F365723
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 202 | 229 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300021358|Ga0213873_10000423|Ga0213873_100004232 |
| Length | 304 |
| Sequence | VSGDAGDGSHRHSRVRRSSPPHXXXLPAVVVDAHTHLDACGATDPAGVRAALDRAAAVGVRAVVTVADDMTAARWVVQASNWDDRVFAAVALHPTRTATMTDADRVELERLARQARVVAVGETGLDYYWTRVDPGCPPPEAQREAYRWHIDLAKRVGKPLMIHDRDAHGDVLAVLDQEGPPPTVVFHCFSGDAAMARACVDAGYVLSFSGTVTFRNARALREAAVLVPDGQLLVETDAPFLTPHPHRGKTNEPVNLPYTVRDLAALRGQDVAELAASTSAAAERVFGFGRLAARFGATDTAGRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 5 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 6 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 7 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 8 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 9 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 10 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 11 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 12 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 13 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 14 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 15 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 16 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 17 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 18 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 19 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 20 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 21 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 22 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 23 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 24 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 127 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 128 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 129 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 130 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 138 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 139 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 145 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 150 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 151 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 152 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 153 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 154 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 155 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 156 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 157 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 158 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 159 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 160 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 161 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 162 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 163 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 164 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 165 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 166 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 167 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 188 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 189 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 198 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 200 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 201 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 202 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.02 |
| Metatranscriptomes | 0.78 |
| Isolates | 10.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.57 |
| Nodule | 0 |
| Rhizoplane | 12.55 |
| Rhizosphere | 74.12 |
| Stem | 0 |
| Stem Tuber | 0.39 |
| Unclassified | 11.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001180 | 3300003203 | Bacteria | 12296 |
| 2 | JGI25406J46586_10009162 | 3300003203 | Bacteria | 4440 |
| 3 | Ga0070658_10003440 | 3300005327 | Bacteria | 13019 |
| 4 | Ga0070658_10071845 | 3300005327 | Bacteria | 2835 |
| 5 | Ga0068869_100015042 | 3300005334 | Bacteria | 5179 |
| 6 | Ga0070680_100055709 | 3300005336 | Bacteria | 3231 |
| 7 | Ga0070682_100031825 | 3300005337 | Bacteria | 3193 |
| 8 | Ga0070682_100168474 | 3300005337 | Bacteria | 1520 |
| 9 | Ga0070682_100258014 | 3300005337 | Bacteria | 1260 |
| 10 | Ga0068868_100070521 | 3300005338 | Bacteria | 2786 |
| 11 | Ga0068868_100148950 | 3300005338 | Bacteria | 1926 |
| 12 | Ga0070691_10010253 | 3300005341 | Bacteria | 4275 |
| 13 | Ga0070668_100004638 | 3300005347 | Bacteria | 10179 |
| 14 | Ga0070671_100077122 | 3300005355 | Bacteria | 2785 |
| 15 | Ga0070673_100115666 | 3300005364 | Bacteria | 2230 |
