F366306

General Info

Members Datasets Scaffolds Average Seq Length
256 139 512 243

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100061547|Ga0070707_1000615472
Length 244
Sequence MKLLLALACFFFAMSYFAYSATAPQTFPTSAGEVKITPLYHASTLIEEGGKTIYLDPSKPAKFAGSPKADLILITDIHPDHMDPASIAAISKAGTDILAPPAVVATVTTAKPIANGETKTWQGWTIEAIPAYNLNPTRGPAPGKLFHEKGRGNGYVLTYGGVRFYFSGDTEGVPEMRALKNIDVAFVCMNLPYTMPPDEAADAVKAFHPKVVIPYHYRGSDLSVFQKRLEGTGIEVRLLDWYPQ

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
61 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
62 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
85 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.47
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 22.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100061547 3300005468 Bacteria 3600
2 LJNas_1000840 3300000546 Bacteria 5052
3 Ga0070658_10329449 3300005327 Bacteria 1305
4 Ga0070683_100297955 3300005329 Bacteria 1534
5 Ga0070690_100656650 3300005330 Unclassified 801
6 Ga0070666_10312475 3300005335 Unclassified 1120
7 Ga0070680_100293642 3300005336 Unclassified 1378
8 Ga0068868_100200492 3300005338 Unclassified 1663
9 Ga0070709_10122008 3300005434 Bacteria 1768
10 Ga0070714_100031829 3300005435 Bacteria 4403
11 Ga0070714_100040521 3300005435 Unclassified 3925
12 Ga0070714_100143803 3300005435 Bacteria 2143
13 Ga0070714_100206681 3300005435 Unclassified 1798
14 Ga0070714_100439530 3300005435 Bacteria 1238
15 Ga0070713_100000117 3300005436 Bacteria 51918
16 Ga0070713_100005564 3300005436 Bacteria 8635
17 Ga0070713_100016298 3300005436 Bacteria 5586
18 Ga0070713_100025382 3300005436 Bacteria 4632
19 Ga0070713_100028657 3300005436 Bacteria 4398
20 Ga0070713_100120018 3300005436 Bacteria 2304
21 Ga0070713_100153709 3300005436 Bacteria 2049
22 Ga0070713_100842852 3300005436 Unclassified 880
23 Ga0070710_10000940 3300005437 Bacteria 13842
24 Ga0070710_10175611 3300005437 Bacteria 1338
25 Ga0070710_10215928 3300005437 Unclassified 1218
26 Ga0070710_10365247 3300005437 Bacteria 959
27 Ga0070711_100000441 3300005439 Bacteria 21555
28 Ga0070711_100000896 3300005439 Bacteria 15674
29 Ga0070711_100007774 3300005439 Bacteria 6530
30 Ga0070711_100103624 3300005439 Bacteria 2074
31 Ga0070711_100448239 3300005439 Bacteria 1056
32 Ga0070705_100317940 3300005440 Unclassified 1122
33 Ga0070708_100039409 3300005445 Bacteria 4134
34 Ga0070708_100168941 3300005445 Bacteria 2041
35 Ga0070708_100303900 3300005445 Bacteria 1502
36 Ga0070681_10257419 3300005458 Bacteria 1657
37 Ga0068867_100301287 3300005459 Unclassified 1321
38 Ga0070706_100002510 3300005467 Bacteria 18480
39 Ga0070706_100009803 3300005467 Bacteria 8904
40 Ga0070706_100020220 3300005467 Bacteria 6135
41 Ga0070706_100298812 3300005467 Bacteria 1502
42 Ga0070707_100076677 3300005468 Unclassified 3225
43 Ga0070707_100322034 3300005468 Bacteria 1502
44 Ga0070698_100017899 3300005471 Bacteria 7465
45 Ga0070698_100122479 3300005471 Bacteria 2559
