046675 Bacteria 11311
204 Ga0495657_0015237 3300046675 Bacteria 5628
205 Ga0495599_0000196 3300046678 Bacteria 40261
206 Ga0495623_0000045 3300046679 Bacteria 76108
207 Ga0495646_0000489 3300046680 Bacteria 21129
208 Ga0495647_0047244 3300046681 Unclassified 1660
209 Ga0495613_0189537 3300046689 Bacteria 1454
210 Ga0495613_0198701 3300046689 Unclassified 1414
211 Ga0495624_0018017 3300046690 Bacteria 4729
212 Ga0495600_0039402 3300046809 Bacteria 3077
213 Ga0495604_0000221 3300047317 Bacteria 52090
214 Ga0495604_0115461 3300047317 Bacteria 1951
215 Ga0495674_0008383 3300047319 Bacteria 9849
216 Ga0495680_0004558 3300047322 Bacteria 13232
217 Ga0495680_0004834 3300047322 Bacteria 12788
218 Ga0495680_0074718 3300047322 Bacteria 2573
219 Ga0495675_0000936 3300047444 Bacteria 17725
220 Ga0495684_0037694 3300047471 Bacteria 3708
221 Ga0495684_0221730 3300047471 Bacteria 1386
222 Ga0495602_0003311 3300048088 Bacteria 16637
223 Ga0496102_0468041 3300048905 Bacteria 1181
224 Ga0496103_0335175 3300048906 Bacteria 973
225 Ga0496104_0289104 3300048907 Bacteria 1551
226 Ga0496105_0022881 3300048908 Bacteria 5065
227 Ga0496106_0002296 3300048909 Bacteria 14265
228 Ga0496107_0009941 3300048910 Bacteria 6601
229 Ga0496109_0350242 3300048912 Bacteria 1395
230 Ga0496110_0024474 3300048913 Bacteria 5146
231 Ga0496111_0197607 3300048914 Bacteria 1495
232 Ga0496112_0002608 3300048915 Bacteria 14552
233 Ga0496112_0157316 3300048915 Unclassified 2239
234 Ga0496112_0396475 3300048915 Bacteria 1320
235 Ga0496114_0011046 3300048917 Bacteria 7204
236 Ga0496115_0205798 3300048918 Bacteria 1625
237 Ga0496115_0532524 3300048918 Unclassified 941
238 Ga0501067_0079303 3300049583 Bacteria 1819
239 Ga0501069_0022128 3300049585 Bacteria 3455
240 Ga0501069_0253619 3300049585 Bacteria 1026
241 Ga0501070_0006050 3300049586 Bacteria 10307
242 Ga0501070_0010675 3300049586 Bacteria 7766
243 Ga0501072_0024500 3300049588 Bacteria 4694
244 Ga0501073_0014392 3300049589 Bacteria 5749
245 Ga0501073_0031203 3300049589 Bacteria 3802
246 Ga0501074_0011676 3300049590 Bacteria 6383
247 Ga0501079_0012464 3300049741 Bacteria 6489
248 Ga0501080_0034166 3300049742 Bacteria 4746
249 Ga0501083_0002494 3300049744 Bacteria 12625
250 Ga0501044_0635348 3300049823 Unclassified 958
251 Ga0495601_0000150 3300053077 Bacteria 39214
252 Ga0495595_0011381 3300053084 Bacteria 3718
253 Ga0495619_0002326 3300053085 Bacteria 12511
254 Ga0501084_0110472 3300054114 Bacteria 2310
255 Ga0501082_0157775 3300060353 Bacteria 1971
256 Ga0530510_0036522 3300061734 Bacteria 3542
257 Ga0070717_10399152
258 rootH2_10099477
259 Ga0070658_10027625
260 Ga0070658_10032298
261 Ga0070658_10133081
262 Ga0070658_10146036
263 Ga0070683_100047266
264 Ga0070680_100075838
265 Ga0070680_100323633
266 Ga0070682_100367088
267 Ga0070660_100005522
268 Ga0070660_100017032
269 Ga0070660_100309938
270 Ga0070661_100052216
271 Ga0070659_100106935
272 Ga0070709_10050740
273 Ga0070714_100004524
274 Ga0070714_100026582
275 Ga0070714_100056636
276 Ga0070714_100075038
277 Ga0070713_100020524
278 Ga0070710_10007856
279 Ga0070711_100292972
280 Ga0070681_10024312
281 Ga0070681_10155624
282 Ga0070707_100614052
283 Ga0070698_100123543
284 Ga0070698_100144059
285 Ga0070679_100066283
286 Ga0070679_100177462
287 Ga0070679_100200862
288 Ga0070679_100395403
289 Ga0070684_100104634
290 Ga0070695_100080406
291 Ga0068855_100033156
