F366183

General Info

Members Datasets Scaffolds Average Seq Length
256 193 512 190

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10404515|Ga0065715_104045152
Length 213
Sequence MFIAEQPLSENIKILFSLDIMANPDSRVTIHMVASLDGFIARKDGRVDWLETSDEFAGGDTLDPEFVESFLKTIDCYVMGSRTYETALNFEAKGFGWAYGDKPTFVLTSRDLPRTRDTVEFYSGDLAQFVNEHLRPRFHSIWFVGGGVVSGECLRVGLADEVRYSILPILIGNGITFFEKLDRDVPLHLAEVKAYKSGTVALHYELRRSRAGA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
191 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 5.86
Rhizosphere 86.72
Stem 0
Stem Tuber 0
Unclassified 9.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10404515 3300005293 Bacteria 877
2 JGI25162J39368_1000953 3300002737 Bacteria 18490
3 JGI25157J39369_1006884 3300002741 Bacteria 1688
4 JGI25164J39214_1000353 3300002772 Bacteria 28602
5 JGI25165J46597_1000647 3300003214 Bacteria 28602
6 Ga0055527_1000824 3300003760 Bacteria 8268
7 Ga0055535_1000381 3300003761 Bacteria 41924
8 Ga0055542_1000670 3300003762 Bacteria 27772
9 Ga0055529_1000237 3300003763 Bacteria 68923
10 JGI25405J52794_10000881 3300003911 Bacteria 4689
11 Ga0065704_10208600 3300005289 Bacteria 1117
12 Ga0065712_10033575 3300005290 Unclassified 1380
13 Ga0065712_10122950 3300005290 Bacteria 1644
14 Ga0065712_10124953 3300005290 Bacteria 1609
15 Ga0065712_10193529 3300005290 Unclassified 1138
16 Ga0065715_10025848 3300005293 Bacteria 2397
17 Ga0070690_100158803 3300005330 Bacteria 1548
18 Ga0070670_100000870 3300005331 Bacteria 23745
19 Ga0070666_10016082 3300005335 Bacteria 4782
20 Ga0068868_100032389 3300005338 Bacteria 4021
21 Ga0068868_100318372 3300005338 Bacteria 1325
22 Ga0070689_100409977 3300005340 Bacteria 1147
23 Ga0070687_100003327 3300005343 Bacteria 6222
24 Ga0070661_100032853 3300005344 Bacteria 3757
25 Ga0070661_100098272 3300005344 Bacteria 2174
26 Ga0070692_10365909 3300005345 Unclassified 900
27 Ga0070668_100132201 3300005347 Bacteria 2004
28 Ga0070668_100315380 3300005347 Bacteria 1315
29 Ga0070675_100274111 3300005354 Bacteria 1481
30 Ga0070671_100554082 3300005355 Bacteria 992
31 Ga0070673_100063497 3300005364 Bacteria 2939
32 Ga0070673_100181741 3300005364 Bacteria 1801
33 Ga0070659_100006814 3300005366 Bacteria 8269
34 Ga0070709_10052253 3300005434 Bacteria 2567
35 Ga0070714_100439861 3300005435 Bacteria 1237
36 Ga0070713_100044141 3300005436 Bacteria 3647
37 Ga0070701_10138819 3300005438 Bacteria 1388
38 Ga0070701_10154871 3300005438 Bacteria 1323
39 Ga0070711_100023873 3300005439 Bacteria 3983
40 Ga0070711_100205519 3300005439 Bacteria 1522
41 Ga0070708_100000426 3300005445 Bacteria 31415
42 Ga0070708_100904056 3300005445 Unclassified 829
43 Ga0070681_10040540 3300005458 Bacteria 4665
44 Ga0068867_100161536 3300005459 Bacteria 1767
45 Ga0070707_100182248 3300005468 Bacteria 2047
46 Ga0070698_100054715 3300005471 Bacteria 4051
47 Ga0070699_101251216 3300005518 Unclassified 681
