F366033

General Info

Members Datasets Scaffolds Average Seq Length
255 161 510 121

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0173243|Ga0501046_0173243_468_890
Length 140
Sequence MNIQNQSRTISQKSSGDWFEVCRVEDLPENGGVCVKYGEEQIALFYFTRRKEWYATQNQCPHKRQMALSRGMIGSCGEEPKIACPFHKKTFSLVTGQCLNGDDCSIRTYPVKVESGLVFIGIGAVQLTPDSAQLPMALPA

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
148 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 2738541302 Pedobacter sp. CF074 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0
Rhizoplane 1.57
Rhizosphere 87.84
Stem 0
Stem Tuber 0
Unclassified 15.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0173243 3300049580 Bacteria 1618
2 SwRhRL2b_contig_2086455 2162886007 Bacteria 1126
3 SwRhRL2b_contig_282216 2162886007 Bacteria 5761
4 JGI25152J39213_1000062 3300002773 Bacteria 72854
5 JGI25150J39212_1000001 3300002774 Bacteria 1318726
6 JGI25151J46595_10000001 3300003187 Bacteria 887211
7 JGI25153J46596_10000001 3300003215 Bacteria 748985
8 rootL2_10355131 3300003322 Bacteria 1153
9 Ga0055536_1000003 3300003781 Bacteria 447744
10 Ga0055530_10015311 3300003791 Bacteria 2510
11 Ga0065714_10027601 3300005288 Bacteria 1298
12 Ga0065714_10064437 3300005288 Bacteria 115817
13 Ga0065714_10076397 3300005288 Bacteria 2791
14 Ga0065704_10082493 3300005289 Bacteria 3581
15 Ga0065712_10004053 3300005290 Bacteria 3619
16 Ga0070658_10314683 3300005327 Bacteria 1336
17 Ga0070658_10454686 3300005327 Bacteria 1103
18 Ga0070658_10561191 3300005327 Unclassified 988
19 Ga0070683_100304405 3300005329 Bacteria 1516
20 Ga0070690_100236232 3300005330 Bacteria 1287
21 Ga0070670_101583450 3300005331 Bacteria 602
22 Ga0068869_100402335 3300005334 Bacteria 1126
23 Ga0068869_101053423 3300005334 Unclassified 710
24 Ga0070666_11031981 3300005335 Bacteria 610
25 Ga0070666_11359144 3300005335 Unclassified 530
26 Ga0068868_100254689 3300005338 Bacteria 1478
27 Ga0070689_100035442 3300005340 Bacteria 3813
28 Ga0070668_100059292 3300005347 Bacteria 2962
29 Ga0070674_100300217 3300005356 Unclassified 1280
30 Ga0070674_101291978 3300005356 Bacteria 650
31 Ga0070673_100127663 3300005364 Bacteria 2129
32 Ga0070673_100232960 3300005364 Bacteria 1598
33 Ga0070673_101750548 3300005364 Bacteria 588
34 Ga0070688_100019244 3300005365 Bacteria 3954
35 Ga0070667_100141806 3300005367 Bacteria 2105
36 Ga0070667_100175725 3300005367 Bacteria 1892
37 Ga0070667_100499725 3300005367 Bacteria 1115
38 Ga0070667_100572588 3300005367 Bacteria 1039
39 Ga0070667_100645097 3300005367 Bacteria 977
40 Ga0070667_101723063 3300005367 Unclassified 589
41 Ga0070678_100697369 3300005456 Bacteria 914
42 Ga0070678_100748036 3300005456 Unclassified 884
43 Ga0070662_100597493 3300005457 Unclassified 928
44 Ga0068867_100025882 3300005459 Bacteria 4209
45 Ga0068867_100544097 3300005459 Unclassified 1005
46 Ga0068867_100680103 3300005459 Unclassified 906
47 Ga0068867_102356559 3300005459 Bacteria 506
48 Ga0070685_10016054 3300005466 Bacteria 3983
49 Ga0070698_101171499 3300005471 Bacteria 718
50 Ga0068853_100173881 3300005539 Bacteria 1950
51 Ga0068853_100539270 3300005539 Bacteria 1104
52 Ga0068853_102120696 3300005539 Unclassified 545