46 Ga0070698_100312426 3300005471 Bacteria 1502
47 Ga0070699_100033755 3300005518 Bacteria 4422
48 Ga0070699_100276962 3300005518 Bacteria 1502
49 Ga0070679_100117986 3300005530 Bacteria 2638
50 Ga0070684_100437397 3300005535 Unclassified 1208
51 Ga0070697_100324426 3300005536 Bacteria 1326
52 Ga0070696_100000854 3300005546 Bacteria 19683
53 Ga0070664_100291085 3300005564 Unclassified 1474
54 Ga0068857_100094099 3300005577 Unclassified 2683
55 Ga0068857_100150227 3300005577 Bacteria 2110
56 Ga0068854_100142382 3300005578 Unclassified 1841
57 Ga0068854_100322025 3300005578 Bacteria 1257
58 Ga0068856_100497061 3300005614 Bacteria 1240
59 Ga0068859_100183379 3300005617 Unclassified 2176
60 Ga0068864_100088842 3300005618 Unclassified 2722
61 Ga0068851_10254060 3300005834 Bacteria 998
62 Ga0068870_10028497 3300005840 Unclassified 2804
63 Ga0068863_100855107 3300005841 Bacteria 909
64 Ga0068858_100052553 3300005842 Unclassified 3770
65 Ga0068858_100102958 3300005842 Unclassified 2663
66 Ga0068860_100086797 3300005843 Unclassified 2978
67 Ga0070717_10013629 3300006028 Bacteria 6237
68 Ga0070717_10058669 3300006028 Unclassified 3183
69 Ga0070717_10086703 3300006028 Bacteria 2636
70 Ga0070717_10390480 3300006028 Bacteria 1249
71 Ga0070716_100125004 3300006173 Bacteria 1617
72 Ga0070712_100001620 3300006175 Bacteria 13772
73 Ga0070712_100001921 3300006175 Bacteria 12720
74 Ga0070712_100007295 3300006175 Bacteria 6898
75 Ga0070712_100084397 3300006175 Unclassified 2309
76 Ga0070712_100594839 3300006175 Bacteria 936
77 Ga0097621_100143882 3300006237 Unclassified 2039
78 Ga0068871_100553150 3300006358 Bacteria 1042
79 Ga0075433_10003674 3300006852 Bacteria 11866
80 Ga0075434_100005040 3300006871 Bacteria 11996
81 Ga0075436_100001651 3300006914 Bacteria 15239
82 Ga0097620_100183397 3300006931 Unclassified 2176
83 Ga0075435_100423155 3300007076 Bacteria 1147
84 Ga0099795_10022134 3300007788 Bacteria 2094
85 Ga0105240_10021518 3300009093 Bacteria 8576
86 Ga0105240_10030920 3300009093 Bacteria 6954
87 Ga0105240_10059713 3300009093 Bacteria 4758
88 Ga0105240_10182760 3300009093 Bacteria 2473
89 Ga0105240_10487359 3300009093 Bacteria 1373
90 Ga0105240_10618504 3300009093 Unclassified 1191
91 Ga0105245_10044312 3300009098 Bacteria 3971
92 Ga0105245_10417233 3300009098 Unclassified 1344
93 Ga0105241_10018482 3300009174 Bacteria 5128
94 Ga0105241_10366257 3300009174 Bacteria 1255
95 Ga0105238_10652701 3300009551 Bacteria 1062
96 Ga0157370_10001589 3300013104 Bacteria 28060
97 Ga0157370_10106350 3300013104 Bacteria 2626
98 Ga0157369_10098018 3300013105 Unclassified 3127
99 Ga0157369_10113306 3300013105 Bacteria 2881
100 Ga0157374_10035780 3300013296 Unclassified 4544
101 Ga0157374_10228661 3300013296 Bacteria 1827
102 Ga0157374_10323791 3300013296 Unclassified 1528
103 Ga0157378_10000721 3300013297 Bacteria 30851
104 Ga0157378_10012787 3300013297 Bacteria 7348
105 Ga0157372_10039829 3300013307 Bacteria 5188
106 Ga0157372_10044120 3300013307 Bacteria 4940