| 16 | Ga0070659_100478277 | 3300005366 | Bacteria | 1059 |
| 17 | Ga0070709_10256986 | 3300005434 | Bacteria | 1261 |
| 18 | Ga0070714_100001968 | 3300005435 | Bacteria | 15009 |
| 19 | Ga0070714_100168433 | 3300005435 | Bacteria | 1986 |
| 20 | Ga0070713_100023799 | 3300005436 | Bacteria | 4760 |
| 21 | Ga0070713_100148019 | 3300005436 | Bacteria | 2086 |
| 22 | Ga0070710_10000680 | 3300005437 | Bacteria | 16127 |
| 23 | Ga0070711_100037144 | 3300005439 | Bacteria | 3267 |
| 24 | Ga0070700_100067946 | 3300005441 | Bacteria | 2265 |
| 25 | Ga0070678_100008452 | 3300005456 | Bacteria | 6167 |
| 26 | Ga0070681_10084866 | 3300005458 | Bacteria | 3119 |
| 27 | Ga0070681_10519525 | 3300005458 | Bacteria | 1104 |
| 28 | Ga0070679_100092840 | 3300005530 | Bacteria | 3005 |
| 29 | Ga0070693_100011395 | 3300005547 | Bacteria | 4478 |
| 30 | Ga0070665_100032761 | 3300005548 | Bacteria | 5228 |
| 31 | Ga0068855_100003444 | 3300005563 | Bacteria | 19355 |
| 32 | Ga0068856_100008884 | 3300005614 | Bacteria | 9777 |
| 33 | Ga0070702_100021087 | 3300005615 | Bacteria | 3423 |
| 34 | Ga0068852_100581886 | 3300005616 | Bacteria | 1122 |
| 35 | Ga0068870_10004653 | 3300005840 | Bacteria | 5920 |
| 36 | Ga0068863_100113425 | 3300005841 | Bacteria | 2582 |
| 37 | Ga0068863_100259074 | 3300005841 | Bacteria | 1681 |
| 38 | Ga0081455_10193901 | 3300005937 | Bacteria | 1527 |
| 39 | Ga0081539_10000094 | 3300005985 | Bacteria | 206102 |
| 40 | Ga0081539_10000907 | 3300005985 | Bacteria | 56125 |
| 41 | Ga0070717_10098840 | 3300006028 | Bacteria | 2475 |
| 42 | Ga0070717_10244245 | 3300006028 | Bacteria | 1584 |
| 43 | Ga0075432_10012204 | 3300006058 | Bacteria | 2920 |
| 44 | Ga0075369_10006131 | 3300006186 | Bacteria | 4535 |
| 45 | Ga0097621_100017881 | 3300006237 | Bacteria | 5398 |
| 46 | Ga0068871_100053086 | 3300006358 | Bacteria | 3284 |
| 47 | Ga0075428_100249427 | 3300006844 | Bacteria | 1914 |
| 48 | Ga0075434_100013991 | 3300006871 | Bacteria | 7658 |
| 49 | Ga0075429_100035941 | 3300006880 | Bacteria | 4309 |
| 50 | Ga0068865_100158129 | 3300006881 | Bacteria | 1726 |
| 51 | Ga0105251_10133257 | 3300009011 | Bacteria | 1126 |
| 52 | Ga0105240_10637101 | 3300009093 | Bacteria | 1170 |
| 53 | Ga0105245_10082286 | 3300009098 | Bacteria | 2945 |
| 54 | Ga0105247_10096604 | 3300009101 | Bacteria | 1883 |
| 55 | Ga0114129_10346024 | 3300009147 | Bacteria | 1970 |
| 56 | Ga0105243_10004245 | 3300009148 | Bacteria | 11357 |
| 57 | Ga0105241_10008456 | 3300009174 | Bacteria | 7566 |
| 58 | Ga0105242_10164804 | 3300009176 | Bacteria | 1943 |
| 59 | Ga0105248_10188046 | 3300009177 | Bacteria | 2327 |
| 60 | Ga0105237_10027719 | 3300009545 | Bacteria | 5776 |
| 61 | Ga0105237_10155548 | 3300009545 | Bacteria | 2283 |
| 62 | Ga0105238_10003581 | 3300009551 | Bacteria | 15488 |
| 63 | Ga0105239_10129991 | 3300010375 | Bacteria | 2800 |
| 64 | Ga0105239_10441724 | 3300010375 | Bacteria | 1475 |
| 65 | Ga0105246_10034223 | 3300011119 | Bacteria | 3384 |
| 66 | Ga0157373_10050605 | 3300013100 | Bacteria | 2958 |
| 67 | Ga0157375_10035526 | 3300013308 | Bacteria | 4758 |
| 68 | Ga0157377_10031738 | 3300014745 | Bacteria | 2872 |
| 69 | Ga0157379_10066796 | 3300014968 | Bacteria | 3215 |
| 70 | Ga0157376_10290131 | 3300014969 | Bacteria | 1544 |
| 71 | Ga0157376_10295531 | 3300014969 | Bacteria | 1531 |
| 72 | Ga0206354_10667412 | 3300020081 | Bacteria | 1309 |
| 73 | Ga0206353_10737186 | 3300020082 | Bacteria | 1110 |
| 74 | Ga0213873_10000423 | 3300021358 | Bacteria | 6830 |
| 75 | Ga0213876_10020823 | 3300021384 | Bacteria | 3468 |
| 76 | Ga0213875_10004022 | 3300021388 | Bacteria | 8184 |
| 77 | Ga0213875_10038992 | 3300021388 | Bacteria | 2238 |
| 78 | Ga0207692_10004117 | 3300025898 | Bacteria | 5739 |
| 79 | Ga0207710_10061106 | 3300025900 | Bacteria | 1709 |
| 80 | Ga0207688_10179762 | 3300025901 | Bacteria | 1261 |
| 81 | Ga0207643_10000496 | 3300025908 | Bacteria | 25178 |
| 82 | Ga0207705_10018642 | 3300025909 | Bacteria | 4963 |
| 83 | Ga0207705_10029478 | 3300025909 | Bacteria | 3911 |
| 84 | Ga0207705_10140007 | 3300025909 | Bacteria | 1806 |
| 85 | Ga0207693_10144212 | 3300025915 | Bacteria | 1873 |
| 86 | Ga0207663_10047167 | 3300025916 | Bacteria | 2658 |
| 87 | Ga0207660_10382013 | 3300025917 | Bacteria | 1132 |
| 88 | Ga0207652_10207747 | 3300025921 | Bacteria | 1763 |
| 89 | Ga0207694_10298820 | 3300025924 | Bacteria | 1325 |
| 90 | Ga0207650_10282785 | 3300025925 | Bacteria | 1351 |
| 91 | Ga0207659_10087783 | 3300025926 | Bacteria | 2316 |
| 92 | Ga0207687_10301038 | 3300025927 | Bacteria | 1292 |
| 93 | Ga0207700_10286007 | 3300025928 | Bacteria | 1420 |