48 Ga0070679_100032712 3300005530 Bacteria 5147
49 Ga0070679_100104359 3300005530 Bacteria 2821
50 Ga0070684_100000967 3300005535 Bacteria 20482
51 Ga0068853_100034481 3300005539 Bacteria 4296
52 Ga0070672_100312453 3300005543 Bacteria 1334
53 Ga0070686_100213347 3300005544 Bacteria 1391
54 Ga0070686_100360508 3300005544 Bacteria 1095
55 Ga0070695_100018854 3300005545 Bacteria 4194
56 Ga0070695_100088113 3300005545 Bacteria 2066
57 Ga0070696_100002019 3300005546 Bacteria 13314
58 Ga0070704_100040790 3300005549 Bacteria 3199
59 Ga0070664_100030916 3300005564 Bacteria 4469
60 Ga0070664_100300756 3300005564 Bacteria 1450
61 Ga0068857_100010089 3300005577 Bacteria 8206
62 Ga0068856_100028406 3300005614 Bacteria 5462
63 Ga0068856_100069696 3300005614 Bacteria 3477
64 Ga0070702_100613054 3300005615 Bacteria 818
65 Ga0068859_100892134 3300005617 Bacteria 974
66 Ga0068864_100002504 3300005618 Bacteria 15194
67 Ga0068864_100007099 3300005618 Bacteria 9199
68 Ga0068864_100064889 3300005618 Bacteria 3168
69 Ga0068861_100580676 3300005719 Bacteria 1026
70 Ga0068863_100023076 3300005841 Bacteria 5945
71 Ga0068858_100247737 3300005842 Unclassified 1692
72 Ga0068860_100015241 3300005843 Bacteria 7508
73 Ga0081455_10000645 3300005937 Bacteria 45201
74 Ga0081455_10011964 3300005937 Bacteria 8685
75 Ga0081539_10017820 3300005985 Bacteria 4961
76 Ga0070715_10062595 3300006163 Bacteria 1638
77 Ga0097621_100317270 3300006237 Bacteria 1380
78 Ga0075433_10925779 3300006852 Bacteria 760
79 Ga0075434_100405144 3300006871 Unclassified 1385
80 Ga0068865_100156294 3300006881 Bacteria 1735
81 Ga0075436_100140377 3300006914 Bacteria 1698
82 Ga0097620_100892137 3300006931 Bacteria 974
83 Ga0075435_100354559 3300007076 Bacteria 1258
84 Ga0105250_10120402 3300009092 Unclassified 1079
85 Ga0105240_10905051 3300009093 Bacteria 949
86 Ga0111539_10010889 3300009094 Bacteria 11447
87 Ga0114129_10034469 3300009147 Bacteria 7149
88 Ga0114129_10316040 3300009147 Bacteria 2077
89 Ga0114129_10652638 3300009147 Bacteria 1358
90 Ga0105243_10244447 3300009148 Bacteria 1599
91 Ga0105241_10732550 3300009174 Bacteria 905
92 Ga0105248_10478928 3300009177 Bacteria 1403
93 Ga0105248_10660648 3300009177 Bacteria 1179
94 Ga0105249_10029052 3300009553 Unclassified 4992
95 Ga0105249_10541208 3300009553 Bacteria 1214
96 Ga0105239_10075550 3300010375 Unclassified 3705
97 Ga0105246_10041659 3300011119 Bacteria 3105
98 Ga0105246_10268688 3300011119 Bacteria 1362
99 Ga0157373_10046411 3300013100 Bacteria 3100
100 Ga0157371_10131727 3300013102 Bacteria 1779
101 Ga0157371_10261271 3300013102 Bacteria 1248
102 Ga0157370_10260130 3300013104 Bacteria 1604
103 Ga0157369_10881102 3300013105 Bacteria 918
104 Ga0157374_10016488 3300013296 Bacteria 6496
105 Ga0157378_10013274 3300013297 Bacteria 7202
106 Ga0157378_10133215 3300013297 Bacteria 2302