107 Ga0157372_10203216 3300013307 Unclassified 2295
108 Ga0157372_10229377 3300013307 Bacteria 2153
109 Ga0163163_10058206 3300014325 Unclassified 3821
110 Ga0163163_10223928 3300014325 Bacteria 1930
111 Ga0182008_10136415 3300014497 Bacteria 1225
112 Ga0157379_10216852 3300014968 Bacteria 1733
113 Ga0157379_10217307 3300014968 Bacteria 1731
114 Ga0157379_10236334 3300014968 Unclassified 1657
115 Ga0157376_10014625 3300014969 Bacteria 5897
116 Ga0157376_10567105 3300014969 Bacteria 1126
117 Ga0224569_101398 3300022732 Unclassified 2032
118 Ga0224572_1003541 3300024225 Bacteria 2645
119 Ga0224572_1005415 3300024225 Unclassified 2273
120 Ga0224572_1012861 3300024225 Bacteria 1594
121 Ga0228598_1001649 3300024227 Bacteria 4879
122 Ga0228598_1002134 3300024227 Bacteria 4327
123 Ga0207656_10186122 3300025321 Bacteria 998
124 Ga0207692_10003324 3300025898 Bacteria 6268
125 Ga0207692_10006324 3300025898 Bacteria 4799
126 Ga0207692_10285663 3300025898 Unclassified 1000
127 Ga0207680_10324603 3300025903 Unclassified 1077
128 Ga0207685_10002362 3300025905 Bacteria 4303
129 Ga0207699_10083565 3300025906 Bacteria 1986
130 Ga0207699_10247349 3300025906 Bacteria 1227
131 Ga0207699_10323079 3300025906 Bacteria 1083
132 Ga0207684_10000873 3300025910 Bacteria 34403
133 Ga0207684_10008895 3300025910 Bacteria 8917
134 Ga0207684_10045103 3300025910 Bacteria 3740
135 Ga0207654_10013018 3300025911 Bacteria 4271
136 Ga0207654_10330892 3300025911 Bacteria 1044
137 Ga0207707_10589679 3300025912 Bacteria 941
138 Ga0207707_10630576 3300025912 Bacteria 905
139 Ga0207695_10241593 3300025913 Bacteria 1707
140 Ga0207693_10000121 3300025915 Bacteria 69495
141 Ga0207693_10000777 3300025915 Bacteria 28620
142 Ga0207693_10019648 3300025915 Bacteria 5373
143 Ga0207693_10021677 3300025915 Bacteria 5107
144 Ga0207693_10663917 3300025915 Unclassified 809
145 Ga0207663_10001532 3300025916 Bacteria 10818
146 Ga0207663_10001682 3300025916 Bacteria 10396
147 Ga0207663_10003950 3300025916 Bacteria 7335
148 Ga0207663_10079413 3300025916 Bacteria 2142
149 Ga0207663_10131565 3300025916 Bacteria 1730
150 Ga0207646_10086425 3300025922 Bacteria 2806
151 Ga0207646_10285491 3300025922 Bacteria 1491
152 Ga0207646_10408727 3300025922 Bacteria 1226
153 Ga0207700_10000064 3300025928 Bacteria 65512
154 Ga0207700_10021021 3300025928 Bacteria 4448
155 Ga0207700_10088571 3300025928 Bacteria 2437
156 Ga0207664_10000086 3300025929 Bacteria 89769
157 Ga0207664_10140561 3300025929 Unclassified 2042
158 Ga0207664_10187494 3300025929 Unclassified 1779
159 Ga0207664_10651311 3300025929 Bacteria 947
160 Ga0207665_10007242 3300025939 Bacteria 7338
161 Ga0207665_10061373 3300025939 Bacteria 2548
162 Ga0207640_10114389 3300025981 Unclassified 1920
163 Ga0207677_10220668 3300026023 Unclassified 1520
164 Ga0207703_10082023 3300026035 Unclassified 2690
165 Ga0207703_10176091 3300026035 Unclassified 1885
166 Ga0207702_10001328 3300026078 Bacteria 24749