| 94 | Ga0207664_10237054 | 3300025929 | Bacteria | 1587 |
| 95 | Ga0207644_10196696 | 3300025931 | Bacteria | 1588 |
| 96 | Ga0207690_10151566 | 3300025932 | Bacteria | 1719 |
| 97 | Ga0207706_10126304 | 3300025933 | Bacteria | 2250 |
| 98 | Ga0207709_10008863 | 3300025935 | Bacteria | 5552 |
| 99 | Ga0207709_10247439 | 3300025935 | Bacteria | 1300 |
| 100 | Ga0207669_10489687 | 3300025937 | Bacteria | 982 |
| 101 | Ga0207711_10075469 | 3300025941 | Bacteria | 2934 |
| 102 | Ga0207689_10003762 | 3300025942 | Bacteria | 13821 |
| 103 | Ga0207667_10019999 | 3300025949 | Bacteria | 7458 |
| 104 | Ga0207651_10109667 | 3300025960 | Bacteria | 2069 |
| 105 | Ga0207712_10233284 | 3300025961 | Bacteria | 1478 |
| 106 | Ga0207668_10005151 | 3300025972 | Bacteria | 7693 |
| 107 | Ga0207640_10274180 | 3300025981 | Bacteria | 1321 |
| 108 | Ga0207639_10052156 | 3300026041 | Bacteria | 3115 |
| 109 | Ga0207708_10029237 | 3300026075 | Bacteria | 4176 |
| 110 | Ga0207702_10003958 | 3300026078 | Bacteria | 13300 |
| 111 | Ga0207702_10004797 | 3300026078 | Bacteria | 11918 |
| 112 | Ga0207641_10026152 | 3300026088 | Bacteria | 4815 |
| 113 | Ga0207676_10014007 | 3300026095 | Bacteria | 5757 |
| 114 | Ga0207683_10001397 | 3300026121 | Bacteria | 21794 |
| 115 | Ga0207683_10322662 | 3300026121 | Bacteria | 1415 |
| 116 | Ga0207698_10084669 | 3300026142 | Bacteria | 2571 |
| 117 | Ga0207428_10029774 | 3300027907 | Bacteria | 4519 |
| 118 | Ga0268266_10377199 | 3300028379 | Bacteria | 1337 |
| 119 | Ga0268264_10119963 | 3300028381 | Bacteria | 2316 |
| 120 | Ga0307515_10104833 | 3300028794 | Bacteria | 3373 |
| 121 | Ga0265338_10152102 | 3300028800 | Bacteria | 1797 |
| 122 | Ga0307511_10001096 | 3300030521 | Bacteria | 28800 |
| 123 | Ga0316177_1032656 | 3300030731 | Bacteria | 2920 |
| 124 | Ga0316176_1115732 | 3300030732 | Bacteria | 2514 |
| 125 | Ga0314311_1019512 | 3300030733 | Bacteria | 17159 |
| 126 | Ga0316180_1060881 | 3300030736 | Bacteria | 3125 |
| 127 | Ga0265325_10031528 | 3300031241 | Bacteria | 2836 |
| 128 | Ga0307513_10040521 | 3300031456 | Bacteria | 5149 |
| 129 | Ga0307513_10125584 | 3300031456 | Bacteria | 2522 |
| 130 | Ga0307509_10290750 | 3300031507 | Bacteria | 1389 |
| 131 | Ga0307413_10111760 | 3300031824 | Bacteria | 1830 |
| 132 | Ga0307518_10000036 | 3300031838 | Bacteria | 91114 |
| 133 | Ga0307518_10143807 | 3300031838 | Bacteria | 1659 |
| 134 | Ga0307411_10041293 | 3300032005 | Bacteria | 2934 |
| 135 | Ga0307507_10008178 | 3300033179 | Bacteria | 14663 |
| 136 | Ga0307507_10022675 | 3300033179 | Bacteria | 6924 |
| 137 | Ga0307507_10036220 | 3300033179 | Bacteria | 5049 |
| 138 | Ga0373926_0004555 | 3300035083 | Bacteria | 4551 |
| 139 | Ga0373935_0003132 | 3300035692 | Bacteria | 9547 |
| 140 | Ga0373947_0000009 | 3300035725 | Bacteria | 172751 |
| 141 | Ga0373925_0240148 | 3300037068 | Bacteria | 1451 |
| 142 | Ga0436364_1129948 | 3300037853 | Bacteria | 21254 |
| 143 | Ga0436364_1275546 | 3300037853 | Bacteria | 1960 |
| 144 | Ga0436365_0022630 | 3300039437 | Bacteria | 7348 |
| 145 | Ga0436362_0375916 | 3300039453 | Bacteria | 21750 |
| 146 | Ga0451789_1022707 | 3300041443 | Bacteria | 1783 |
| 147 | Ga0451791_0457924 | 3300041451 | Bacteria | 2078 |
| 148 | Ga0451793_0999238 | 3300041452 | Bacteria | 2566 |
| 149 | Ga0451797_0608614 | 3300041453 | Bacteria | 3164 |
| 150 | Ga0451837_0838264 | 3300041494 | Bacteria | 1030 |
| 151 | Ga0451843_0186514 | 3300041509 | Bacteria | 2085 |
| 152 | Ga0439448_0010475 | 3300042005 | Bacteria | 2752 |
| 153 | Ga0439449_0011077 | 3300042007 | Bacteria | 3399 |
| 154 | Ga0439463_009843 | 3300042016 | Bacteria | 2349 |
| 155 | Ga0439440_0038783 | 3300042993 | Bacteria | 1154 |
| 156 | Ga0466969_0033105 | 3300044656 | Bacteria | 2626 |
| 157 | Ga0466972_0001280 | 3300044658 | Bacteria | 12139 |
| 158 | Ga0453683_0065724 | 3300044673 | Bacteria | 2267 |
| 159 | Ga0466965_0001241 | 3300044683 | Bacteria | 10103 |
| 160 | Ga0466965_0247085 | 3300044683 | Bacteria | 956 |
| 161 | Ga0466966_0001110 | 3300044684 | Bacteria | 17258 |
| 162 | Ga0466966_0002517 | 3300044684 | Bacteria | 12012 |
| 163 | Ga0466966_0369658 | 3300044684 | Bacteria | 861 |
| 164 | Ga0466961_0001725 | 3300044693 | Bacteria | 13595 |
| 165 | Ga0466961_0040214 | 3300044693 | Bacteria | 2998 |
| 166 | Ga0466963_0001724 | 3300044694 | Bacteria | 11903 |
| 167 | Ga0466963_0244582 | 3300044694 | Bacteria | 1258 |
| 168 | Ga0466964_0112126 | 3300044706 | Bacteria | 1218 |
| 169 | Ga0466971_0000990 | 3300044719 | Bacteria | 11715 |
| 170 | Ga0466968_0041831 | 3300044735 | Bacteria | 1936 |
| 171 | Ga0466970_0007488 | 3300044765 | Bacteria | 5475 |
| 172 | Ga0466970_0073169 | 3300044765 | Bacteria | 1844 |