53 Ga0070672_100440875 3300005543 Bacteria 1121
54 Ga0070686_100212942 3300005544 Bacteria 1392
55 Ga0070665_100881070 3300005548 Bacteria 908
56 Ga0070665_102240757 3300005548 Bacteria 550
57 Ga0070664_100312193 3300005564 Unclassified 1423
58 Ga0068854_101692529 3300005578 Bacteria 578
59 Ga0068852_100786379 3300005616 Bacteria 965
60 Ga0068852_101633239 3300005616 Bacteria 667
61 Ga0068852_101705637 3300005616 Bacteria 652
62 Ga0068859_100052680 3300005617 Bacteria 4092
63 Ga0068859_100653621 3300005617 Bacteria 1143
64 Ga0068864_100280653 3300005618 Bacteria 1554
65 Ga0068864_100388181 3300005618 Bacteria 1325
66 Ga0068866_10218632 3300005718 Unclassified 1148
67 Ga0068861_100052997 3300005719 Bacteria 3085
68 Ga0068861_100061556 3300005719 Bacteria 2881
69 Ga0068861_100332991 3300005719 Bacteria 1326
70 Ga0068863_100022447 3300005841 Bacteria 6028
71 Ga0068863_100405629 3300005841 Bacteria 1334
72 Ga0068863_100518371 3300005841 Bacteria 1175
73 Ga0068858_100040892 3300005842 Bacteria 4300
74 Ga0068858_100980436 3300005842 Bacteria 828
75 Ga0068860_100579004 3300005843 Bacteria 1127
76 Ga0068860_100834244 3300005843 Bacteria 936
77 Ga0075427_10094345 3300006194 Unclassified 552
78 Ga0068871_100358284 3300006358 Bacteria 1291
79 Ga0075428_100007604 3300006844 Bacteria 12011
80 Ga0075428_100364641 3300006844 Bacteria 1550
81 Ga0075430_100009740 3300006846 Bacteria 8123
82 Ga0075429_100602445 3300006880 Bacteria 963
83 Ga0097620_100052680 3300006931 Bacteria 4092
84 Ga0097620_100653516 3300006931 Bacteria 1143
85 Ga0105244_10230704 3300009036 Bacteria 866
86 Ga0105240_10278220 3300009093 Bacteria 1924
87 Ga0111539_10392158 3300009094 Unclassified 1617
88 Ga0111539_10501031 3300009094 Bacteria 1414
89 Ga0105242_10109556 3300009176 Bacteria 2351
90 Ga0105242_10149115 3300009176 Bacteria 2038
91 Ga0105242_10243072 3300009176 Bacteria 1619
92 Ga0105242_10767081 3300009176 Bacteria 951
93 Ga0105248_10694127 3300009177 Unclassified 1148
94 Ga0105249_10000878 3300009553 Bacteria 26707
95 Ga0105239_10399988 3300010375 Bacteria 1554
96 Ga0105239_10784680 3300010375 Unclassified 1091
97 Ga0157373_10026337 3300013100 Bacteria 4201
98 Ga0157371_10000009 3300013102 Bacteria 392895
99 Ga0157370_10000304 3300013104 Bacteria 61764
100 Ga0157370_10008414 3300013104 Bacteria 11130
101 Ga0157370_10516163 3300013104 Unclassified 1097
102 Ga0157370_10634725 3300013104 Bacteria 977
103 Ga0157369_10000006 3300013105 Bacteria 412230
104 Ga0157369_10077551 3300013105 Unclassified 3561
105 Ga0157369_10220541 3300013105 Bacteria 1985
106 Ga0157374_10288308 3300013296 Bacteria 1622
107 Ga0157374_10311640 3300013296 Bacteria 1558
108 Ga0157378_10468983 3300013297 Bacteria 1253
109 Ga0163162_10000663 3300013306 Bacteria 31885
110 Ga0163162_10037997 3300013306 Bacteria 4805
111 Ga0163162_10261563 3300013306 Bacteria 1862
112 Ga0163162_10313315 3300013306 Unclassified 1702
113 Ga0163162_10862367 3300013306 Bacteria 1020
114 Ga0157372_10150314 3300013307 Bacteria 2688
115 Ga0157375_10004408 3300013308 Bacteria 12222
116 Ga0157375_10729889 3300013308 Unclassified 1143
117 Ga0157375_11078734 3300013308 Bacteria 939