167 Ga0207702_10172921 3300026078 Bacteria 1982
168 Ga0207676_10244949 3300026095 Unclassified 1610
169 Ga0207674_10080340 3300026116 Unclassified 3264
170 Ga0207674_10316361 3300026116 Bacteria 1510
171 Ga0265356_1000603 3300028017 Bacteria 6303
172 Ga0265356_1002822 3300028017 Bacteria 2250
173 Ga0265357_1004657 3300028023 Bacteria 1244
174 Ga0265357_1005923 3300028023 Bacteria 1145
175 Ga0268266_10196873 3300028379 Unclassified 1843
176 Ga0268264_10070229 3300028381 Unclassified 2964
177 Ga0265338_10006988 3300028800 Bacteria 14182
178 Ga0265338_10035704 3300028800 Bacteria 4770
179 Ga0265338_10231767 3300028800 Bacteria 1373
180 Ga0265338_10261342 3300028800 Bacteria 1272
181 Ga0265762_1000963 3300030760 Bacteria 5170
182 Ga0265760_10004611 3300031090 Bacteria 3946
183 Ga0265760_10018927 3300031090 Unclassified 1984
184 Ga0265330_10003692 3300031235 Bacteria 7938
185 Ga0265340_10217426 3300031247 Bacteria 857
186 Ga0265339_10054620 3300031249 Bacteria 2169
187 Ga0265316_10019324 3300031344 Bacteria 5830
188 Ga0265314_10048019 3300031711 Bacteria 2999
189 Ga0265314_10055406 3300031711 Bacteria 2737
190 Ga0265342_10056481 3300031712 Bacteria 2326
191 Ga0373926_0170515 3300035083 Bacteria 833
192 Ga0373923_0016776 3300035111 Unclassified 2790
193 Ga0373936_0134759 3300035113 Bacteria 1063
194 Ga0373954_0211888 3300035118 Bacteria 952
195 Ga0373956_0015979 3300035119 Bacteria 3148
196 Ga0373957_0037264 3300035120 Bacteria 1816
197 Ga0373943_0000057 3300035170 Bacteria 38342
198 Ga0373943_0157849 3300035170 Bacteria 1233
199 Ga0373955_0067247 3300035172 Bacteria 1994
200 Ga0373924_0005113 3300035410 Bacteria 4629
201 Ga0373935_0071432 3300035692 Bacteria 2239
202 Ga0373935_0131143 3300035692 Unclassified 1684
203 Ga0373927_0001441 3300035695 Bacteria 17936
204 Ga0373933_0063304 3300035724 Bacteria 2236
205 Ga0373933_0222502 3300035724 Bacteria 1211
206 Ga0373947_0000573 3300035725 Bacteria 21508
207 Ga0373947_0273383 3300035725 Unclassified 1122
208 Ga0373937_0132268 3300036401 Bacteria 2330
209 Ga0373937_0188353 3300036401 Bacteria 1938
210 Ga0373937_0205741 3300036401 Unclassified 1851
211 Ga0373937_0647342 3300036401 Bacteria 1002
212 Ga0373937_0702492 3300036401 Bacteria 958
213 Ga0373925_0008295 3300037068 Bacteria 7561
214 Ga0373925_0143459 3300037068 Bacteria 1870
215 Ga0436363_1096034 3300039450 Unclassified 1602
216 Ga0451576_0549000 3300045051 Bacteria 1214
217 Ga0451576_0732232 3300045051 Bacteria 1039
218 Ga0495580_0000403 3300046472 Bacteria 35484
219 Ga0495580_0003237 3300046472 Bacteria 13923
220 Ga0495580_0036881 3300046472 Bacteria 3510
221 Ga0495580_0316354 3300046472 Unclassified 1061
222 Ga0495582_0001797 3300046473 Bacteria 12117
223 Ga0495630_0517526 3300046517 Bacteria 915
224 Ga0495665_0034463 3300046531 Bacteria 2707
225 Ga0495665_0230889 3300046531 Bacteria 955
226 Ga0495586_0170246 3300046535 Unclassified 1231
227 Ga0495645_0063941 3300046543 Bacteria 2663
228 Ga0495634_0200067 3300046642 Bacteria 1241