| 173 | Ga0466957_0002460 | 3300044842 | Bacteria | 9946 |
| 174 | Ga0466957_0016885 | 3300044842 | Bacteria | 4271 |
| 175 | Ga0466960_0047662 | 3300044901 | Bacteria | 2056 |
| 176 | Ga0466959_0010237 | 3300045049 | Bacteria | 6696 |
| 177 | Ga0466959_0034348 | 3300045049 | Bacteria | 3750 |
| 178 | Ga0466959_0203394 | 3300045049 | Bacteria | 1378 |
| 179 | Ga0466958_0000135 | 3300045836 | Bacteria | 24888 |
| 180 | Ga0466958_0090339 | 3300045836 | Bacteria | 1895 |
| 181 | Ga0466967_0000549 | 3300045976 | Bacteria | 18250 |
| 182 | Ga0466967_0000569 | 3300045976 | Bacteria | 18154 |
| 183 | Ga0466967_0026273 | 3300045976 | Bacteria | 4820 |
| 184 | Ga0466967_0099515 | 3300045976 | Bacteria | 2656 |
| 185 | Ga0466967_0219029 | 3300045976 | Bacteria | 1808 |
| 186 | Ga0495629_0061612 | 3300046459 | Bacteria | 2622 |
| 187 | Ga0495665_0010587 | 3300046531 | Bacteria | 4993 |
| 188 | Ga0495646_0178406 | 3300046680 | Bacteria | 1167 |
| 189 | Ga0495674_0196917 | 3300047319 | Bacteria | 1673 |
| 190 | Ga0495683_0000575 | 3300047323 | Bacteria | 27777 |
| 191 | Ga0495602_0532106 | 3300048088 | Bacteria | 817 |
| 192 | Ga0496100_0377434 | 3300048903 | Bacteria | 1076 |
| 193 | Ga0496101_0055037 | 3300048904 | Bacteria | 2873 |
| 194 | Ga0496102_0080057 | 3300048905 | Bacteria | 3009 |
| 195 | Ga0496104_0021752 | 3300048907 | Bacteria | 5890 |
| 196 | Ga0496105_0053852 | 3300048908 | Bacteria | 3323 |
| 197 | Ga0496105_0118338 | 3300048908 | Bacteria | 2185 |
| 198 | Ga0496106_0066208 | 3300048909 | Bacteria | 2751 |
| 199 | Ga0496106_0354996 | 3300048909 | Bacteria | 1178 |
| 200 | Ga0496107_0016397 | 3300048910 | Bacteria | 5201 |
| 201 | Ga0496108_0005804 | 3300048911 | Bacteria | 10006 |
| 202 | Ga0496108_0578709 | 3300048911 | Bacteria | 979 |
| 203 | Ga0496108_0599199 | 3300048911 | Bacteria | 960 |
| 204 | Ga0496109_0000540 | 3300048912 | Bacteria | 31969 |
| 205 | Ga0496109_0218475 | 3300048912 | Bacteria | 1793 |
| 206 | Ga0496110_0000523 | 3300048913 | Bacteria | 26101 |
| 207 | Ga0496110_0457058 | 3300048913 | Bacteria | 1163 |
| 208 | Ga0496111_0000211 | 3300048914 | Bacteria | 27526 |
| 209 | Ga0496111_0173935 | 3300048914 | Bacteria | 1600 |
| 210 | Ga0496112_0847385 | 3300048915 | Bacteria | 837 |
| 211 | Ga0496113_0017341 | 3300048916 | Bacteria | 4996 |
| 212 | Ga0496113_0264409 | 3300048916 | Bacteria | 1374 |
| 213 | Ga0496114_0002902 | 3300048917 | Bacteria | 13139 |
| 214 | Ga0496114_0067002 | 3300048917 | Bacteria | 3011 |
| 215 | Ga0496114_0130297 | 3300048917 | Bacteria | 2171 |
| 216 | Ga0496114_0140522 | 3300048917 | Bacteria | 2090 |
| 217 | Ga0496114_0189663 | 3300048917 | Bacteria | 1798 |
| 218 | Ga0496115_0079003 | 3300048918 | Bacteria | 2678 |
| 219 | Ga0496115_0287699 | 3300048918 | Bacteria | 1349 |
| 220 | Ga0501047_0028632 | 3300049581 | Bacteria | 5372 |
| 221 | nmdc:mga03683_71457_c1 | 3300050489 | Bacteria | 1484 |
| 222 | nmdc:mga05p37_124481_c1 | 3300050507 | Bacteria | 3166 |
| 223 | nmdc:mga06r32_44_c4 | 3300050510 | Bacteria | 11694 |
| 224 | nmdc:mga0n895_301737_c1 | 3300050512 | Bacteria | 1624 |
| 225 | Ga0500559_0003724 | 3300053136 | Bacteria | 7422 |
| 226 | Ga0500568_0003332 | 3300053139 | Bacteria | 9030 |
| 227 | Ga0466962_0015047 | 3300061719 | Bacteria | 3730 |
| 228 | Ga0466962_0067449 | 3300061719 | Bacteria | 1708 |
| 229 | Ga0530510_0078190 | 3300061734 | Bacteria | 2405 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025909 | Ga0207705_10018642 | Ga0207705_100186424 | 199 |
| 2 | 3300003203 | JGI25406J46586_10009162 | JGI25406J46586_100091622 | 207 |
| 3 | 3300005985 | Ga0081539_10000094 | Ga0081539_1000009440 | 207 |
| 4 | 3300021388 | Ga0213875_10004022 | Ga0213875_100040224 | 209 |
| 5 | 3300037853 | Ga0436364_1129948 | Ga0436364_1129948_15744_16598 | 209 |
| 6 | 3300005614 | Ga0068856_100008884 | Ga0068856_1000088844 | 212 |
| 7 | 3300005937 | Ga0081455_10193901 | Ga0081455_101939012 | 212 |
| 8 | 3300026078 | Ga0207702_10004797 | Ga0207702_100047975 | 212 |
| 9 | 3300049581 | Ga0501047_0028632 | Ga0501047_0028632_1647_2489 | 212 |
| 10 | 3300005338 | Ga0068868_100070521 | Ga0068868_1000705212 | 214 |
| 11 | 3300005355 | Ga0070671_100077122 | Ga0070671_1000771222 | 214 |
| 12 | 3300005364 | Ga0070673_100115666 | Ga0070673_1001156662 | 214 |
| 13 | 3300005841 | Ga0068863_100259074 | Ga0068863_1002590742 | 214 |
| 14 | 3300006881 | Ga0068865_100158129 | Ga0068865_1001581292 | 214 |
| 15 | 3300009011 | Ga0105251_10133257 | Ga0105251_101332572 | 214 |
| 16 | 3300014969 | Ga0157376_10295531 | Ga0157376_102955312 | 214 |
| 17 | 3300025901 | Ga0207688_10179762 | Ga0207688_101797621 | 214 |