118 Ga0163163_10205658 3300014325 Bacteria 2017
119 Ga0163163_10248024 3300014325 Unclassified 1831
120 Ga0157380_12210873 3300014326 Bacteria 614
121 Ga0157380_13493293 3300014326 Unclassified 503
122 Ga0182008_10000588 3300014497 Bacteria 26837
123 Ga0157377_10858504 3300014745 Unclassified 675
124 Ga0157379_10056384 3300014968 Unclassified 3511
125 Ga0157379_10554680 3300014968 Unclassified 1069
126 Ga0157376_10203796 3300014969 Bacteria 1822
127 Ga0157376_10343125 3300014969 Bacteria 1427
128 Ga0182006_1000238 3300015261 Bacteria 51972
129 Ga0182006_1000995 3300015261 Bacteria 18555
130 Ga0182007_10000001 3300015262 Bacteria 1127301
131 Ga0163161_10000276 3300017792 Bacteria 45031
132 Ga0163161_10000341 3300017792 Bacteria 39792
133 Ga0163161_10001455 3300017792 Bacteria 17485
134 Ga0163161_10020658 3300017792 Bacteria 4624
135 Ga0163161_10180834 3300017792 Bacteria 1617
136 Ga0207425_1000002 3300025245 Bacteria 1362590
137 Ga0209129_1000002 3300025258 Bacteria 1359086
138 Ga0209676_1000001 3300025292 Bacteria 1852142
139 Ga0209025_1000004 3300025294 Bacteria 1361782
140 Ga0209758_1000006 3300025297 Bacteria 1359562
141 Ga0209050_1000016 3300025298 Bacteria 729149
142 Ga0207697_10494636 3300025315 Bacteria 540
143 Ga0207642_10017584 3300025899 Unclassified 2723
144 Ga0207642_10085664 3300025899 Unclassified 1542
145 Ga0207680_10207783 3300025903 Bacteria 1337
146 Ga0207680_10750715 3300025903 Unclassified 699
147 Ga0207680_11086778 3300025903 Unclassified 572
148 Ga0207645_10077981 3300025907 Bacteria 2123
149 Ga0207645_10135728 3300025907 Bacteria 1602
150 Ga0207654_11148630 3300025911 Bacteria 566
151 Ga0207654_11418524 3300025911 Bacteria 506
152 Ga0207695_10047803 3300025913 Bacteria 4523
153 Ga0207671_10077577 3300025914 Bacteria 2487
154 Ga0207681_10296859 3300025923 Bacteria 1277
155 Ga0207650_10073433 3300025925 Bacteria 2576
156 Ga0207650_11380827 3300025925 Unclassified 599
157 Ga0207706_10082046 3300025933 Bacteria 2834
158 Ga0207686_10067015 3300025934 Bacteria 2295
159 Ga0207670_10016481 3300025936 Bacteria 4442
160 Ga0207669_10315384 3300025937 Unclassified 1194
161 Ga0207691_10192263 3300025940 Bacteria 1779
162 Ga0207691_10372467 3300025940 Bacteria 1220
163 Ga0207691_11432445 3300025940 Unclassified 567
164 Ga0207689_10009533 3300025942 Bacteria 8379
165 Ga0207661_10056907 3300025944 Bacteria 3142
166 Ga0207651_10202166 3300025960 Bacteria 1593
167 Ga0207651_11488488 3300025960 Bacteria 610
168 Ga0207712_10000496 3300025961 Bacteria 32480
169 Ga0207712_10069466 3300025961 Unclassified 2527
170 Ga0207668_10250074 3300025972 Bacteria 1439
171 Ga0207658_10233653 3300025986 Bacteria 1553
172 Ga0207658_10690625 3300025986 Bacteria 922
173 Ga0207658_10797605 3300025986 Bacteria 857
174 Ga0207658_11422462 3300025986 Unclassified 634
175 Ga0207658_11594566 3300025986 Bacteria 597
176 Ga0207677_10194878 3300026023 Bacteria 1606
177 Ga0207703_10073271 3300026035 Bacteria 2833
178 Ga0207703_10283636 3300026035 Bacteria 1505
179 Ga0207639_10057254 3300026041 Bacteria 2992
180 Ga0207639_10782579 3300026041 Unclassified 888
181 Ga0207641_10013546 3300026088 Bacteria 6690
182 Ga0207641_10567421 3300026088 Bacteria 1108