107 Ga0157378_10205032 3300013297 Bacteria 1867
108 Ga0157378_10343675 3300013297 Bacteria 1456
109 Ga0163162_10114155 3300013306 Bacteria 2800
110 Ga0163162_10560645 3300013306 Bacteria 1270
111 Ga0163162_10573048 3300013306 Unclassified 1256
112 Ga0157372_10100208 3300013307 Bacteria 3306
113 Ga0157375_10254179 3300013308 Bacteria 1918
114 Ga0163163_10003820 3300014325 Bacteria 12826
115 Ga0163163_10011659 3300014325 Bacteria 7985
116 Ga0157380_10005088 3300014326 Bacteria 9182
117 Ga0157380_10730139 3300014326 Bacteria 999
118 Ga0157377_10101438 3300014745 Bacteria 1715
119 Ga0157379_10069779 3300014968 Bacteria 3144
120 Ga0157376_10043012 3300014969 Bacteria 3705
121 Ga0157376_11846567 3300014969 Unclassified 641
122 Ga0209672_100117 3300025228 Bacteria 86660
123 Ga0207427_100358 3300025231 Bacteria 28655
124 Ga0209437_100496 3300025233 Bacteria 28662
125 Ga0209258_100338 3300025242 Bacteria 69473
126 Ga0209148_1000309 3300025254 Bacteria 69520
127 Ga0209759_1000211 3300025256 Bacteria 90002
128 Ga0209233_1000443 3300025261 Bacteria 28662
129 Ga0209455_1000018 3300025272 Bacteria 718034
130 Ga0207697_10000971 3300025315 Bacteria 16130
131 Ga0207697_10010624 3300025315 Bacteria 3928
132 Ga0207692_10288214 3300025898 Bacteria 995
133 Ga0207680_10021855 3300025903 Bacteria 3469
134 Ga0207699_10035328 3300025906 Bacteria 2843
135 Ga0207699_10373250 3300025906 Bacteria 1011
136 Ga0207707_10150034 3300025912 Bacteria 2038
137 Ga0207693_10012411 3300025915 Bacteria 6883
138 Ga0207663_10020830 3300025916 Bacteria 3721
139 Ga0207649_10055571 3300025920 Bacteria 2468
140 Ga0207652_10039738 3300025921 Bacteria 3993
141 Ga0207652_10163968 3300025921 Bacteria 1992
142 Ga0207646_10000943 3300025922 Bacteria 37403
143 Ga0207681_10144351 3300025923 Bacteria 1776
144 Ga0207650_10082412 3300025925 Bacteria 2442
145 Ga0207650_10127850 3300025925 Bacteria 1985
146 Ga0207700_10008341 3300025928 Bacteria 6411
147 Ga0207644_10266263 3300025931 Bacteria 1372
148 Ga0207644_10941759 3300025931 Bacteria 724
149 Ga0207690_10062560 3300025932 Bacteria 2534
150 Ga0207670_10454073 3300025936 Bacteria 1034
151 Ga0207669_10530695 3300025937 Bacteria 946
152 Ga0207665_10022488 3300025939 Bacteria 4148
153 Ga0207691_10000806 3300025940 Bacteria 31170
154 Ga0207691_10472397 3300025940 Bacteria 1066
155 Ga0207661_10328781 3300025944 Bacteria 1375
156 Ga0207679_10071053 3300025945 Bacteria 2624
157 Ga0207651_10352396 3300025960 Bacteria 1240
158 Ga0207640_10486832 3300025981 Bacteria 1024
159 Ga0207708_10819627 3300026075 Bacteria 802
160 Ga0207702_10107538 3300026078 Bacteria 2474
161 Ga0207676_10004996 3300026095 Bacteria 9396
162 Ga0207676_10113686 3300026095 Bacteria 2270
163 Ga0207676_10114500 3300026095 Bacteria 2262
164 Ga0207674_10000499 3300026116 Bacteria 51844
165 Ga0207675_100543363 3300026118 Bacteria 1160
166 Ga0207698_11097021 3300026142 Bacteria 809