| 18 | 3300025931 | Ga0207644_10196696 | Ga0207644_101966962 | 214 |
| 19 | 3300025960 | Ga0207651_10109667 | Ga0207651_101096672 | 214 |
| 20 | 3300025981 | Ga0207640_10274180 | Ga0207640_102741801 | 214 |
| 21 | 3300028381 | Ga0268264_10119963 | Ga0268264_101199632 | 214 |
| 22 | 3300009098 | Ga0105245_10082286 | Ga0105245_100822861 | 215 |
| 23 | 3300013308 | Ga0157375_10035526 | Ga0157375_100355262 | 215 |
| 24 | 3300025961 | Ga0207712_10233284 | Ga0207712_102332842 | 215 |
| 25 | 3300044684 | Ga0466966_0369658 | Ga0466966_0369658_21_707 | 215 |
| 26 | 3300046459 | Ga0495629_0061612 | Ga0495629_0061612_396_1241 | 215 |
| 27 | 3300048911 | Ga0496108_0578709 | Ga0496108_0578709_118_963 | 215 |
| 28 | 3300048912 | Ga0496109_0218475 | Ga0496109_0218475_329_1174 | 215 |
| 29 | 3300048917 | Ga0496114_0130297 | Ga0496114_0130297_118_963 | 215 |
| 30 | 3300048917 | Ga0496114_0189663 | Ga0496114_0189663_117_962 | 215 |
| 31 | 3300048918 | Ga0496115_0287699 | Ga0496115_0287699_318_1163 | 215 |
| 32 | 3300005434 | Ga0070709_10256986 | Ga0070709_102569862 | 216 |
| 33 | 3300005435 | Ga0070714_100168433 | Ga0070714_1001684332 | 216 |
| 34 | 3300005436 | Ga0070713_100023799 | Ga0070713_1000237992 | 216 |
| 35 | 3300005439 | Ga0070711_100037144 | Ga0070711_1000371443 | 216 |
| 36 | 3300006028 | Ga0070717_10098840 | Ga0070717_100988402 | 216 |
| 37 | 3300025915 | Ga0207693_10144212 | Ga0207693_101442122 | 216 |
| 38 | 3300025929 | Ga0207664_10237054 | Ga0207664_102370542 | 216 |
| 39 | 3300037068 | Ga0373925_0240148 | Ga0373925_0240148_179_904 | 216 |
| 40 | 3300005327 | Ga0070658_10071845 | Ga0070658_100718452 | 218 |
| 41 | 3300005563 | Ga0068855_100003444 | Ga0068855_1000034443 | 218 |
| 42 | 3300025909 | Ga0207705_10029478 | Ga0207705_100294781 | 218 |
| 43 | 3300025949 | Ga0207667_10019999 | Ga0207667_100199995 | 218 |
| 44 | 3300009148 | Ga0105243_10004245 | Ga0105243_100042455 | 222 |
| 45 | 3300009176 | Ga0105242_10164804 | Ga0105242_101648042 | 222 |
| 46 | 3300025935 | Ga0207709_10008863 | Ga0207709_100088634 | 222 |
| 47 | 3300031456 | Ga0307513_10040521 | Ga0307513_100405214 | 222 |
| 48 | 3300044673 | Ga0453683_0065724 | Ga0453683_0065724_760_1539 | 222 |
| 49 | 3300047323 | Ga0495683_0000575 | Ga0495683_0000575_23293_24072 | 222 |
| 50 | 3300048918 | Ga0496115_0079003 | Ga0496115_0079003_1180_1998 | 222 |
| 51 | iso_pu_bacteria | 2738543011 | 2739238130 | 222 |
| 52 | iso_pu_bacteria | 2889300758 | 2889303252 | 222 |
| 53 | iso_pu_bacteria | 2904765812 | 2904766512 | 222 |
| 54 | iso_pu_bacteria | 2904770941 | 2904772680 | 222 |
| 55 | iso_pu_bacteria | 2908811453 | 2908811472 | 222 |
| 56 | iso_pu_bacteria | 2919420072 | 2919421052 | 222 |
| 57 | iso_pu_bacteria | 2919432681 | 2919433190 | 222 |
| 58 | iso_pu_bacteria | 2939743619 | 2939745859 | 222 |
| 59 | 3300005334 | Ga0068869_100015042 | Ga0068869_1000150424 | 223 |
| 60 | 3300005336 | Ga0070680_100055709 | Ga0070680_1000557092 | 223 |
| 61 | 3300005337 | Ga0070682_100031825 | Ga0070682_1000318253 | 223 |
| 62 | 3300005341 | Ga0070691_10010253 | Ga0070691_100102532 | 223 |
| 63 | 3300005366 | Ga0070659_100478277 | Ga0070659_1004782772 | 223 |
| 64 | 3300005441 | Ga0070700_100067946 | Ga0070700_1000679462 | 223 |
| 65 | 3300005456 | Ga0070678_100008452 | Ga0070678_1000084523 | 223 |
| 66 | 3300005458 | Ga0070681_10084866 | Ga0070681_100848662 | 223 |
| 67 | 3300005530 | Ga0070679_100092840 | Ga0070679_1000928401 | 223 |
| 68 | 3300005547 | Ga0070693_100011395 | Ga0070693_1000113954 | 223 |
| 69 | 3300005548 | Ga0070665_100032761 | Ga0070665_1000327612 | 223 |
| 70 | 3300005615 | Ga0070702_100021087 | Ga0070702_1000210872 | 223 |
| 71 | 3300005616 | Ga0068852_100581886 | Ga0068852_1005818862 | 223 |
| 72 | 3300005840 | Ga0068870_10004653 | Ga0068870_100046533 | 223 |
| 73 | 3300006058 | Ga0075432_10012204 | Ga0075432_100122043 | 223 |
| 74 | 3300006237 | Ga0097621_100017881 | Ga0097621_1000178813 | 223 |
| 75 | 3300006358 | Ga0068871_100053086 | Ga0068871_1000530863 | 223 |
| 76 | 3300006844 | Ga0075428_100249427 | Ga0075428_1002494272 | 223 |
| 77 | 3300006871 | Ga0075434_100013991 | Ga0075434_1000139916 | 223 |
| 78 | 3300006880 | Ga0075429_100035941 | Ga0075429_1000359414 | 223 |
| 79 | 3300009101 | Ga0105247_10096604 | Ga0105247_100966042 | 223 |
| 80 | 3300009147 | Ga0114129_10346024 | Ga0114129_103460242 | 223 |
| 81 | 3300009174 | Ga0105241_10008456 | Ga0105241_100084562 | 223 |
| 82 | 3300009177 | Ga0105248_10188046 | Ga0105248_101880462 | 223 |
| 83 | 3300009545 | Ga0105237_10027719 | Ga0105237_100277192 | 223 |
| 84 | 3300010375 | Ga0105239_10129991 | Ga0105239_101299911 | 223 |