183 Ga0207648_10026328 3300026089 Bacteria 5170
184 Ga0207648_10032865 3300026089 Bacteria 4578
185 Ga0207648_10803624 3300026089 Unclassified 875
186 Ga0207648_11133387 3300026089 Bacteria 734
187 Ga0207676_10234674 3300026095 Bacteria 1642
188 Ga0207674_11459902 3300026116 Bacteria 653
189 Ga0207674_11811699 3300026116 Bacteria 577
190 Ga0207675_100015203 3300026118 Bacteria 7180
191 Ga0207675_100073932 3300026118 Bacteria 3189
192 Ga0207675_100174567 3300026118 Bacteria 2056
193 Ga0207683_10520744 3300026121 Bacteria 1099
194 Ga0207683_11647431 3300026121 Bacteria 591
195 Ga0207428_10520123 3300027907 Bacteria 863
196 Ga0268264_10050840 3300028381 Bacteria 3452
197 Ga0268264_10193639 3300028381 Bacteria 1855
198 Ga0307515_10060829 3300028794 Bacteria 5376
199 Ga0316181_1269746 3300030744 Bacteria 706
200 Ga0307405_10000018 3300031731 Bacteria 182495
201 Ga0307407_10000076 3300031903 Bacteria 34994
202 Ga0307412_10186158 3300031911 Bacteria 1566
203 Ga0307409_100117279 3300031995 Bacteria 2246
204 Ga0307409_102026445 3300031995 Bacteria 605
205 Ga0307416_100000025 3300032002 Bacteria 178154
206 Ga0307414_10023594 3300032004 Bacteria 3905
207 Ga0307414_10051873 3300032004 Bacteria 2851
208 Ga0307414_10065846 3300032004 Bacteria 2587
209 Ga0307414_10080684 3300032004 Bacteria 2380
210 Ga0307414_11468667 3300032004 Bacteria 634
211 Ga0451807_0269186 3300041486 Bacteria 870
212 Ga0466964_0761609 3300044706 Unclassified 544
213 Ga0495638_0310310 3300046460 Unclassified 847
214 Ga0495610_0000028 3300046512 Bacteria 272572
215 Ga0495630_0373573 3300046517 Bacteria 1092
216 Ga0495637_0047341 3300046520 Bacteria 1815
217 Ga0495609_0018600 3300046538 Bacteria 3219
218 Ga0495633_0108931 3300046558 Bacteria 1284
219 Ga0495613_0555541 3300046689 Unclassified 768
220 Ga0496101_0629355 3300048904 Bacteria 848
221 Ga0496114_1620311 3300048917 Bacteria 535
222 Ga0496115_1120703 3300048918 Bacteria 595
223 Ga0496117_0001255 3300048920 Bacteria 37776
224 Ga0496118_0014833 3300048921 Bacteria 7264
225 Ga0496122_0000625 3300048925 Bacteria 72309
226 Ga0496122_0011080 3300048925 Bacteria 9194
227 Ga0496123_0005294 3300048926 Bacteria 13072
228 Ga0496123_0006652 3300048926 Bacteria 11146
229 Ga0496125_0240589 3300048928 Bacteria 1150
230 Ga0501032_0193303 3300049569 Bacteria 1330
231 Ga0501034_0002192 3300049571 Bacteria 24178
232 Ga0501034_0236546 3300049571 Bacteria 1774
233 Ga0501036_0715530 3300049572 Bacteria 827
234 Ga0501043_0271431 3300049579 Bacteria 1302
235 Ga0501067_0211989 3300049583 Bacteria 1079
236 Ga0501070_0089097 3300049586 Bacteria 2553
237 Ga0501073_0071686 3300049589 Bacteria 2413
238 Ga0501080_1265728 3300049742 Bacteria 632
239 Ga0501083_0019118 3300049744 Bacteria 4770
240 Ga0501241_001563 3300049758 Bacteria 4596
241 Ga0501280_093599 3300049776 Bacteria 569
242 Ga0501044_0083658 3300049823 Bacteria 3227
243 Ga0501044_0466549 3300049823 Bacteria 1167
244 nmdc:mga09592_25240_c1 3300050508 Bacteria 4918
245 nmdc:mga0qj67_23316_c1 3300050509 Bacteria 4760
246 nmdc:mga06r32_90941_c1 3300050510 Bacteria 2982
247 nmdc:mga08y16_875858_c1 3300050511 Unclassified 886