229 Ga0495658_0104802 3300046683 Bacteria 1693
230 Ga0495613_0210323 3300046689 Bacteria 1368
231 Ga0495674_0008059 3300047319 Bacteria 10056
232 Ga0495674_0042362 3300047319 Bacteria 4061
233 Ga0495674_0269657 3300047319 Unclassified 1397
234 Ga0495676_0133466 3300047321 Bacteria 1789
235 Ga0495680_0050583 3300047322 Bacteria 3248
236 Ga0495602_0106665 3300048088 Unclassified 2286
237 Ga0496102_0013011 3300048905 Bacteria 7205
238 Ga0496102_0185622 3300048905 Bacteria 1960
239 Ga0496103_0036430 3300048906 Bacteria 3013
240 Ga0496104_0181984 3300048907 Bacteria 2012
241 Ga0496104_0284857 3300048907 Bacteria 1565
242 Ga0496104_0330145 3300048907 Bacteria 1438
243 Ga0496104_0431290 3300048907 Bacteria 1230
244 Ga0496108_0284045 3300048911 Bacteria 1441
245 Ga0496110_0763651 3300048913 Bacteria 870
246 Ga0496112_0188779 3300048915 Bacteria 2023
247 Ga0496112_0344709 3300048915 Bacteria 1433
248 Ga0496114_0201170 3300048917 Bacteria 1745
249 Ga0496115_0005484 3300048918 Bacteria 9232
250 Ga0496115_0246303 3300048918 Bacteria 1472
251 Ga0501034_0009639 3300049571 Bacteria 10099
252 nmdc:mga0n895_1502_c2 3300050512 Bacteria 15127
253 nmdc:mga0rr50_14332_c1 3300050513 Bacteria 5195
254 nmdc:mga0rr50_434288_c1 3300050513 Bacteria 1112
255 nmdc:mga08x19_2407_c1 3300050514 Bacteria 11351
256 nmdc:mga0a205_177992_c1 3300050515 Bacteria 2022
257 Ga0070707_100061547
258 LJNas_1000840
259 Ga0070658_10329449
260 Ga0070683_100297955
261 Ga0070690_100656650
262 Ga0070666_10312475
263 Ga0070680_100293642
264 Ga0068868_100200492
265 Ga0070709_10122008
266 Ga0070714_100031829
267 Ga0070714_100040521
268 Ga0070714_100143803
269 Ga0070714_100206681
270 Ga0070714_100439530
271 Ga0070713_100000117
272 Ga0070713_100005564
273 Ga0070713_100016298
274 Ga0070713_100025382
275 Ga0070713_100028657
276 Ga0070713_100120018
277 Ga0070713_100153709
278 Ga0070713_100842852
279 Ga0070710_10000940
280 Ga0070710_10175611
281 Ga0070710_10215928
282 Ga0070710_10365247
283 Ga0070711_100000441
284 Ga0070711_100000896
285 Ga0070711_100007774
286 Ga0070711_100103624
287 Ga0070711_100448239
288 Ga0070705_100317940
289 Ga0070708_100039409
290 Ga0070708_100168941
291 Ga0070708_100303900
292 Ga0070681_10257419
293 Ga0068867_100301287
294 Ga0070706_100002510
295 Ga0070706_100009803
296 Ga0070706_100020220
297 Ga0070706_100298812
298 Ga0070707_100076677
299 Ga0070707_100322034
300 Ga0070698_100017899
301 Ga0070698_100122479
302 Ga0070698_100312426
303 Ga0070699_100033755
304 Ga0070699_100276962
305 Ga0070679_100117986
306 Ga0070684_100437397
307 Ga0070697_100324426
308 Ga0070696_100000854
309 Ga0070664_100291085
310 Ga0068857_100094099
311 Ga0068857_100150227
312 Ga0068854_100142382
313 Ga0068854_100322025
314 Ga0068856_100497061
315 Ga0068859_100183379
316 Ga0068864_100088842
317 Ga0068851_10254060
318 Ga0068870_10028497
319 Ga0068863_100855107
320 Ga0068858_100052553
321 Ga0068858_100102958
322 Ga0068860_100086797
323 Ga0070717_10013629
324 Ga0070717_10058669