167 Ga0207428_10004721 3300027907 Bacteria 12887
168 Ga0268266_10049619 3300028379 Bacteria 3599
169 Ga0268266_10249835 3300028379 Bacteria 1640
170 Ga0268266_10411985 3300028379 Bacteria 1280
171 Ga0268265_10297657 3300028380 Bacteria 1451
172 Ga0268264_10012947 3300028381 Bacteria 6859
173 Ga0268264_10014103 3300028381 Bacteria 6571
174 Ga0265765_1003005 3300030879 Unclassified 1670
175 Ga0265760_10003070 3300031090 Unclassified 4872
176 Ga0307416_100061005 3300032002 Unclassified 3075
177 Ga0373926_0229313 3300035083 Bacteria 718
178 Ga0373956_0091341 3300035119 Bacteria 1405
179 Ga0373943_0042595 3300035170 Bacteria 2201
180 Ga0373943_0086771 3300035170 Bacteria 1614
181 Ga0373943_0409345 3300035170 Bacteria 784
182 Ga0373955_0035871 3300035172 Bacteria 2629
183 Ga0373955_0732757 3300035172 Bacteria 607
184 Ga0373935_0302411 3300035692 Bacteria 1131
185 Ga0373935_0621404 3300035692 Bacteria 791
186 Ga0373927_0471293 3300035695 Bacteria 830
187 Ga0373937_0393811 3300036401 Bacteria 1314
188 Ga0373937_0606344 3300036401 Bacteria 1039
189 Ga0373937_0863425 3300036401 Bacteria 853
190 Ga0373925_0223293 3300037068 Bacteria 1504
191 Ga0373925_0270300 3300037068 Bacteria 1367
192 Ga0395900_0537300 3300037418 Bacteria 1115
193 Ga0395900_0901107 3300037418 Bacteria 808
194 Ga0395905_0016625 3300037471 Bacteria 6994
195 Ga0395905_0713974 3300037471 Unclassified 905
196 Ga0436360_1034799 3300039438 Bacteria 1031
197 Ga0451845_0593283 3300041501 Unclassified 957
198 Ga0439455_0005178 3300042012 Bacteria 2633
199 Ga0439458_0024158 3300042157 Bacteria 1420
200 Ga0439435_0015187 3300042436 Bacteria 1913
201 Ga0453684_0236121 3300044712 Bacteria 2108
202 Ga0451576_0653224 3300045051 Unclassified 1105
203 Ga0495641_0032625 3300046461 Unclassified 2477
204 Ga0495651_0025069 3300046462 Bacteria 4640
205 Ga0495651_0275448 3300046462 Bacteria 1139
206 Ga0495584_0057103 3300046491 Bacteria 1964
207 Ga0495585_0279293 3300046492 Viruses 826
208 Ga0495608_0125701 3300046511 Bacteria 1643
209 Ga0495630_0121771 3300046517 Bacteria 1979
210 Ga0495586_0000777 3300046535 Bacteria 18345
211 Ga0495587_0049339 3300046536 Bacteria 2492
212 Ga0495667_0350291 3300046559 Bacteria 933
213 Ga0495634_0083983 3300046642 Unclassified 2077
214 Ga0495611_0229624 3300046648 Bacteria 863
215 Ga0495659_0024681 3300046664 Bacteria 2052
216 Ga0495657_0352160 3300046675 Bacteria 871
217 Ga0495623_0204151 3300046679 Bacteria 1135
218 Ga0495646_0169296 3300046680 Bacteria 1205
219 Ga0495658_0004383 3300046683 Bacteria 6951
220 Ga0495669_0022798 3300046684 Unclassified 2721
221 Ga0495669_0267575 3300046684 Bacteria 822
222 Ga0495613_0087432 3300046689 Unclassified 2259
223 Ga0495613_0142811 3300046689 Bacteria 1710
224 Ga0495674_0584736 3300047319 Bacteria 886
225 Ga0495675_0075853 3300047444 Bacteria 2119
226 Ga0495677_0144057 3300047445 Bacteria 916