248 Ga0500641_0001197 3300053096 Bacteria 9243
249 Ga0500562_058933 3300053108 Bacteria 1031
250 Ga0500628_172294 3300053129 Bacteria 615
251 Ga0500568_0001302 3300053139 Bacteria 16386
252 Ga0500611_000124 3300053727 Bacteria 16507
253 Ga0501084_0088446 3300054114 Bacteria 2600
254 Ga0501082_0068300 3300060353 Bacteria 3060
255 2738855981 2738541302 Bacteria 5944758
256 Ga0501046_0173243
257 SwRhRL2b_contig_2086455
258 SwRhRL2b_contig_282216
259 JGI25152J39213_1000062
260 JGI25150J39212_1000001
261 JGI25151J46595_10000001
262 JGI25153J46596_10000001
263 rootL2_10355131
264 Ga0055536_1000003
265 Ga0055530_10015311
266 Ga0065714_10027601
267 Ga0065714_10064437
268 Ga0065714_10076397
269 Ga0065704_10082493
270 Ga0065712_10004053
271 Ga0070658_10314683
272 Ga0070658_10454686
273 Ga0070658_10561191
274 Ga0070683_100304405
275 Ga0070690_100236232
276 Ga0070670_101583450
277 Ga0068869_100402335
278 Ga0068869_101053423
279 Ga0070666_11031981
280 Ga0070666_11359144
281 Ga0068868_100254689
282 Ga0070689_100035442
283 Ga0070668_100059292
284 Ga0070674_100300217
285 Ga0070674_101291978
286 Ga0070673_100127663
287 Ga0070673_100232960
288 Ga0070673_101750548
289 Ga0070688_100019244
290 Ga0070667_100141806
291 Ga0070667_100175725
292 Ga0070667_100499725
293 Ga0070667_100572588
294 Ga0070667_100645097
295 Ga0070667_101723063
296 Ga0070678_100697369
297 Ga0070678_100748036
298 Ga0070662_100597493
299 Ga0068867_100025882
300 Ga0068867_100544097
301 Ga0068867_100680103
302 Ga0068867_102356559
303 Ga0070685_10016054
304 Ga0070698_101171499
305 Ga0068853_100173881
306 Ga0068853_100539270
307 Ga0068853_102120696
308 Ga0070672_100440875
309 Ga0070686_100212942
310 Ga0070665_100881070
311 Ga0070665_102240757
312 Ga0070664_100312193
313 Ga0068854_101692529
314 Ga0068852_100786379
315 Ga0068852_101633239
316 Ga0068852_101705637
317 Ga0068859_100052680
318 Ga0068859_100653621
319 Ga0068864_100280653
320 Ga0068864_100388181
321 Ga0068866_10218632
322 Ga0068861_100052997
323 Ga0068861_100061556
324 Ga0068861_100332991
325 Ga0068863_100022447
326 Ga0068863_100405629
327 Ga0068863_100518371
328 Ga0068858_100040892
329 Ga0068858_100980436
330 Ga0068860_100579004
331 Ga0068860_100834244
332 Ga0075427_10094345
333 Ga0068871_100358284
334 Ga0075428_100007604
335 Ga0075428_100364641
336 Ga0075430_100009740
337 Ga0075429_100602445
338 Ga0097620_100052680
339 Ga0097620_100653516
340 Ga0105244_10230704
341 Ga0105240_10278220
342 Ga0111539_10392158
343 Ga0111539_10501031
344 Ga0105242_10109556
345 Ga0105242_10149115
346 Ga0105242_10243072
347 Ga0105242_10767081
348 Ga0105248_10694127
349 Ga0105249_10000878
350 Ga0105239_10399988
351 Ga0105239_10784680
352 Ga0157373_10026337
353 Ga0157371_10000009
354 Ga0157370_10000304
355 Ga0157370_10008414
356 Ga0157370_10516163
357 Ga0157370_10634725
358 Ga0157369_10000006
359 Ga0157369_10077551
360 Ga0157369_10220541
361 Ga0157374_10288308
362 Ga0157374_10311640
363 Ga0157378_10468983
364 Ga0163162_10000663
365 Ga0163162_10037997
366 Ga0163162_10261563
367 Ga0163162_10313315
368 Ga0163162_10862367
369 Ga0157372_10150314
370 Ga0157375_10004408
371 Ga0157375_10729889
372 Ga0157375_11078734
373 Ga0163163_10205658