325 Ga0070717_10086703
326 Ga0070717_10390480
327 Ga0070716_100125004
328 Ga0070712_100001620
329 Ga0070712_100001921
330 Ga0070712_100007295
331 Ga0070712_100084397
332 Ga0070712_100594839
333 Ga0097621_100143882
334 Ga0068871_100553150
335 Ga0075433_10003674
336 Ga0075434_100005040
337 Ga0075436_100001651
338 Ga0097620_100183397
339 Ga0075435_100423155
340 Ga0099795_10022134
341 Ga0105240_10021518
342 Ga0105240_10030920
343 Ga0105240_10059713
344 Ga0105240_10182760
345 Ga0105240_10487359
346 Ga0105240_10618504
347 Ga0105245_10044312
348 Ga0105245_10417233
349 Ga0105241_10018482
350 Ga0105241_10366257
351 Ga0105238_10652701
352 Ga0157370_10001589
353 Ga0157370_10106350
354 Ga0157369_10098018
355 Ga0157369_10113306
356 Ga0157374_10035780
357 Ga0157374_10228661
358 Ga0157374_10323791
359 Ga0157378_10000721
360 Ga0157378_10012787
361 Ga0157372_10039829
362 Ga0157372_10044120
363 Ga0157372_10203216
364 Ga0157372_10229377
365 Ga0163163_10058206
366 Ga0163163_10223928
367 Ga0182008_10136415
368 Ga0157379_10216852
369 Ga0157379_10217307
370 Ga0157379_10236334
371 Ga0157376_10014625
372 Ga0157376_10567105
373 Ga0224569_101398
374 Ga0224572_1003541
375 Ga0224572_1005415
376 Ga0224572_1012861
377 Ga0228598_1001649
378 Ga0228598_1002134
379 Ga0207656_10186122
380 Ga0207692_10003324
381 Ga0207692_10006324
382 Ga0207692_10285663
383 Ga0207680_10324603
384 Ga0207685_10002362
385 Ga0207699_10083565
386 Ga0207699_10247349
387 Ga0207699_10323079
388 Ga0207684_10000873
389 Ga0207684_10008895
390 Ga0207684_10045103
391 Ga0207654_10013018
392 Ga0207654_10330892
393 Ga0207707_10589679
394 Ga0207707_10630576
395 Ga0207695_10241593
396 Ga0207693_10000121
397 Ga0207693_10000777
398 Ga0207693_10019648
399 Ga0207693_10021677
400 Ga0207693_10663917
401 Ga0207663_10001532
402 Ga0207663_10001682
403 Ga0207663_10003950
404 Ga0207663_10079413
405 Ga0207663_10131565
406 Ga0207646_10086425
407 Ga0207646_10285491
408 Ga0207646_10408727
409 Ga0207700_10000064
410 Ga0207700_10021021
411 Ga0207700_10088571
412 Ga0207664_10000086
413 Ga0207664_10140561
414 Ga0207664_10187494
415 Ga0207664_10651311
416 Ga0207665_10007242
417 Ga0207665_10061373
418 Ga0207640_10114389
419 Ga0207677_10220668
420 Ga0207703_10082023
421 Ga0207703_10176091
422 Ga0207702_10001328
423 Ga0207702_10172921
424 Ga0207676_10244949
425 Ga0207674_10080340
426 Ga0207674_10316361
427 Ga0265356_1000603
428 Ga0265356_1002822
429 Ga0265357_1004657
430 Ga0265357_1005923
431 Ga0268266_10196873
432 Ga0268264_10070229
433 Ga0265338_10006988
434 Ga0265338_10035704
435 Ga0265338_10231767
436 Ga0265338_10261342
437 Ga0265762_1000963
438 Ga0265760_10004611
439 Ga0265760_10018927
440 Ga0265330_10003692
441 Ga0265340_10217426
442 Ga0265339_10054620
443 Ga0265316_10019324
444 Ga0265314_10048019
445 Ga0265314_10055406
446 Ga0265342_10056481
447 Ga0373926_0170515
448 Ga0373923_0016776
449 Ga0373936_0134759
450 Ga0373954_0211888
451 Ga0373956_0015979
452 Ga0373957_0037264
453 Ga0373943_0000057
454 Ga0373943_0157849
455 Ga0373955_0067247
456 Ga0373924_0005113
457 Ga0373935_0071432
458 Ga0373935_0131143
459 Ga0373927_0001441
460 Ga0373933_0063304
461 Ga0373933_0222502
462 Ga0373947_0000573
463 Ga0373947_0273383
464 Ga0373937_0132268
465 Ga0373937_0188353
466 Ga0373937_0205741
467 Ga0373937_0647342
468 Ga0373937_0702492
469 Ga0373925_0008295
470 Ga0373925_0143459
471 Ga0436363_1096034
472 Ga0451576_0549000
473 Ga0451576_0732232
474 Ga0495580_0000403
475 Ga0495580_0003237
476 Ga0495580_0036881
477 Ga0495580_0316354
478 Ga0495582_0001797
479 Ga0495630_0517526
480 Ga0495665_0034463
481 Ga0495665_0230889
482 Ga0495586_0170246
483 Ga0495645_0063941
484 Ga0495634_0200067
485 Ga0495658_0104802
486 Ga0495613_0210323
487 Ga0495674_0008059
488 Ga0495674_0042362
489 Ga0495674_0269657
490 Ga0495676_0133466
491 Ga0495680_0050583
492 Ga0495602_0106665
493 Ga0496102_0013011
494 Ga0496102_0185622
495 Ga0496103_0036430
496 Ga0496104_0181984
497 Ga0496104_0284857
498 Ga0496104_0330145
499 Ga0496104_0431290
500 Ga0496108_0284045
501 Ga0496110_0763651
502 Ga0496112_0188779
503 Ga0496112_0344709
504 Ga0496114_0201170
505 Ga0496115_0005484
506 Ga0496115_0246303
507 Ga0501034_0009639
508 nmdc:mga0n895_1502_c2
509 nmdc:mga0rr50_14332_c1
510 nmdc:mga0rr50_434288_c1
511 nmdc:mga08x19_2407_c1
512 nmdc:mga0a205_177992_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

35

216

0.87

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

50

217

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kl7-assembly1.cif.gz_A crystal structure of putative metal-dependent hydrolase (yp_001302908.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution 0.9487 21 237
3kl7-assembly1.cif.gz_A crystal structure of putative metal-dependent hydrolase (yp_001302908.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution 0.9319 21 237
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.8299 33 240
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8289 33 240
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.826 33 240
ID Description Score Start End Superfamily
3kl7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9478 21 237 3.60.15.10
3kl7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9307 21 237 3.60.15.10
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8033 35 237 3.60.15.10
af_Q9TZ27_64_133_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7974 22 55 2.40.50.100
af_Q965X7_61_355_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7907 26 238 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7C5AWB8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.983 21 241 GO:0004553
GO:0005975
AF-A0A850BKE2-F1-model_v4 MBL fold metallo-hydrolase 0.982 22 239 GO:0016787
AF-A0A3D1AWP6-F1-model_v4 MBL fold metallo-hydrolase 0.981 22 240 GO:0016787
AF-A0A1F2SV50-F1-model_v4 MBL fold metallo-hydrolase 0.9791 61 239 GO:0016787
AF-A0A850BKE2-F1-model_v4 MBL fold metallo-hydrolase 0.9732 22 239 GO:0016787

Map