292 Ga0068855_100071900
293 Ga0068856_100580612
294 Ga0068852_100233329
295 Ga0070717_10032960
296 Ga0070717_10071990
297 Ga0070716_100250871
298 Ga0075436_100072964
299 Ga0105240_10014437
300 Ga0105240_10170023
301 Ga0157370_10011996
302 Ga0157370_10015958
303 Ga0157370_10198938
304 Ga0157370_10268076
305 Ga0157369_10018844
306 Ga0157369_10033003
307 Ga0157369_10047116
308 Ga0157369_10083477
309 Ga0157369_10217685
310 Ga0157372_10140543
311 Ga0157372_10497585
312 Ga0182008_10008297
313 Ga0182006_1019929
314 Ga0197907_10320177
315 Ga0206356_10309015
316 Ga0206354_11211303
317 Ga0206354_11619780
318 Ga0206353_11631854
319 Ga0207692_10008495
320 Ga0207699_10038449
321 Ga0207699_10120914
322 Ga0207705_10018662
323 Ga0207705_10072799
324 Ga0207705_10181274
325 Ga0207707_10126699
326 Ga0207695_10115796
327 Ga0207695_10129382
328 Ga0207693_10003137
329 Ga0207693_10388222
330 Ga0207660_10140234
331 Ga0207657_10003817
332 Ga0207657_10004902
333 Ga0207657_10007726
334 Ga0207657_10035319
335 Ga0207649_10037883
336 Ga0207649_10124553
337 Ga0207652_10094933
338 Ga0207652_10122018
339 Ga0207652_10187044
340 Ga0207664_10007120
341 Ga0207664_10023630
342 Ga0207664_10033568
343 Ga0207664_10062751
344 Ga0207664_10098915
345 Ga0207665_10219848
346 Ga0207661_10032026
347 Ga0207661_10519707
348 Ga0207667_10187314
349 Ga0207667_10200853
350 Ga0207639_10246949
351 Ga0207639_10533848
352 Ga0207702_10567532
353 Ga0207698_10163651
354 Ga0207698_10749107
355 Ga0265337_1020581
356 Ga0265319_1000329
357 Ga0265319_1008096
358 Ga0265318_10003884
359 Ga0265322_10007489
360 Ga0265338_10000705
361 Ga0265338_10009048
362 Ga0265338_10014823
363 Ga0265338_10017004
364 Ga0265338_10074371
365 Ga0265338_10162351
366 Ga0265330_10065420
367 Ga0265320_10050949
368 Ga0265320_10199137
369 Ga0265325_10003644
370 Ga0265325_10030359
371 Ga0265325_10053313
372 Ga0265329_10005056
373 Ga0265340_10058431
374 Ga0265340_10081000
375 Ga0265331_10071856
376 Ga0265331_10072981
377 Ga0265327_10014252
378 Ga0265327_10015067
379 Ga0265327_10117790
380 Ga0265316_10050932
381 Ga0265313_10007116
382 Ga0265313_10033206
383 Ga0265313_10035742
384 Ga0265314_10014927
385 Ga0265314_10017982
386 Ga0265314_10018190
387 Ga0265342_10078862
388 Ga0265342_10157248
389 Ga0265342_10250307
390 Ga0373934_0134116
391 Ga0373955_0019206
392 Ga0373933_0037705
393 Ga0373933_0280150
394 Ga0373937_0001027
395 Ga0373937_0007398
396 Ga0395899_0148519
397 Ga0395899_0230854
398 Ga0395900_0508662
399 Ga0395898_0058949
400 Ga0395898_0178330
401 Ga0395898_0376112
402 Ga0395905_0070967
403 Ga0395901_0435051
404 Ga0395901_0716177
405 Ga0436360_0577753
406 Ga0436360_0955524
407 Ga0466972_0063053
408 Ga0466966_0015781
409 Ga0466963_0003253
410 Ga0466963_0006007
411 Ga0466963_0040685
412 Ga0466963_0147013
413 Ga0466963_0300017
414 Ga0466964_0009785
415 Ga0466971_0098505
416 Ga0466971_0107162
417 Ga0466957_0027157
418 Ga0466957_0089755
419 Ga0466957_0427490
420 Ga0466960_0189703
421 Ga0466958_0016734
422 Ga0466958_0040010
423 Ga0466958_0084227
424 Ga0466967_0000990
425 Ga0466967_0001633
426 Ga0466967_0012376
427 Ga0466967_0020284
428 Ga0466967_0020860
429 Ga0466967_0035920
430 Ga0466967_0042964
431 Ga0466967_0098941
432 Ga0466967_0130299
433 Ga0466967_0209138
434 Ga0466967_0489515
435 Ga0495592_0000314
436 Ga0495592_0243622
437 Ga0495651_0000258
438 Ga0495651_0100091
439 Ga0495653_0007739
