F365946

General Info

Members Datasets Scaffolds Average Seq Length
255 185 510 134

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0711102|Ga0495618_0711102_21_455
Length 144
Sequence MATMADLDELALSMPQTTKDVSEDGRPSYLVHGKIFCFHRSRRPDAVDPATGERLADVLMLRVEDTGVKELMLADPRAIFFTTPHFDGYPAVLMRIPDLVRLDREELRDIVVEAWMTRAQKRVAKAWLAENEPDRDQRTVDFRT

Samples

Sample ID Description Type Environment
1 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
99 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.49
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 14.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495618_0711102 3300046514 Bacteria 590
2 Ga0070683_100161814 3300005329 Bacteria 2124
3 Ga0070683_101243756 3300005329 Bacteria 715
4 Ga0070690_101474205 3300005330 Bacteria 549
5 Ga0070680_100070385 3300005336 Bacteria 2873
6 Ga0068868_100488478 3300005338 Unclassified 1077
7 Ga0070660_100031163 3300005339 Bacteria 4003
8 Ga0070660_100415738 3300005339 Unclassified 1113
9 Ga0070689_100414475 3300005340 Bacteria 1141
10 Ga0070691_10041654 3300005341 Bacteria 2172
11 Ga0070661_100160578 3300005344 Bacteria 1702
12 Ga0070661_100537953 3300005344 Bacteria 939
13 Ga0070675_100781240 3300005354 Unclassified 872
14 Ga0070674_100456243 3300005356 Unclassified 1056
15 Ga0070659_100138889 3300005366 Bacteria 1978
16 Ga0070659_100366085 3300005366 Unclassified 1212
17 Ga0070714_101299738 3300005435 Bacteria 710
18 Ga0070701_10185001 3300005438 Bacteria 1222
19 Ga0070711_100396555 3300005439 Bacteria 1119
20 Ga0070705_100065909 3300005440 Bacteria 2170
21 Ga0070700_100105289 3300005441 Unclassified 1865
22 Ga0070663_101281592 3300005455 Unclassified 646
23 Ga0070681_10009487 3300005458 Bacteria 9578
24 Ga0070681_10658433 3300005458 Unclassified 962
25 Ga0070685_10151005 3300005466 Bacteria 1472
26 Ga0070685_11210780 3300005466 Bacteria 574
27 Ga0070679_100079802 3300005530 Bacteria 3262
28 Ga0070679_100221209 3300005530 Bacteria 1854
29 Ga0070679_101074080 3300005530 Bacteria 749
30 Ga0070684_100122869 3300005535 Bacteria 2336
31 Ga0070697_102083790 3300005536 Bacteria 508
32 Ga0068853_100545107 3300005539 Bacteria 1098
33 Ga0070686_100192006 3300005544 Unclassified 1458
34 Ga0070696_100055957 3300005546 Bacteria 2751
35 Ga0070696_100540871 3300005546 Bacteria 932
36 Ga0070693_100441896 3300005547 Bacteria 911
37 Ga0070693_100648254 3300005547 Bacteria 768
38 Ga0070704_101174690 3300005549 Bacteria 699
39 Ga0068852_100281688 3300005616 Bacteria 1603
40 Ga0068852_100571963 3300005616 Bacteria 1132
41 Ga0068866_10427246 3300005718 Bacteria 861
42 Ga0081455_10010177 3300005937 Bacteria 9574
43 Ga0081455_10042883 3300005937 Bacteria 3964
44 Ga0070717_10883034 3300006028 Bacteria 814
45 Ga0070717_11748869 3300006028 Unclassified 562
46 Ga0070712_100997107 3300006175 Unclassified 725
47 Ga0075435_100508405 3300007076 Bacteria 1042
48 Ga0075435_101417684 3300007076 Bacteria 609
49 Ga0105245_10236218 3300009098 Unclassified 1770
50 Ga0114129_10699054 3300009147 Bacteria 1303
51 Ga0105243_10036800 3300009148 Unclassified 3801
52 Ga0105243_10377779 3300009148 Bacteria 1310
53 Ga0105242_10041172 3300009176 Bacteria 3725
54 Ga0105242_10089865 3300009176 Bacteria 2582
55 Ga0105242_11367824 3300009176 Bacteria 734
56 Ga0105238_12261966 3300009551 Bacteria 579
57 Ga0105239_10074317 3300010375 Unclassified 3737
58 Ga0105246_10380484 3300011119 Bacteria 1166
59 Ga0105246_12391408 3300011119 Bacteria 518
60 Ga0157340_1013451 3300012473 Bacteria 614
61 Ga0157370_10175272 3300013104 Bacteria 1993
62 Ga0163162_12113789 3300013306 Bacteria 646
63 Ga0157372_11550078 3300013307 Bacteria 763
64 Ga0157375_11614367 3300013308 Bacteria 767
65 Ga0182008_10047889 3300014497 Bacteria 2123
66 Ga0182008_10089862 3300014497 Bacteria 1514
67 Ga0182008_10426728 3300014497 Bacteria 717
68 Ga0182006_1216256 3300015261 Unclassified 632
69 Ga0182005_1241392 3300015265 Unclassified 556
70 Ga0206356_11820454 3300020070 Bacteria 2128
71 Ga0206353_10105895 3300020082 Bacteria 1217
72 Ga0207688_10008534 3300025901 Bacteria 5577
73 Ga0207643_10344325 3300025908 Bacteria 935
74 Ga0207654_10929347 3300025911 Bacteria 631
75 Ga0207707_10029610 3300025912 Bacteria 4787
76 Ga0207707_10165851 3300025912 Bacteria 1930
77 Ga0207707_10510934 3300025912 Unclassified 1024
78 Ga0207693_10050346 3300025915 Bacteria 3271
79 Ga0207660_10142840 3300025917 Bacteria 1831
80 Ga0207657_10012673 3300025919 Bacteria 8310
81 Ga0207657_10395255 3300025919 Unclassified 1087
82 Ga0207649_10140944 3300025920 Bacteria 1650
83 Ga0207652_10205225 3300025921 Bacteria 1774
84 Ga0207652_10220197 3300025921 Bacteria 1710
85 Ga0207694_10258304 3300025924 Bacteria 1427
86 Ga0207687_10718639 3300025927 Bacteria 849
87 Ga0207700_10262640 3300025928 Bacteria 1479
88 Ga0207664_10156477 3300025929 Bacteria 1941
89 Ga0207690_11331806 3300025932 Bacteria 600
90 Ga0207686_10537153 3300025934 Bacteria 912
91 Ga0207670_10307599 3300025936 Unclassified 1243
92 Ga0207670_10363471 3300025936 Bacteria 1149
93 Ga0207661_10640184 3300025944 Unclassified 977
94 Ga0207679_10095054 3300025945 Unclassified 2315
95 Ga0207679_10102302 3300025945 Unclassified 2243
96 Ga0207712_11304772 3300025961 Bacteria 649
97 Ga0207677_10423131 3300026023 Unclassified 1135
98 Ga0207639_10667435 3300026041 Bacteria 963
99 Ga0207639_11286674 3300026041 Bacteria 686
100 Ga0207678_11033837 3300026067 Unclassified 727
101 Ga0207708_10188590 3300026075 Bacteria 1640
102 Ga0207674_10085086 3300026116 Unclassified 3159
103 Ga0207683_10581782 3300026121 Bacteria 1036
104 Ga0207698_10025454 3300026142 Bacteria 4170
105 Ga0207698_10567464 3300026142 Unclassified 1115
106 Ga0207698_10769723 3300026142 Bacteria 963
107 Ga0265326_10009095 3300028558 Bacteria 2976
108 Ga0265318_10162363 3300028577 Bacteria 819
109 Ga0265338_10010758 3300028800 Bacteria 10675
110 Ga0265338_10720685 3300028800 Bacteria 687
111 Ga0265332_10162393 3300031238 Bacteria 933
112 Ga0265320_10314234 3300031240 Bacteria 693
113 Ga0265325_10003971 3300031241 Bacteria 9468
114 Ga0265340_10014474 3300031247 Bacteria 4118
115 Ga0265340_10368636 3300031247 Bacteria 634
116 Ga0265339_10088931 3300031249 Bacteria 1621
117 Ga0265331_10090970 3300031250 Bacteria 1410
118 Ga0265316_10011546 3300031344 Bacteria 7953
119 Ga0265313_10007769 3300031595 Bacteria 7251
120 Ga0265314_10006678 3300031711 Bacteria 10137
121 Ga0373953_0471637 3300035117 Bacteria 555
122 Ga0373956_0169495 3300035119 Bacteria 1030
123 Ga0373933_0332375 3300035724 Bacteria 986
124 Ga0395899_0577090 3300037312 Bacteria 719
125 Ga0395900_0537322 3300037418 Bacteria 1115
126 Ga0395900_0701797 3300037418 Bacteria 945
127 Ga0395898_0436489 3300037466 Bacteria 1247
128 Ga0395898_0672116 3300037466 Unclassified 978
129 Ga0395905_0084345 3300037471 Bacteria 2976
130 Ga0395901_0287591 3300038443 Bacteria 1706
131 Ga0395901_0438326 3300038443 Bacteria 1338
132 Ga0451787_597839 3300041441 Bacteria 566
133 Ga0439458_0030521 3300042157 Bacteria 1283
134 Ga0466963_0016135 3300044694 Bacteria 4641
135 Ga0466963_0383251 3300044694 Bacteria 991
136 Ga0466963_0931460 3300044694 Bacteria 612
137 Ga0466964_0037822 3300044706 Bacteria 1939
138 Ga0466968_0101550 3300044735 Bacteria 1284
139 Ga0466957_0079100 3300044842 Bacteria 2045
140 Ga0451576_0269986 3300045051 Unclassified 1778
141 Ga0466967_0000295 3300045976 Bacteria 22299
142 Ga0466967_0002581 3300045976 Bacteria 11375
143 Ga0466967_0018617 3300045976 Bacteria 5557
144 Ga0466967_0114333 3300045976 Bacteria 2484
145 Ga0466967_0436740 3300045976 Bacteria 1278
146 Ga0495592_0137235 3300046454 Bacteria 1704
147 Ga0495603_0082185 3300046455 Bacteria 1887
148 Ga0495651_0147504 3300046462 Unclassified 1699
149 Ga0495653_0088357 3300046463 Bacteria 2274
150 Ga0495582_0038496 3300046473 Bacteria 2632
151 Ga0495582_0248792 3300046473 Bacteria 1019
152 Ga0495664_0135493 3300046477 Bacteria 1492
153 Ga0495596_0131570 3300046500 Bacteria 971
154 Ga0495608_0023596 3300046511 Bacteria 4215
155 Ga0495618_0171305 3300046514 Bacteria 1381
156 Ga0495652_0164948 3300046529 Bacteria 1715
157 Ga0495665_0181721 3300046531 Bacteria 1093
158 Ga0495640_0414872 3300046533 Bacteria 825
159 Ga0495586_0019814 3300046535 Bacteria 3582
160 Ga0495587_0348575 3300046536 Bacteria 825
161 Ga0495587_0491543 3300046536 Unclassified 679
162 Ga0495609_0056003 3300046538 Bacteria 1748
163 Ga0495645_0154915 3300046543 Bacteria 1588
164 Ga0495667_0028268 3300046559 Bacteria 3775
165 Ga0495667_0061486 3300046559 Bacteria 2462
166 Ga0495667_0544902 3300046559 Archaea 725
167 Ga0495634_0040306 3300046642 Bacteria 3177
168 Ga0495634_0112643 3300046642 Bacteria 1748
169 Ga0495588_0092500 3300046674 Bacteria 1585
170 Ga0495657_0145250 3300046675 Bacteria 1476
171 Ga0495658_0008989 3300046683 Bacteria 4967
172 Ga0495613_0078064 3300046689 Bacteria 2409
173 Ga0495613_0110088 3300046689 Bacteria 1985
174 Ga0495613_0946520 3300046689 Bacteria 555
175 Ga0495671_0123859 3300046692 Bacteria 1261
176 Ga0495589_0207178 3300046794 Bacteria 924
177 Ga0495600_0074688 3300046809 Bacteria 2214
178 Ga0495600_0112510 3300046809 Bacteria 1773
179 Ga0495581_0759927 3300047315 Archaea 557
180 Ga0495604_0305984 3300047317 Unclassified 1066
181 Ga0495604_0389622 3300047317 Bacteria 919
182 Ga0495674_0081735 3300047319 Bacteria 2771
183 Ga0495674_0754157 3300047319 Archaea 760
184 Ga0495676_0121532 3300047321 Bacteria 1899
185 Ga0495680_0114765 3300047322 Bacteria 1993
186 Ga0495680_0581293 3300047322 Bacteria 751
187 Ga0495675_0262836 3300047444 Bacteria 1033
188 Ga0495685_242572 3300047447 Bacteria 573
189 Ga0495684_0038994 3300047471 Bacteria 3641
190 Ga0496100_0332544 3300048903 Bacteria 1144
191 Ga0496102_0244610 3300048905 Bacteria 1691
192 Ga0496102_0877603 3300048905 Bacteria 819
193 Ga0496107_0335643 3300048910 Bacteria 1125
194 Ga0496107_0876460 3300048910 Bacteria 655
195 Ga0496108_1025478 3300048911 Bacteria 704
196 Ga0496109_0087287 3300048912 Bacteria 2881
197 Ga0496110_0163300 3300048913 Bacteria 2019
198 Ga0496111_0095290 3300048914 Unclassified 2184
199 Ga0496112_0739760 3300048915 Bacteria 910
200 Ga0496112_1326191 3300048915 Bacteria 635
201 Ga0496113_0183099 3300048916 Unclassified 1661
202 Ga0496114_0645758 3300048917 Bacteria 931
203 Ga0501031_0003642 3300049568 Bacteria 9914
204 Ga0501032_0037890 3300049569 Bacteria 3286
205 Ga0501036_0016222 3300049572 Bacteria 6221
206 Ga0501039_0002789 3300049575 Bacteria 13051
207 Ga0501039_0048602 3300049575 Bacteria 3279
208 Ga0501040_0005131 3300049576 Bacteria 8468
209 Ga0501041_0035256 3300049577 Bacteria 3031
210 Ga0501042_0004912 3300049578 Bacteria 8560
211 Ga0501043_0091409 3300049579 Bacteria 2393
212 Ga0501046_0127239 3300049580 Bacteria 1934
213 Ga0501046_0427264 3300049580 Bacteria 955
214 Ga0501047_0058173 3300049581 Bacteria 3735
215 Ga0501048_0018852 3300049582 Bacteria 5072
216 Ga0501067_0060018 3300049583 Bacteria 2105
217 Ga0501067_0091017 3300049583 Bacteria 1693
218 Ga0501068_0080635 3300049584 Bacteria 1997
219 Ga0501069_0152764 3300049585 Bacteria 1327
220 Ga0501069_0307333 3300049585 Bacteria 930
221 Ga0501069_0358343 3300049585 Bacteria 860
222 Ga0501070_0224746 3300049586 Unclassified 1539
223 Ga0501071_0002459 3300049587 Bacteria 11252
224 Ga0501072_0008518 3300049588 Bacteria 7779
225 Ga0501073_0334086 3300049589 Bacteria 1046
226 Ga0501074_0124121 3300049590 Bacteria 1846
227 Ga0501075_0008069 3300049591 Bacteria 7321
228 Ga0501076_0001380 3300049592 Bacteria 16264
229 Ga0501077_0446108 3300049593 Bacteria 828
230 Ga0501079_0009383 3300049741 Bacteria 7415
231 Ga0501080_0086245 3300049742 Bacteria 2917
232 Ga0501080_0506510 3300049742 Bacteria 1078
233 Ga0501081_0002744 3300049743 Bacteria 11159
234 Ga0501081_0168946 3300049743 Bacteria 1578
235 Ga0501083_0047780 3300049744 Bacteria 2891
236 Ga0501083_0390144 3300049744 Bacteria 906
237 Ga0501035_0278635 3300049822 Bacteria 1414
238 Ga0501044_0967909 3300049823 Bacteria 724
239 Ga0501045_0002906 3300049824 Bacteria 11707
240 nmdc:mga05p37_732261_c1 3300050507 Bacteria 1093
241 nmdc:mga0rr50_428881_c1 3300050513 Bacteria 1119
242 Ga0495601_0061714 3300053077 Bacteria 2379
243 Ga0495601_0101770 3300053077 Bacteria 1856
244 Ga0495601_0491503 3300053077 Unclassified 792
245 Ga0495612_0269001 3300053078 Bacteria 760
246 Ga0495612_0461868 3300053078 Bacteria 581
247 Ga0495595_0034374 3300053084 Bacteria 2292
248 Ga0495619_0115405 3300053085 Bacteria 1838
249 Ga0495619_0502614 3300053085 Bacteria 834
250 Ga0495619_0579605 3300053085 Unclassified 768
251 Ga0501084_0011044 3300054114 Bacteria 7479
252 Ga0501082_0010567 3300060353 Bacteria 7944
253 Ga0501082_0516857 3300060353 Bacteria 1044
254 Ga0530510_0012357 3300061734 Bacteria 5997
255 Ga0530510_0756619 3300061734 Unclassified 741
256 Ga0495618_0711102
257 Ga0070683_100161814
258 Ga0070683_101243756
259 Ga0070690_101474205
260 Ga0070680_100070385
261 Ga0068868_100488478
262 Ga0070660_100031163
263 Ga0070660_100415738
264 Ga0070689_100414475
265 Ga0070691_10041654
266 Ga0070661_100160578
267 Ga0070661_100537953
268 Ga0070675_100781240
269 Ga0070674_100456243
270 Ga0070659_100138889
271 Ga0070659_100366085
272 Ga0070714_101299738
273 Ga0070701_10185001
274 Ga0070711_100396555
275 Ga0070705_100065909