| 85 | 3300011119 | Ga0105246_10034223 | Ga0105246_100342232 | 223 |
| 86 | 3300013100 | Ga0157373_10050605 | Ga0157373_100506052 | 223 |
| 87 | 3300014745 | Ga0157377_10031738 | Ga0157377_100317382 | 223 |
| 88 | 3300014968 | Ga0157379_10066796 | Ga0157379_100667962 | 223 |
| 89 | 3300020081 | Ga0206354_10667412 | Ga0206354_106674122 | 223 |
| 90 | 3300020082 | Ga0206353_10737186 | Ga0206353_107371861 | 223 |
| 91 | 3300025900 | Ga0207710_10061106 | Ga0207710_100611062 | 223 |
| 92 | 3300025908 | Ga0207643_10000496 | Ga0207643_1000049611 | 223 |
| 93 | 3300025909 | Ga0207705_10140007 | Ga0207705_101400072 | 223 |
| 94 | 3300025917 | Ga0207660_10382013 | Ga0207660_103820132 | 223 |
| 95 | 3300025921 | Ga0207652_10207747 | Ga0207652_102077472 | 223 |
| 96 | 3300025924 | Ga0207694_10298820 | Ga0207694_102988202 | 223 |
| 97 | 3300025925 | Ga0207650_10282785 | Ga0207650_102827852 | 223 |
| 98 | 3300025926 | Ga0207659_10087783 | Ga0207659_100877832 | 223 |
| 99 | 3300025927 | Ga0207687_10301038 | Ga0207687_103010382 | 223 |
| 100 | 3300025932 | Ga0207690_10151566 | Ga0207690_101515662 | 223 |
| 101 | 3300025933 | Ga0207706_10126304 | Ga0207706_101263042 | 223 |
| 102 | 3300025935 | Ga0207709_10247439 | Ga0207709_102474391 | 223 |
| 103 | 3300025941 | Ga0207711_10075469 | Ga0207711_100754692 | 223 |
| 104 | 3300025942 | Ga0207689_10003762 | Ga0207689_100037629 | 223 |
| 105 | 3300026075 | Ga0207708_10029237 | Ga0207708_100292373 | 223 |
| 106 | 3300026078 | Ga0207702_10003958 | Ga0207702_100039588 | 223 |
| 107 | 3300026095 | Ga0207676_10014007 | Ga0207676_100140073 | 223 |
| 108 | 3300026121 | Ga0207683_10001397 | Ga0207683_1000139710 | 223 |
| 109 | 3300026142 | Ga0207698_10084669 | Ga0207698_100846692 | 223 |
| 110 | 3300027907 | Ga0207428_10029774 | Ga0207428_100297742 | 223 |
| 111 | 3300028379 | Ga0268266_10377199 | Ga0268266_103771991 | 223 |
| 112 | 3300035083 | Ga0373926_0004555 | Ga0373926_0004555_2756_3670 | 223 |
| 113 | 3300035692 | Ga0373935_0003132 | Ga0373935_0003132_1363_2277 | 223 |
| 114 | 3300035725 | Ga0373947_0000009 | Ga0373947_0000009_93062_93976 | 223 |
| 115 | 3300042005 | Ga0439448_0010475 | Ga0439448_0010475_524_1291 | 223 |
| 116 | 3300042016 | Ga0439463_009843 | Ga0439463_009843_1374_2180 | 223 |
| 117 | 3300042993 | Ga0439440_0038783 | Ga0439440_0038783_275_1081 | 223 |
| 118 | 3300044694 | Ga0466963_0244582 | Ga0466963_0244582_318_1148 | 223 |
| 119 | 3300044842 | Ga0466957_0016885 | Ga0466957_0016885_2051_2881 | 223 |
| 120 | 3300045836 | Ga0466958_0090339 | Ga0466958_0090339_713_1543 | 223 |
| 121 | 3300045976 | Ga0466967_0000569 | Ga0466967_0000569_2862_3689 | 223 |
| 122 | 3300045976 | Ga0466967_0219029 | Ga0466967_0219029_913_1743 | 223 |
| 123 | 3300048904 | Ga0496101_0055037 | Ga0496101_0055037_757_1524 | 223 |
| 124 | 3300048905 | Ga0496102_0080057 | Ga0496102_0080057_2155_2922 | 223 |
| 125 | 3300048909 | Ga0496106_0066208 | Ga0496106_0066208_1942_2709 | 223 |
| 126 | 3300048910 | Ga0496107_0016397 | Ga0496107_0016397_2255_3022 | 223 |
| 127 | 3300048911 | Ga0496108_0599199 | Ga0496108_0599199_31_891 | 223 |
| 128 | 3300048913 | Ga0496110_0457058 | Ga0496110_0457058_86_853 | 223 |
| 129 | 3300048914 | Ga0496111_0173935 | Ga0496111_0173935_500_1267 | 223 |
| 130 | 3300048915 | Ga0496112_0847385 | Ga0496112_0847385_89_814 | 223 |
| 131 | 3300048916 | Ga0496113_0264409 | Ga0496113_0264409_417_1184 | 223 |
| 132 | 3300050489 | nmdc:mga03683_71457_c1 | nmdc:mga03683_71457_c1_579_1382 | 223 |
| 133 | 3300050507 | nmdc:mga05p37_124481_c1 | nmdc:mga05p37_124481_c1_2233_3000 | 223 |
| 134 | 3300050512 | nmdc:mga0n895_301737_c1 | nmdc:mga0n895_301737_c1_321_1088 | 223 |
| 135 | 3300053139 | Ga0500568_0003332 | Ga0500568_0003332_5326_6159 | 223 |
| 136 | 3300005327 | Ga0070658_10003440 | Ga0070658_1000344013 | 224 |
| 137 | 3300005337 | Ga0070682_100168474 | Ga0070682_1001684742 | 224 |
| 138 | 3300005437 | Ga0070710_10000680 | Ga0070710_100006809 | 224 |
| 139 | 3300005458 | Ga0070681_10519525 | Ga0070681_105195251 | 224 |
| 140 | 3300009093 | Ga0105240_10637101 | Ga0105240_106371011 | 224 |
| 141 | 3300009545 | Ga0105237_10155548 | Ga0105237_101555482 | 224 |
| 142 | 3300009551 | Ga0105238_10003581 | Ga0105238_100035812 | 224 |
| 143 | 3300010375 | Ga0105239_10441724 | Ga0105239_104417242 | 224 |
| 144 | 3300025898 | Ga0207692_10004117 | Ga0207692_100041175 | 224 |
| 145 | 3300026041 | Ga0207639_10052156 | Ga0207639_100521562 | 224 |
| 146 | 3300028800 | Ga0265338_10152102 | Ga0265338_101521022 | 224 |
| 147 | 3300030521 | Ga0307511_10001096 | Ga0307511_1000109626 | 224 |
| 148 | 3300030731 | Ga0316177_1032656 | Ga0316177_10326562 | 224 |