227 Ga0495684_0121343 3300047471 Bacteria 1968
228 Ga0496101_0405576 3300048904 Bacteria 1074
229 Ga0496102_0135729 3300048905 Bacteria 2305
230 Ga0496102_1143534 3300048905 Bacteria 698
231 Ga0496104_0659130 3300048907 Bacteria 955
232 Ga0496106_0036884 3300048909 Bacteria 3656
233 Ga0496106_0158833 3300048909 Bacteria 1787
234 Ga0496106_0618053 3300048909 Unclassified 867
235 Ga0496108_0406195 3300048911 Unclassified 1189
236 Ga0496109_0012074 3300048912 Bacteria 7443
237 Ga0496109_0151435 3300048912 Bacteria 2172
238 Ga0496110_0225194 3300048913 Bacteria 1705
239 Ga0496112_0036965 3300048915 Bacteria 4765
240 Ga0496113_0012690 3300048916 Bacteria 5671
241 Ga0496113_0161609 3300048916 Bacteria 1771
242 Ga0496115_0963010 3300048918 Bacteria 654
243 Ga0501040_0920153 3300049576 Bacteria 634
244 Ga0501079_0117026 3300049741 Bacteria 2072
245 Ga0501079_0416203 3300049741 Bacteria 1055
246 Ga0501045_0517805 3300049824 Bacteria 886
247 nmdc:mga05p37_645885_c1 3300050507 Unclassified 1186
248 nmdc:mga05p37_80742_c1 3300050507 Bacteria 4006
249 nmdc:mga09592_684555_c1 3300050508 Bacteria 874
250 nmdc:mga06r32_215094_c1 3300050510 Bacteria 1910
251 nmdc:mga0n895_876499_c1 3300050512 Bacteria 884
252 Ga0495601_0247417 3300053077 Bacteria 1164
253 Ga0500610_0223723 3300053079 Bacteria 889
254 Ga0495655_0068760 3300053083 Bacteria 985
255 Ga0495595_0409038 3300053084 Bacteria 688
256 Ga0500583_0032805 3300053092 Bacteria 2293
257 Ga0065715_10404515
258 JGI25162J39368_1000953
259 JGI25157J39369_1006884
260 JGI25164J39214_1000353
261 JGI25165J46597_1000647
262 Ga0055527_1000824
263 Ga0055535_1000381
264 Ga0055542_1000670
265 Ga0055529_1000237
266 JGI25405J52794_10000881
267 Ga0065704_10208600
268 Ga0065712_10033575
269 Ga0065712_10122950
270 Ga0065712_10124953
271 Ga0065712_10193529
272 Ga0065715_10025848
273 Ga0070690_100158803
274 Ga0070670_100000870
275 Ga0070666_10016082
276 Ga0068868_100032389
277 Ga0068868_100318372
278 Ga0070689_100409977
279 Ga0070687_100003327
280 Ga0070661_100032853
281 Ga0070661_100098272
282 Ga0070692_10365909
283 Ga0070668_100132201
284 Ga0070668_100315380
285 Ga0070675_100274111
286 Ga0070671_100554082
287 Ga0070673_100063497
288 Ga0070673_100181741
289 Ga0070659_100006814
290 Ga0070709_10052253
291 Ga0070714_100439861
292 Ga0070713_100044141
293 Ga0070701_10138819
294 Ga0070701_10154871
295 Ga0070711_100023873
296 Ga0070711_100205519
297 Ga0070708_100000426
298 Ga0070708_100904056
299 Ga0070681_10040540
300 Ga0068867_100161536
301 Ga0070707_100182248
302 Ga0070698_100054715
303 Ga0070699_101251216
304 Ga0070679_100032712
305 Ga0070679_100104359
306 Ga0070684_100000967
307 Ga0068853_100034481
308 Ga0070672_100312453
309 Ga0070686_100213347
310 Ga0070686_100360508
311 Ga0070695_100018854
312 Ga0070695_100088113
313 Ga0070696_100002019
314 Ga0070704_100040790
315 Ga0070664_100030916