374 Ga0163163_10248024
375 Ga0157380_12210873
376 Ga0157380_13493293
377 Ga0182008_10000588
378 Ga0157377_10858504
379 Ga0157379_10056384
380 Ga0157379_10554680
381 Ga0157376_10203796
382 Ga0157376_10343125
383 Ga0182006_1000238
384 Ga0182006_1000995
385 Ga0182007_10000001
386 Ga0163161_10000276
387 Ga0163161_10000341
388 Ga0163161_10001455
389 Ga0163161_10020658
390 Ga0163161_10180834
391 Ga0207425_1000002
392 Ga0209129_1000002
393 Ga0209676_1000001
394 Ga0209025_1000004
395 Ga0209758_1000006
396 Ga0209050_1000016
397 Ga0207697_10494636
398 Ga0207642_10017584
399 Ga0207642_10085664
400 Ga0207680_10207783
401 Ga0207680_10750715
402 Ga0207680_11086778
403 Ga0207645_10077981
404 Ga0207645_10135728
405 Ga0207654_11148630
406 Ga0207654_11418524
407 Ga0207695_10047803
408 Ga0207671_10077577
409 Ga0207681_10296859
410 Ga0207650_10073433
411 Ga0207650_11380827
412 Ga0207706_10082046
413 Ga0207686_10067015
414 Ga0207670_10016481
415 Ga0207669_10315384
416 Ga0207691_10192263
417 Ga0207691_10372467
418 Ga0207691_11432445
419 Ga0207689_10009533
420 Ga0207661_10056907
421 Ga0207651_10202166
422 Ga0207651_11488488
423 Ga0207712_10000496
424 Ga0207712_10069466
425 Ga0207668_10250074
426 Ga0207658_10233653
427 Ga0207658_10690625
428 Ga0207658_10797605
429 Ga0207658_11422462
430 Ga0207658_11594566
431 Ga0207677_10194878
432 Ga0207703_10073271
433 Ga0207703_10283636
434 Ga0207639_10057254
435 Ga0207639_10782579
436 Ga0207641_10013546
437 Ga0207641_10567421
438 Ga0207648_10026328
439 Ga0207648_10032865
440 Ga0207648_10803624
441 Ga0207648_11133387
442 Ga0207676_10234674
443 Ga0207674_11459902
444 Ga0207674_11811699
445 Ga0207675_100015203
446 Ga0207675_100073932
447 Ga0207675_100174567
448 Ga0207683_10520744
449 Ga0207683_11647431
450 Ga0207428_10520123
451 Ga0268264_10050840
452 Ga0268264_10193639
453 Ga0307515_10060829
454 Ga0316181_1269746
455 Ga0307405_10000018
456 Ga0307407_10000076
457 Ga0307412_10186158
458 Ga0307409_100117279
459 Ga0307409_102026445
460 Ga0307416_100000025
461 Ga0307414_10023594
462 Ga0307414_10051873
463 Ga0307414_10065846
464 Ga0307414_10080684
465 Ga0307414_11468667
466 Ga0451807_0269186
467 Ga0466964_0761609
468 Ga0495638_0310310
469 Ga0495610_0000028
470 Ga0495630_0373573
471 Ga0495637_0047341
472 Ga0495609_0018600
473 Ga0495633_0108931
474 Ga0495613_0555541
475 Ga0496101_0629355
476 Ga0496114_1620311
477 Ga0496115_1120703
478 Ga0496117_0001255
479 Ga0496118_0014833
480 Ga0496122_0000625
481 Ga0496122_0011080
482 Ga0496123_0005294
483 Ga0496123_0006652
484 Ga0496125_0240589
485 Ga0501032_0193303
486 Ga0501034_0002192
487 Ga0501034_0236546
488 Ga0501036_0715530
489 Ga0501043_0271431
490 Ga0501067_0211989
491 Ga0501070_0089097
492 Ga0501073_0071686
493 Ga0501080_1265728
494 Ga0501083_0019118
495 Ga0501241_001563
496 Ga0501280_093599
497 Ga0501044_0083658
498 Ga0501044_0466549
499 nmdc:mga09592_25240_c1
500 nmdc:mga0qj67_23316_c1
501 nmdc:mga06r32_90941_c1
502 nmdc:mga08y16_875858_c1
503 Ga0500641_0001197
504 Ga0500562_058933
505 Ga0500628_172294
506 Ga0500568_0001302
507 Ga0500611_000124
508 Ga0501084_0088446
509 Ga0501082_0068300
510 2738855981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