276 Ga0070700_100105289
277 Ga0070663_101281592
278 Ga0070681_10009487
279 Ga0070681_10658433
280 Ga0070685_10151005
281 Ga0070685_11210780
282 Ga0070679_100079802
283 Ga0070679_100221209
284 Ga0070679_101074080
285 Ga0070684_100122869
286 Ga0070697_102083790
287 Ga0068853_100545107
288 Ga0070686_100192006
289 Ga0070696_100055957
290 Ga0070696_100540871
291 Ga0070693_100441896
292 Ga0070693_100648254
293 Ga0070704_101174690
294 Ga0068852_100281688
295 Ga0068852_100571963
296 Ga0068866_10427246
297 Ga0081455_10010177
298 Ga0081455_10042883
299 Ga0070717_10883034
300 Ga0070717_11748869
301 Ga0070712_100997107
302 Ga0075435_100508405
303 Ga0075435_101417684
304 Ga0105245_10236218
305 Ga0114129_10699054
306 Ga0105243_10036800
307 Ga0105243_10377779
308 Ga0105242_10041172
309 Ga0105242_10089865
310 Ga0105242_11367824
311 Ga0105238_12261966
312 Ga0105239_10074317
313 Ga0105246_10380484
314 Ga0105246_12391408
315 Ga0157340_1013451
316 Ga0157370_10175272
317 Ga0163162_12113789
318 Ga0157372_11550078
319 Ga0157375_11614367
320 Ga0182008_10047889
321 Ga0182008_10089862
322 Ga0182008_10426728
323 Ga0182006_1216256
324 Ga0182005_1241392
325 Ga0206356_11820454
326 Ga0206353_10105895
327 Ga0207688_10008534
328 Ga0207643_10344325
329 Ga0207654_10929347
330 Ga0207707_10029610
331 Ga0207707_10165851
332 Ga0207707_10510934
333 Ga0207693_10050346
334 Ga0207660_10142840
335 Ga0207657_10012673
336 Ga0207657_10395255
337 Ga0207649_10140944
338 Ga0207652_10205225
339 Ga0207652_10220197
340 Ga0207694_10258304
341 Ga0207687_10718639
342 Ga0207700_10262640
343 Ga0207664_10156477
344 Ga0207690_11331806
345 Ga0207686_10537153
346 Ga0207670_10307599
347 Ga0207670_10363471
348 Ga0207661_10640184
349 Ga0207679_10095054
350 Ga0207679_10102302
351 Ga0207712_11304772
352 Ga0207677_10423131
353 Ga0207639_10667435
354 Ga0207639_11286674
355 Ga0207678_11033837
356 Ga0207708_10188590
357 Ga0207674_10085086
358 Ga0207683_10581782
359 Ga0207698_10025454
360 Ga0207698_10567464
361 Ga0207698_10769723
362 Ga0265326_10009095
363 Ga0265318_10162363
364 Ga0265338_10010758
365 Ga0265338_10720685
366 Ga0265332_10162393
367 Ga0265320_10314234
368 Ga0265325_10003971
369 Ga0265340_10014474
370 Ga0265340_10368636
371 Ga0265339_10088931
372 Ga0265331_10090970
373 Ga0265316_10011546
374 Ga0265313_10007769
375 Ga0265314_10006678
376 Ga0373953_0471637
377 Ga0373956_0169495
378 Ga0373933_0332375
379 Ga0395899_0577090
380 Ga0395900_0537322
381 Ga0395900_0701797
382 Ga0395898_0436489
383 Ga0395898_0672116
384 Ga0395905_0084345
385 Ga0395901_0287591
386 Ga0395901_0438326
387 Ga0451787_597839
388 Ga0439458_0030521
389 Ga0466963_0016135
390 Ga0466963_0383251
391 Ga0466963_0931460
392 Ga0466964_0037822
393 Ga0466968_0101550
394 Ga0466957_0079100
395 Ga0451576_0269986
396 Ga0466967_0000295
397 Ga0466967_0002581
398 Ga0466967_0018617
399 Ga0466967_0114333
400 Ga0466967_0436740
401 Ga0495592_0137235
402 Ga0495603_0082185
403 Ga0495651_0147504
404 Ga0495653_0088357
405 Ga0495582_0038496
406 Ga0495582_0248792
407 Ga0495664_0135493
408 Ga0495596_0131570
409 Ga0495608_0023596
410 Ga0495618_0171305
411 Ga0495652_0164948
412 Ga0495665_0181721
413 Ga0495640_0414872
414 Ga0495586_0019814
415 Ga0495587_0348575
416 Ga0495587_0491543
417 Ga0495609_0056003
418 Ga0495645_0154915
419 Ga0495667_0028268
420 Ga0495667_0061486
421 Ga0495667_0544902
422 Ga0495634_0040306
423 Ga0495634_0112643
424 Ga0495588_0092500
425 Ga0495657_0145250
426 Ga0495658_0008989
427 Ga0495613_0078064
428 Ga0495613_0110088
429 Ga0495613_0946520
430 Ga0495671_0123859
431 Ga0495589_0207178
432 Ga0495600_0074688
433 Ga0495600_0112510
434 Ga0495581_0759927
435 Ga0495604_0305984
436 Ga0495604_0389622
437 Ga0495674_0081735
438 Ga0495674_0754157
439 Ga0495676_0121532
440 Ga0495680_0114765
441 Ga0495680_0581293
442 Ga0495675_0262836
443 Ga0495685_242572
444 Ga0495684_0038994
445 Ga0496100_0332544
446 Ga0496102_0244610
447 Ga0496102_0877603
448 Ga0496107_0335643
449 Ga0496107_0876460
450 Ga0496108_1025478
451 Ga0496109_0087287
452 Ga0496110_0163300
453 Ga0496111_0095290
454 Ga0496112_0739760
455 Ga0496112_1326191
456 Ga0496113_0183099
457 Ga0496114_0645758
458 Ga0501031_0003642
459 Ga0501032_0037890
460 Ga0501036_0016222
461 Ga0501039_0002789
462 Ga0501039_0048602
463 Ga0501040_0005131
464 Ga0501041_0035256
465 Ga0501042_0004912
466 Ga0501043_0091409
467 Ga0501046_0127239
468 Ga0501046_0427264
469 Ga0501047_0058173
470 Ga0501048_0018852
471 Ga0501067_0060018
472 Ga0501067_0091017
473 Ga0501068_0080635
474 Ga0501069_0152764
475 Ga0501069_0307333
476 Ga0501069_0358343
477 Ga0501070_0224746
478 Ga0501071_0002459
479 Ga0501072_0008518
480 Ga0501073_0334086
481 Ga0501074_0124121
482 Ga0501075_0008069
483 Ga0501076_0001380
484 Ga0501077_0446108
485 Ga0501079_0009383
486 Ga0501080_0086245
487 Ga0501080_0506510
488 Ga0501081_0002744
489 Ga0501081_0168946
490 Ga0501083_0047780
491 Ga0501083_0390144
492 Ga0501035_0278635
493 Ga0501044_0967909
494 Ga0501045_0002906
495 nmdc:mga05p37_732261_c1
496 nmdc:mga0rr50_428881_c1
497 Ga0495601_0061714
498 Ga0495601_0101770
499 Ga0495601_0491503
500 Ga0495612_0269001
501 Ga0495612_0461868
502 Ga0495595_0034374
503 Ga0495619_0115405
504 Ga0495619_0502614
505 Ga0495619_0579605
506 Ga0501084_0011044
507 Ga0501082_0010567
508 Ga0501082_0516857
509 Ga0530510_0012357
510 Ga0530510_0756619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cd7-assembly1.cif.gz_A crystal structure of the ntd l199m of drosophila oskar protein 0.8509 4 31
5cd7-assembly3.cif.gz_E crystal structure of the ntd l199m of drosophila oskar protein 0.8278 4 30
3ey7-assembly1.cif.gz_B structure from the mobile metagenome of v. cholerae. integron cassette protein vch_cass1 0.7689 1 32
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.764 1 32
5cd8-assembly1.cif.gz_B crystal structure of the ntd of drosophila oskar protein 0.7563 5 30
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8142 1 122 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8019 1 122 3.30.70.1230
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7751 1 32 3.10.180.10
af_A0A0R0JTR6_29_130_2.90.10.10 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain 0.7219 13 37 2.90.10.10
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6986 2 123 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9914 1 127
AF-A0A538IJE1-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9845 33 127
AF-A0A7Y5WXI2-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9779 11 128
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9762 1 127
AF-A0A7Y5WXI2-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.962 11 128

Map