316 Ga0070664_100300756
317 Ga0068857_100010089
318 Ga0068856_100028406
319 Ga0068856_100069696
320 Ga0070702_100613054
321 Ga0068859_100892134
322 Ga0068864_100002504
323 Ga0068864_100007099
324 Ga0068864_100064889
325 Ga0068861_100580676
326 Ga0068863_100023076
327 Ga0068858_100247737
328 Ga0068860_100015241
329 Ga0081455_10000645
330 Ga0081455_10011964
331 Ga0081539_10017820
332 Ga0070715_10062595
333 Ga0097621_100317270
334 Ga0075433_10925779
335 Ga0075434_100405144
336 Ga0068865_100156294
337 Ga0075436_100140377
338 Ga0097620_100892137
339 Ga0075435_100354559
340 Ga0105250_10120402
341 Ga0105240_10905051
342 Ga0111539_10010889
343 Ga0114129_10034469
344 Ga0114129_10316040
345 Ga0114129_10652638
346 Ga0105243_10244447
347 Ga0105241_10732550
348 Ga0105248_10478928
349 Ga0105248_10660648
350 Ga0105249_10029052
351 Ga0105249_10541208
352 Ga0105239_10075550
353 Ga0105246_10041659
354 Ga0105246_10268688
355 Ga0157373_10046411
356 Ga0157371_10131727
357 Ga0157371_10261271
358 Ga0157370_10260130
359 Ga0157369_10881102
360 Ga0157374_10016488
361 Ga0157378_10013274
362 Ga0157378_10133215
363 Ga0157378_10205032
364 Ga0157378_10343675
365 Ga0163162_10114155
366 Ga0163162_10560645
367 Ga0163162_10573048
368 Ga0157372_10100208
369 Ga0157375_10254179
370 Ga0163163_10003820
371 Ga0163163_10011659
372 Ga0157380_10005088
373 Ga0157380_10730139
374 Ga0157377_10101438
375 Ga0157379_10069779
376 Ga0157376_10043012
377 Ga0157376_11846567
378 Ga0209672_100117
379 Ga0207427_100358
380 Ga0209437_100496
381 Ga0209258_100338
382 Ga0209148_1000309
383 Ga0209759_1000211
384 Ga0209233_1000443
385 Ga0209455_1000018
386 Ga0207697_10000971
387 Ga0207697_10010624
388 Ga0207692_10288214
389 Ga0207680_10021855
390 Ga0207699_10035328
391 Ga0207699_10373250
392 Ga0207707_10150034
393 Ga0207693_10012411
394 Ga0207663_10020830
395 Ga0207649_10055571
396 Ga0207652_10039738
397 Ga0207652_10163968
398 Ga0207646_10000943
399 Ga0207681_10144351
400 Ga0207650_10082412
401 Ga0207650_10127850
402 Ga0207700_10008341
403 Ga0207644_10266263
404 Ga0207644_10941759
405 Ga0207690_10062560
406 Ga0207670_10454073
407 Ga0207669_10530695
408 Ga0207665_10022488
409 Ga0207691_10000806
410 Ga0207691_10472397
411 Ga0207661_10328781
412 Ga0207679_10071053
413 Ga0207651_10352396
414 Ga0207640_10486832
415 Ga0207708_10819627
416 Ga0207702_10107538
417 Ga0207676_10004996
418 Ga0207676_10113686
419 Ga0207676_10114500
420 Ga0207674_10000499
421 Ga0207675_100543363
422 Ga0207698_11097021
423 Ga0207428_10004721
424 Ga0268266_10049619
425 Ga0268266_10249835
426 Ga0268266_10411985
427 Ga0268265_10297657
428 Ga0268264_10012947
429 Ga0268264_10014103
430 Ga0265765_1003005
431 Ga0265760_10003070
432 Ga0307416_100061005
433 Ga0373926_0229313
434 Ga0373956_0091341
435 Ga0373943_0042595
436 Ga0373943_0086771
437 Ga0373943_0409345
438 Ga0373955_0035871
439 Ga0373955_0732757