17

121

0.98

PF00355

Rieske

Rieske [2Fe-2S] domain

17

110

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aiv-assembly1.cif.gz_A crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis 0.9518 11 119
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.9289 11 115
4aiv-assembly1.cif.gz_A crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis 0.9113 11 119
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.9041 11 115
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.902 13 115
ID Description Score Start End Superfamily
4aivA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9518 11 119 2.102.10.10
af_P0A9I8_1_108_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9446 11 117 2.102.10.10
af_P0A9I8_1_108_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9279 11 117 2.102.10.10
3c0dC00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9261 11 115 2.102.10.10
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9183 1 115 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A4R7CSL7-F1-model_v4 Assimilatory nitrite reductase (NAD(P)H) small subunit 0.9987 11 119 GO:0042128
GO:0046872
GO:0051537
AF-A0A5C6C1V4-F1-model_v4 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit 0.9979 45 115 GO:0042128
GO:0046872
GO:0051213
GO:0051537
AF-A0A2D1U2V3-F1-model_v4 Nitrite reductase (NAD(P)H) small subunit 0.9964 11 117 GO:0016491
GO:0042128
GO:0046872
GO:0051537
AF-A0A2T0U5S7-F1-model_v4 Assimilatory nitrite reductase (NAD(P)H) small subunit 0.9931 11 119 GO:0016491
GO:0042128
GO:0046872
GO:0051537
AF-A0A6M1NLN5-F1-model_v4 Nitrite reductase small subunit NirD 0.9885 11 117 GO:0016491
GO:0042128
GO:0046872
GO:0051537

Map