440 Ga0495653_0164652
441 Ga0495639_0133003
442 Ga0495608_0002507
443 Ga0495608_0014685
444 Ga0495608_0034711
445 Ga0495618_0002370
446 Ga0495618_0120549
447 Ga0495628_0000585
448 Ga0495630_0256151
449 Ga0495630_0324197
450 Ga0495652_0000187
451 Ga0495652_0098073
452 Ga0495640_0006450
453 Ga0495640_0429465
454 Ga0495587_0000366
455 Ga0495645_0000103
456 Ga0495667_0051444
457 Ga0495635_0041053
458 Ga0495635_0204614
459 Ga0495657_0004349
460 Ga0495657_0015237
461 Ga0495599_0000196
462 Ga0495623_0000045
463 Ga0495646_0000489
464 Ga0495647_0047244
465 Ga0495613_0189537
466 Ga0495613_0198701
467 Ga0495624_0018017
468 Ga0495600_0039402
469 Ga0495604_0000221
470 Ga0495604_0115461
471 Ga0495674_0008383
472 Ga0495680_0004558
473 Ga0495680_0004834
474 Ga0495680_0074718
475 Ga0495675_0000936
476 Ga0495684_0037694
477 Ga0495684_0221730
478 Ga0495602_0003311
479 Ga0496102_0468041
480 Ga0496103_0335175
481 Ga0496104_0289104
482 Ga0496105_0022881
483 Ga0496106_0002296
484 Ga0496107_0009941
485 Ga0496109_0350242
486 Ga0496110_0024474
487 Ga0496111_0197607
488 Ga0496112_0002608
489 Ga0496112_0157316
490 Ga0496112_0396475
491 Ga0496114_0011046
492 Ga0496115_0205798
493 Ga0496115_0532524
494 Ga0501067_0079303
495 Ga0501069_0022128
496 Ga0501069_0253619
497 Ga0501070_0006050
498 Ga0501070_0010675
499 Ga0501072_0024500
500 Ga0501073_0014392
501 Ga0501073_0031203
502 Ga0501074_0011676
503 Ga0501079_0012464
504 Ga0501080_0034166
505 Ga0501083_0002494
506 Ga0501044_0635348
507 Ga0495601_0000150
508 Ga0495595_0011381
509 Ga0495619_0002326
510 Ga0501084_0110472
511 Ga0501082_0157775
512 Ga0530510_0036522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jdu-assembly1.cif.gz_A the crystal structure of an aerotolerance-related membrane protein from bacteroides fragilis nctc 9343 with multiple mutations to serines. 0.8376 69 212
1sht-assembly1.cif.gz_X crystal structure of the von willebrand factor a domain of human capillary morphogenesis protein 2: an anthrax toxin receptor 0.8053 69 234
3ibs-assembly1.cif.gz_B crystal structure of conserved hypothetical protein batb from bacteroides thetaiotaomicron 0.7974 69 211
8fz4-assembly2.cif.gz_B the von willebrand factor a domain of anthrax toxin receptor 2 0.7963 69 235
8fzv-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, ala-ala linker variant, expressed with sumo tag 0.7883 69 237
ID Description Score Start End Superfamily
4jduA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.776 69 211 3.40.50.410
af_O76836_379_570_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7644 69 237 3.40.50.410
af_O59782_529_660_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7488 176 233 3.30.750.24
af_A0A0P0XV48_261_417_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7411 69 179 3.40.50.410
af_Q54ES2_261_409_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7382 69 233 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A848WXC9-F1-model_v4 VWA domain-containing protein 0.8084 62 212 GO:0016020
AF-A0A3Q3N500-F1-model_v4 Anthrax toxin receptor 0.8047 69 233 GO:0004888
GO:0005886
GO:0009986
GO:0046872
AF-A0A2K6BDV6-F1-model_v4 Anthrax toxin receptor 0.7982 69 235 GO:0004888
GO:0005886
GO:0009986
GO:0046872
AF-A0A670ZSR3-F1-model_v4 ANTXR cell adhesion molecule 2 0.7951 65 233 GO:0004888
GO:0005886
GO:0009986
AF-A0A5E4P2W2-F1-model_v4 von Willebrand factor type A 0.795 55 235 GO:0016020

Map