| 149 | 3300030732 | Ga0316176_1115732 | Ga0316176_11157322 | 224 |
| 150 | 3300030733 | Ga0314311_1019512 | Ga0314311_10195127 | 224 |
| 151 | 3300030736 | Ga0316180_1060881 | Ga0316180_10608812 | 224 |
| 152 | 3300031241 | Ga0265325_10031528 | Ga0265325_100315282 | 224 |
| 153 | 3300031507 | Ga0307509_10290750 | Ga0307509_102907502 | 224 |
| 154 | 3300044656 | Ga0466969_0033105 | Ga0466969_0033105_1460_2236 | 224 |
| 155 | 3300044658 | Ga0466972_0001280 | Ga0466972_0001280_11149_11970 | 224 |
| 156 | 3300044683 | Ga0466965_0001241 | Ga0466965_0001241_4189_5010 | 224 |
| 157 | 3300044684 | Ga0466966_0002517 | Ga0466966_0002517_9367_10191 | 224 |
| 158 | 3300044693 | Ga0466961_0001725 | Ga0466961_0001725_855_1679 | 224 |
| 159 | 3300044706 | Ga0466964_0112126 | Ga0466964_0112126_388_1164 | 224 |
| 160 | 3300044765 | Ga0466970_0073169 | Ga0466970_0073169_331_1155 | 224 |
| 161 | 3300045049 | Ga0466959_0034348 | Ga0466959_0034348_2199_3023 | 224 |
| 162 | 3300061719 | Ga0466962_0067449 | Ga0466962_0067449_765_1589 | 224 |
| 163 | iso_pu_bacteria | 2558860280 | 2559427178 | 224 |
| 164 | iso_pu_bacteria | 2917736166 | 2917739800 | 224 |
| 165 | 3300025916 | Ga0207663_10047167 | Ga0207663_100471672 | 225 |
| 166 | 3300041443 | Ga0451789_1022707 | Ga0451789_1022707_48_893 | 225 |
| 167 | 3300041451 | Ga0451791_0457924 | Ga0451791_0457924_79_924 | 225 |
| 168 | 3300041452 | Ga0451793_0999238 | Ga0451793_0999238_170_1015 | 225 |
| 169 | 3300041453 | Ga0451797_0608614 | Ga0451797_0608614_978_1823 | 225 |
| 170 | 3300041494 | Ga0451837_0838264 | Ga0451837_0838264_132_977 | 225 |
| 171 | 3300041509 | Ga0451843_0186514 | Ga0451843_0186514_766_1611 | 225 |
| 172 | 3300046680 | Ga0495646_0178406 | Ga0495646_0178406_193_1038 | 225 |
| 173 | 3300047319 | Ga0495674_0196917 | Ga0495674_0196917_172_1017 | 225 |
| 174 | 3300048907 | Ga0496104_0021752 | Ga0496104_0021752_853_1698 | 225 |
| 175 | 3300048908 | Ga0496105_0118338 | Ga0496105_0118338_373_1218 | 225 |
| 176 | 3300048909 | Ga0496106_0354996 | Ga0496106_0354996_18_803 | 225 |
| 177 | 3300048911 | Ga0496108_0005804 | Ga0496108_0005804_6684_7529 | 225 |
| 178 | 3300048912 | Ga0496109_0000540 | Ga0496109_0000540_22866_23711 | 225 |
| 179 | 3300048913 | Ga0496110_0000523 | Ga0496110_0000523_23322_24167 | 225 |
| 180 | 3300048914 | Ga0496111_0000211 | Ga0496111_0000211_23195_24040 | 225 |
| 181 | 3300048916 | Ga0496113_0017341 | Ga0496113_0017341_433_1278 | 225 |
| 182 | 3300048917 | Ga0496114_0067002 | Ga0496114_0067002_227_1075 | 225 |
| 183 | 3300048917 | Ga0496114_0140522 | Ga0496114_0140522_74_919 | 225 |
| 184 | iso_pu_bacteria | 2775506925 | 2776370292 | 225 |
| 185 | iso_pu_bacteria | 2863067949 | 2863069122 | 225 |
| 186 | iso_pu_bacteria | 2866552031 | 2866552924 | 225 |
| 187 | iso_pu_bacteria | 8056207758 | 8056209136 | 225 |
| 188 | 3300031838 | Ga0307518_10143807 | Ga0307518_101438072 | 226 |
| 189 | 3300053136 | Ga0500559_0003724 | Ga0500559_0003724_1765_2628 | 226 |
| 190 | 3300021388 | Ga0213875_10038992 | Ga0213875_100389922 | 227 |
| 191 | 3300025937 | Ga0207669_10489687 | Ga0207669_104896871 | 227 |
| 192 | 3300037853 | Ga0436364_1275546 | Ga0436364_1275546_340_1083 | 227 |
| 193 | 3300046531 | Ga0495665_0010587 | Ga0495665_0010587_1779_2657 | 227 |
| 194 | 3300048903 | Ga0496100_0377434 | Ga0496100_0377434_195_1043 | 227 |
| 195 | 3300048908 | Ga0496105_0053852 | Ga0496105_0053852_2375_3223 | 227 |
| 196 | 3300048917 | Ga0496114_0002902 | Ga0496114_0002902_10188_11036 | 227 |
| 197 | 3300005337 | Ga0070682_100258014 | Ga0070682_1002580141 | 228 |
| 198 | 3300005338 | Ga0068868_100148950 | Ga0068868_1001489501 | 228 |
| 199 | 3300005347 | Ga0070668_100004638 | Ga0070668_1000046382 | 228 |
| 200 | 3300005841 | Ga0068863_100113425 | Ga0068863_1001134251 | 228 |
| 201 | 3300006186 | Ga0075369_10006131 | Ga0075369_100061312 | 228 |
| 202 | 3300014969 | Ga0157376_10290131 | Ga0157376_102901312 | 228 |
| 203 | 3300025972 | Ga0207668_10005151 | Ga0207668_100051514 | 228 |
| 204 | 3300026088 | Ga0207641_10026152 | Ga0207641_100261524 | 228 |
| 205 | 3300026121 | Ga0207683_10322662 | Ga0207683_103226622 | 228 |
| 206 | 3300028794 | Ga0307515_10104833 | Ga0307515_101048331 | 228 |
| 207 | 3300031838 | Ga0307518_10000036 | Ga0307518_1000003685 | 228 |
| 208 | 3300032005 | Ga0307411_10041293 | Ga0307411_100412932 | 228 |
| 209 | 3300033179 | Ga0307507_10008178 | Ga0307507_100081784 | 228 |
| 210 | 3300033179 | Ga0307507_10022675 | Ga0307507_100226752 | 228 |
| 211 | 3300042007 | Ga0439449_0011077 | Ga0439449_0011077_739_1521 | 228 |
| 212 | 3300044683 | Ga0466965_0247085 | Ga0466965_0247085_158_946 | 228 |
| 213 | 3300048088 | Ga0495602_0532106 | Ga0495602_0532106_17_757 | 228 |