440 Ga0373935_0302411
441 Ga0373935_0621404
442 Ga0373927_0471293
443 Ga0373937_0393811
444 Ga0373937_0606344
445 Ga0373937_0863425
446 Ga0373925_0223293
447 Ga0373925_0270300
448 Ga0395900_0537300
449 Ga0395900_0901107
450 Ga0395905_0016625
451 Ga0395905_0713974
452 Ga0436360_1034799
453 Ga0451845_0593283
454 Ga0439455_0005178
455 Ga0439458_0024158
456 Ga0439435_0015187
457 Ga0453684_0236121
458 Ga0451576_0653224
459 Ga0495641_0032625
460 Ga0495651_0025069
461 Ga0495651_0275448
462 Ga0495584_0057103
463 Ga0495585_0279293
464 Ga0495608_0125701
465 Ga0495630_0121771
466 Ga0495586_0000777
467 Ga0495587_0049339
468 Ga0495667_0350291
469 Ga0495634_0083983
470 Ga0495611_0229624
471 Ga0495659_0024681
472 Ga0495657_0352160
473 Ga0495623_0204151
474 Ga0495646_0169296
475 Ga0495658_0004383
476 Ga0495669_0022798
477 Ga0495669_0267575
478 Ga0495613_0087432
479 Ga0495613_0142811
480 Ga0495674_0584736
481 Ga0495675_0075853
482 Ga0495677_0144057
483 Ga0495684_0121343
484 Ga0496101_0405576
485 Ga0496102_0135729
486 Ga0496102_1143534
487 Ga0496104_0659130
488 Ga0496106_0036884
489 Ga0496106_0158833
490 Ga0496106_0618053
491 Ga0496108_0406195
492 Ga0496109_0012074
493 Ga0496109_0151435
494 Ga0496110_0225194
495 Ga0496112_0036965
496 Ga0496113_0012690
497 Ga0496113_0161609
498 Ga0496115_0963010
499 Ga0501040_0920153
500 Ga0501079_0117026
501 Ga0501079_0416203
502 Ga0501045_0517805
503 nmdc:mga05p37_645885_c1
504 nmdc:mga05p37_80742_c1
505 nmdc:mga09592_684555_c1
506 nmdc:mga06r32_215094_c1
507 nmdc:mga0n895_876499_c1
508 Ga0495601_0247417
509 Ga0500610_0223723
510 Ga0495655_0068760
511 Ga0495595_0409038
512 Ga0500583_0032805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

26

201

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7628 5 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7589 5 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7572 5 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7534 5 187
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7358 5 186
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7556 5 187 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7516 5 187 3.40.430.10
af_Q54FJ0_879_1544_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.7481 164 192 2.70.130.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7256 6 188 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7174 7 185 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4Q3WB29-F1-model_v4 Dihydrofolate reductase 0.8921 64 196 GO:0008703
GO:0009231
AF-A0A4Q3WB29-F1-model_v4 Dihydrofolate reductase 0.8857 64 196 GO:0008703
GO:0009231
AF-A0A2W4JST6-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.8647 55 187 GO:0008703
GO:0009231
AF-A0A813AQK8-F1-model_v4 YyaP protein 0.858 83 188 GO:0008703
GO:0009231
AF-A0A3D5SJ21-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.8571 83 188 GO:0008703
GO:0009231

Map