| 214 | 3300061734 | Ga0530510_0078190 | Ga0530510_0078190_1242_2057 | 228 |
| 215 | iso_pu_bacteria | 2582580736 | 2583149470 | 228 |
| 216 | iso_pu_bacteria | 2585427649 | 2586058141 | 228 |
| 217 | iso_pu_bacteria | 2751185734 | 2753074473 | 228 |
| 218 | iso_pu_bacteria | 2808606522 | 2809593012 | 228 |
| 219 | iso_pu_bacteria | 2870721527 | 2870728928 | 228 |
| 220 | iso_pu_bacteria | 2899359706 | 2899364879 | 228 |
| 221 | iso_pu_bacteria | 2915768154 | 2915768281 | 228 |
| 222 | iso_pu_bacteria | 8047710418 | 8047715293 | 228 |
| 223 | 3300044765 | Ga0466970_0007488 | Ga0466970_0007488_4527_5381 | 229 |
| 224 | 3300050510 | nmdc:mga06r32_44_c4 | nmdc:mga06r32_44_c4_6491_7288 | 230 |
| 225 | 3300044684 | Ga0466966_0001110 | Ga0466966_0001110_15709_16551 | 231 |
| 226 | 3300044693 | Ga0466961_0040214 | Ga0466961_0040214_721_1563 | 231 |
| 227 | 3300044694 | Ga0466963_0001724 | Ga0466963_0001724_5438_6280 | 231 |
| 228 | 3300044719 | Ga0466971_0000990 | Ga0466971_0000990_1742_2584 | 231 |
| 229 | 3300044735 | Ga0466968_0041831 | Ga0466968_0041831_65_889 | 231 |
| 230 | 3300044842 | Ga0466957_0002460 | Ga0466957_0002460_1271_2113 | 231 |
| 231 | 3300045049 | Ga0466959_0010237 | Ga0466959_0010237_5314_6156 | 231 |
| 232 | 3300045049 | Ga0466959_0203394 | Ga0466959_0203394_517_1275 | 231 |
| 233 | 3300045836 | Ga0466958_0000135 | Ga0466958_0000135_711_1553 | 231 |
| 234 | 3300045976 | Ga0466967_0000549 | Ga0466967_0000549_2469_3227 | 231 |
| 235 | 3300045976 | Ga0466967_0026273 | Ga0466967_0026273_3431_4273 | 231 |
| 236 | 3300045976 | Ga0466967_0099515 | Ga0466967_0099515_1813_2604 | 231 |
| 237 | 3300061719 | Ga0466962_0015047 | Ga0466962_0015047_254_1096 | 231 |
| 238 | 3300005435 | Ga0070714_100001968 | Ga0070714_1000019683 | 232 |
| 239 | 3300005436 | Ga0070713_100148019 | Ga0070713_1001480192 | 232 |
| 240 | 3300006028 | Ga0070717_10244245 | Ga0070717_102442452 | 232 |
| 241 | 3300025928 | Ga0207700_10286007 | Ga0207700_102860072 | 232 |
| 242 | 3300021358 | Ga0213873_10000423 | Ga0213873_100004232 | 234 |
| 243 | 3300021384 | Ga0213876_10020823 | Ga0213876_100208233 | 234 |
| 244 | 3300031456 | Ga0307513_10125584 | Ga0307513_101255842 | 234 |
| 245 | 3300039437 | Ga0436365_0022630 | Ga0436365_0022630_2345_3217 | 234 |
| 246 | 3300039453 | Ga0436362_0375916 | Ga0436362_0375916_18534_19406 | 234 |
| 247 | iso_pu_bacteria | 2795385470 | 2795779966 | 234 |
| 248 | 3300003203 | JGI25406J46586_10001180 | JGI25406J46586_100011808 | 235 |
| 249 | 3300005985 | Ga0081539_10000907 | Ga0081539_1000090730 | 235 |
| 250 | 3300031824 | Ga0307413_10111760 | Ga0307413_101117602 | 235 |
| 251 | 3300033179 | Ga0307507_10036220 | Ga0307507_100362202 | 235 |
| 252 | 3300044901 | Ga0466960_0047662 | Ga0466960_0047662_801_1658 | 235 |
| 253 | iso_pu_bacteria | 2791354901 | 2791914343 | 235 |
| 254 | iso_pu_bacteria | 2795385472 | 2795793416 | 235 |
| 255 | iso_pu_bacteria | 2899370129 | 2899370269 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gzx-assembly2.cif.gz_B | crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. | 0.8772 | 2 | 220 |
| 1xwy-assembly1.cif.gz_A | crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution | 0.8677 | 2 | 224 |
| 1yix-assembly2.cif.gz_B | crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution | 0.8607 | 2 | 222 |
| 1zzm-assembly1.cif.gz_A | crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution | 0.8521 | 2 | 223 |
| 2xio-assembly1.cif.gz_A | structure of putative deoxyribonuclease tatdn1 isoform a | 0.8511 | 2 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MNS0_5_296_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8999 | 2 | 189 | 3.20.20.140 |
| af_A0A1D8PS00_9_414_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8835 | 10 | 185 | 3.20.20.140 |
| af_Q9VDC1_36_319_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8748 | 2 | 223 | 3.20.20.140 |
| af_O08343_1_262_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8711 | 2 | 225 | 3.20.20.140 |
| af_G5EG18_4_286_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8695 | 2 | 223 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523VG11-F1-model_v4 | TatD family deoxyribonuclease | 0.9905 | 2 | 137 |
GO:0005829
GO:0016788 |
| AF-A0A349GAX6-F1-model_v4 | Hydrolase TatD | 0.9815 | 2 | 151 |
GO:0005829
GO:0016788 |
| AF-A0A7V6RP70-F1-model_v4 | TatD family hydrolase | 0.9815 | 3 | 124 |
GO:0005829
GO:0016788 |
| AF-A0A1Y1QBB3-F1-model_v4 | Hydrolase TatD | 0.9805 | 2 | 123 |
GO:0005829
GO:0016788 |
| AF-A0A3B9QH37-F1-model_v4 | Hydrolase TatD | 0.9784 | 2 | 182 |
GO:0005829
GO:0016788 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar