F365723

General Info

Members Datasets Scaffolds Average Seq Length
255 202 229 266

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10000423|Ga0213873_100004232
Length 304
Sequence VSGDAGDGSHRHSRVRRSSPPHXXXLPAVVVDAHTHLDACGATDPAGVRAALDRAAAVGVRAVVTVADDMTAARWVVQASNWDDRVFAAVALHPTRTATMTDADRVELERLARQARVVAVGETGLDYYWTRVDPGCPPPEAQREAYRWHIDLAKRVGKPLMIHDRDAHGDVLAVLDQEGPPPTVVFHCFSGDAAMARACVDAGYVLSFSGTVTFRNARALREAAVLVPDGQLLVETDAPFLTPHPHRGKTNEPVNLPYTVRDLAALRGQDVAELAASTSAAAERVFGFGRLAARFGATDTAGRS

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
5 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
6 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
7 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
8 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
9 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
10 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
11 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
12 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
13 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
14 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
15 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
16 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
17 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
18 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
19 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
20 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
21 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
22 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
23 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
24 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
128 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
129 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
130 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
150 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
202 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.02
Metatranscriptomes 0.78
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 12.55
Rhizosphere 74.12
Stem 0
Stem Tuber 0.39
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001180 3300003203 Bacteria 12296
2 JGI25406J46586_10009162 3300003203 Bacteria 4440
3 Ga0070658_10003440 3300005327 Bacteria 13019
4 Ga0070658_10071845 3300005327 Bacteria 2835
5 Ga0068869_100015042 3300005334 Bacteria 5179
6 Ga0070680_100055709 3300005336 Bacteria 3231
7 Ga0070682_100031825 3300005337 Bacteria 3193
8 Ga0070682_100168474 3300005337 Bacteria 1520
9 Ga0070682_100258014 3300005337 Bacteria 1260
10 Ga0068868_100070521 3300005338 Bacteria 2786
11 Ga0068868_100148950 3300005338 Bacteria 1926
12 Ga0070691_10010253 3300005341 Bacteria 4275
13 Ga0070668_100004638 3300005347 Bacteria 10179
14 Ga0070671_100077122 3300005355 Bacteria 2785
15 Ga0070673_100115666 3300005364 Bacteria 2230
16 Ga0070659_100478277 3300005366 Bacteria 1059
17 Ga0070709_10256986 3300005434 Bacteria 1261
18 Ga0070714_100001968 3300005435 Bacteria 15009
19 Ga0070714_100168433 3300005435 Bacteria 1986
20 Ga0070713_100023799 3300005436 Bacteria 4760
21 Ga0070713_100148019 3300005436 Bacteria 2086
22 Ga0070710_10000680 3300005437 Bacteria 16127
23 Ga0070711_100037144 3300005439 Bacteria 3267
24 Ga0070700_100067946 3300005441 Bacteria 2265
25 Ga0070678_100008452 3300005456 Bacteria 6167
26 Ga0070681_10084866 3300005458 Bacteria 3119
27 Ga0070681_10519525 3300005458 Bacteria 1104
28 Ga0070679_100092840 3300005530 Bacteria 3005
29 Ga0070693_100011395 3300005547 Bacteria 4478
30 Ga0070665_100032761 3300005548 Bacteria 5228
31 Ga0068855_100003444 3300005563 Bacteria 19355
32 Ga0068856_100008884 3300005614 Bacteria 9777
33 Ga0070702_100021087 3300005615 Bacteria 3423
34 Ga0068852_100581886 3300005616 Bacteria 1122
35 Ga0068870_10004653 3300005840 Bacteria 5920
36 Ga0068863_100113425 3300005841 Bacteria 2582
37 Ga0068863_100259074 3300005841 Bacteria 1681
38 Ga0081455_10193901 3300005937 Bacteria 1527
39 Ga0081539_10000094 3300005985 Bacteria 206102
40 Ga0081539_10000907 3300005985 Bacteria 56125
41 Ga0070717_10098840 3300006028 Bacteria 2475
42 Ga0070717_10244245 3300006028 Bacteria 1584
43 Ga0075432_10012204 3300006058 Bacteria 2920
44 Ga0075369_10006131 3300006186 Bacteria 4535
45 Ga0097621_100017881 3300006237 Bacteria 5398
46 Ga0068871_100053086 3300006358 Bacteria 3284
47 Ga0075428_100249427 3300006844 Bacteria 1914
48 Ga0075434_100013991 3300006871 Bacteria 7658
49 Ga0075429_100035941 3300006880 Bacteria 4309
50 Ga0068865_100158129 3300006881 Bacteria 1726
51 Ga0105251_10133257 3300009011 Bacteria 1126
52 Ga0105240_10637101 3300009093 Bacteria 1170
53 Ga0105245_10082286 3300009098 Bacteria 2945
54 Ga0105247_10096604 3300009101 Bacteria 1883
55 Ga0114129_10346024 3300009147 Bacteria 1970
56 Ga0105243_10004245 3300009148 Bacteria 11357
57 Ga0105241_10008456 3300009174 Bacteria 7566
58 Ga0105242_10164804 3300009176 Bacteria 1943
59 Ga0105248_10188046 3300009177 Bacteria 2327
60 Ga0105237_10027719 3300009545 Bacteria 5776
61 Ga0105237_10155548 3300009545 Bacteria 2283
62 Ga0105238_10003581 3300009551 Bacteria 15488
63 Ga0105239_10129991 3300010375 Bacteria 2800
64 Ga0105239_10441724 3300010375 Bacteria 1475
65 Ga0105246_10034223 3300011119 Bacteria 3384
66 Ga0157373_10050605 3300013100 Bacteria 2958
67 Ga0157375_10035526 3300013308 Bacteria 4758
68 Ga0157377_10031738 3300014745 Bacteria 2872
69 Ga0157379_10066796 3300014968 Bacteria 3215
70 Ga0157376_10290131 3300014969 Bacteria 1544
71 Ga0157376_10295531 3300014969 Bacteria 1531
72 Ga0206354_10667412 3300020081 Bacteria 1309
73 Ga0206353_10737186 3300020082 Bacteria 1110
74 Ga0213873_10000423 3300021358 Bacteria 6830
75 Ga0213876_10020823 3300021384 Bacteria 3468
76 Ga0213875_10004022 3300021388 Bacteria 8184
77 Ga0213875_10038992 3300021388 Bacteria 2238
78 Ga0207692_10004117 3300025898 Bacteria 5739
79 Ga0207710_10061106 3300025900 Bacteria 1709
80 Ga0207688_10179762 3300025901 Bacteria 1261
81 Ga0207643_10000496 3300025908 Bacteria 25178
82 Ga0207705_10018642 3300025909 Bacteria 4963
83 Ga0207705_10029478 3300025909 Bacteria 3911
84 Ga0207705_10140007 3300025909 Bacteria 1806
85 Ga0207693_10144212 3300025915 Bacteria 1873
86 Ga0207663_10047167 3300025916 Bacteria 2658
87 Ga0207660_10382013 3300025917 Bacteria 1132
88 Ga0207652_10207747 3300025921 Bacteria 1763
89 Ga0207694_10298820 3300025924 Bacteria 1325
90 Ga0207650_10282785 3300025925 Bacteria 1351
91 Ga0207659_10087783 3300025926 Bacteria 2316
92 Ga0207687_10301038 3300025927 Bacteria 1292
93 Ga0207700_10286007 3300025928 Bacteria 1420
94 Ga0207664_10237054 3300025929 Bacteria 1587
95 Ga0207644_10196696 3300025931 Bacteria 1588
96 Ga0207690_10151566 3300025932 Bacteria 1719
97 Ga0207706_10126304 3300025933 Bacteria 2250
98 Ga0207709_10008863 3300025935 Bacteria 5552
99 Ga0207709_10247439 3300025935 Bacteria 1300
100 Ga0207669_10489687 3300025937 Bacteria 982
101 Ga0207711_10075469 3300025941 Bacteria 2934
102 Ga0207689_10003762 3300025942 Bacteria 13821
103 Ga0207667_10019999 3300025949 Bacteria 7458
104 Ga0207651_10109667 3300025960 Bacteria 2069
105 Ga0207712_10233284 3300025961 Bacteria 1478
106 Ga0207668_10005151 3300025972 Bacteria 7693
107 Ga0207640_10274180 3300025981 Bacteria 1321
108 Ga0207639_10052156 3300026041 Bacteria 3115
109 Ga0207708_10029237 3300026075 Bacteria 4176
110 Ga0207702_10003958 3300026078 Bacteria 13300
111 Ga0207702_10004797 3300026078 Bacteria 11918
112 Ga0207641_10026152 3300026088 Bacteria 4815
113 Ga0207676_10014007 3300026095 Bacteria 5757
114 Ga0207683_10001397 3300026121 Bacteria 21794
115 Ga0207683_10322662 3300026121 Bacteria 1415
116 Ga0207698_10084669 3300026142 Bacteria 2571
117 Ga0207428_10029774 3300027907 Bacteria 4519
118 Ga0268266_10377199 3300028379 Bacteria 1337
119 Ga0268264_10119963 3300028381 Bacteria 2316
120 Ga0307515_10104833 3300028794 Bacteria 3373
121 Ga0265338_10152102 3300028800 Bacteria 1797
122 Ga0307511_10001096 3300030521 Bacteria 28800
123 Ga0316177_1032656 3300030731 Bacteria 2920
124 Ga0316176_1115732 3300030732 Bacteria 2514
125 Ga0314311_1019512 3300030733 Bacteria 17159
126 Ga0316180_1060881 3300030736 Bacteria 3125
127 Ga0265325_10031528 3300031241 Bacteria 2836
128 Ga0307513_10040521 3300031456 Bacteria 5149
129 Ga0307513_10125584 3300031456 Bacteria 2522
130 Ga0307509_10290750 3300031507 Bacteria 1389
131 Ga0307413_10111760 3300031824 Bacteria 1830
132 Ga0307518_10000036 3300031838 Bacteria 91114
133 Ga0307518_10143807 3300031838 Bacteria 1659
134 Ga0307411_10041293 3300032005 Bacteria 2934
135 Ga0307507_10008178 3300033179 Bacteria 14663
136 Ga0307507_10022675 3300033179 Bacteria 6924
137 Ga0307507_10036220 3300033179 Bacteria 5049
138 Ga0373926_0004555 3300035083 Bacteria 4551
139 Ga0373935_0003132 3300035692 Bacteria 9547
140 Ga0373947_0000009 3300035725 Bacteria 172751
141 Ga0373925_0240148 3300037068 Bacteria 1451
142 Ga0436364_1129948 3300037853 Bacteria 21254
143 Ga0436364_1275546 3300037853 Bacteria 1960
144 Ga0436365_0022630 3300039437 Bacteria 7348
145 Ga0436362_0375916 3300039453 Bacteria 21750
146 Ga0451789_1022707 3300041443 Bacteria 1783
147 Ga0451791_0457924 3300041451 Bacteria 2078
148 Ga0451793_0999238 3300041452 Bacteria 2566
149 Ga0451797_0608614 3300041453 Bacteria 3164
150 Ga0451837_0838264 3300041494 Bacteria 1030
151 Ga0451843_0186514 3300041509 Bacteria 2085
152 Ga0439448_0010475 3300042005 Bacteria 2752
153 Ga0439449_0011077 3300042007 Bacteria 3399
154 Ga0439463_009843 3300042016 Bacteria 2349
155 Ga0439440_0038783 3300042993 Bacteria 1154
156 Ga0466969_0033105 3300044656 Bacteria 2626
157 Ga0466972_0001280 3300044658 Bacteria 12139
158 Ga0453683_0065724 3300044673 Bacteria 2267
159 Ga0466965_0001241 3300044683 Bacteria 10103
160 Ga0466965_0247085 3300044683 Bacteria 956
161 Ga0466966_0001110 3300044684 Bacteria 17258
162 Ga0466966_0002517 3300044684 Bacteria 12012
163 Ga0466966_0369658 3300044684 Bacteria 861
164 Ga0466961_0001725 3300044693 Bacteria 13595
165 Ga0466961_0040214 3300044693 Bacteria 2998
166 Ga0466963_0001724 3300044694 Bacteria 11903
167 Ga0466963_0244582 3300044694 Bacteria 1258
168 Ga0466964_0112126 3300044706 Bacteria 1218
169 Ga0466971_0000990 3300044719 Bacteria 11715
170 Ga0466968_0041831 3300044735 Bacteria 1936
171 Ga0466970_0007488 3300044765 Bacteria 5475
172 Ga0466970_0073169 3300044765 Bacteria 1844
173 Ga0466957_0002460 3300044842 Bacteria 9946
174 Ga0466957_0016885 3300044842 Bacteria 4271
175 Ga0466960_0047662 3300044901 Bacteria 2056
176 Ga0466959_0010237 3300045049 Bacteria 6696
177 Ga0466959_0034348 3300045049 Bacteria 3750
178 Ga0466959_0203394 3300045049 Bacteria 1378
179 Ga0466958_0000135 3300045836 Bacteria 24888
180 Ga0466958_0090339 3300045836 Bacteria 1895
181 Ga0466967_0000549 3300045976 Bacteria 18250
182 Ga0466967_0000569 3300045976 Bacteria 18154
183 Ga0466967_0026273 3300045976 Bacteria 4820
184 Ga0466967_0099515 3300045976 Bacteria 2656
185 Ga0466967_0219029 3300045976 Bacteria 1808
186 Ga0495629_0061612 3300046459 Bacteria 2622
187 Ga0495665_0010587 3300046531 Bacteria 4993
188 Ga0495646_0178406 3300046680 Bacteria 1167
189 Ga0495674_0196917 3300047319 Bacteria 1673
190 Ga0495683_0000575 3300047323 Bacteria 27777
191 Ga0495602_0532106 3300048088 Bacteria 817
192 Ga0496100_0377434 3300048903 Bacteria 1076
193 Ga0496101_0055037 3300048904 Bacteria 2873
194 Ga0496102_0080057 3300048905 Bacteria 3009
195 Ga0496104_0021752 3300048907 Bacteria 5890
196 Ga0496105_0053852 3300048908 Bacteria 3323
197 Ga0496105_0118338 3300048908 Bacteria 2185
198 Ga0496106_0066208 3300048909 Bacteria 2751
199 Ga0496106_0354996 3300048909 Bacteria 1178
200 Ga0496107_0016397 3300048910 Bacteria 5201
201 Ga0496108_0005804 3300048911 Bacteria 10006
202 Ga0496108_0578709 3300048911 Bacteria 979
203 Ga0496108_0599199 3300048911 Bacteria 960
204 Ga0496109_0000540 3300048912 Bacteria 31969
205 Ga0496109_0218475 3300048912 Bacteria 1793
206 Ga0496110_0000523 3300048913 Bacteria 26101
207 Ga0496110_0457058 3300048913 Bacteria 1163
208 Ga0496111_0000211 3300048914 Bacteria 27526
209 Ga0496111_0173935 3300048914 Bacteria 1600
210 Ga0496112_0847385 3300048915 Bacteria 837
211 Ga0496113_0017341 3300048916 Bacteria 4996
212 Ga0496113_0264409 3300048916 Bacteria 1374
213 Ga0496114_0002902 3300048917 Bacteria 13139
214 Ga0496114_0067002 3300048917 Bacteria 3011
215 Ga0496114_0130297 3300048917 Bacteria 2171
216 Ga0496114_0140522 3300048917 Bacteria 2090
217 Ga0496114_0189663 3300048917 Bacteria 1798
218 Ga0496115_0079003 3300048918 Bacteria 2678
219 Ga0496115_0287699 3300048918 Bacteria 1349
220 Ga0501047_0028632 3300049581 Bacteria 5372
221 nmdc:mga03683_71457_c1 3300050489 Bacteria 1484
222 nmdc:mga05p37_124481_c1 3300050507 Bacteria 3166
223 nmdc:mga06r32_44_c4 3300050510 Bacteria 11694
224 nmdc:mga0n895_301737_c1 3300050512 Bacteria 1624
225 Ga0500559_0003724 3300053136 Bacteria 7422
226 Ga0500568_0003332 3300053139 Bacteria 9030
227 Ga0466962_0015047 3300061719 Bacteria 3730
228 Ga0466962_0067449 3300061719 Bacteria 1708
229 Ga0530510_0078190 3300061734 Bacteria 2405

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025909 Ga0207705_10018642 Ga0207705_100186424 199
2 3300003203 JGI25406J46586_10009162 JGI25406J46586_100091622 207
3 3300005985 Ga0081539_10000094 Ga0081539_1000009440 207
4 3300021388 Ga0213875_10004022 Ga0213875_100040224 209
5 3300037853 Ga0436364_1129948 Ga0436364_1129948_15744_16598 209
6 3300005614 Ga0068856_100008884 Ga0068856_1000088844 212
7 3300005937 Ga0081455_10193901 Ga0081455_101939012 212
8 3300026078 Ga0207702_10004797 Ga0207702_100047975 212
9 3300049581 Ga0501047_0028632 Ga0501047_0028632_1647_2489 212
10 3300005338 Ga0068868_100070521 Ga0068868_1000705212 214
11 3300005355 Ga0070671_100077122 Ga0070671_1000771222 214
12 3300005364 Ga0070673_100115666 Ga0070673_1001156662 214
13 3300005841 Ga0068863_100259074 Ga0068863_1002590742 214
14 3300006881 Ga0068865_100158129 Ga0068865_1001581292 214
15 3300009011 Ga0105251_10133257 Ga0105251_101332572 214
16 3300014969 Ga0157376_10295531 Ga0157376_102955312 214
17 3300025901 Ga0207688_10179762 Ga0207688_101797621 214
18 3300025931 Ga0207644_10196696 Ga0207644_101966962 214
19 3300025960 Ga0207651_10109667 Ga0207651_101096672 214
20 3300025981 Ga0207640_10274180 Ga0207640_102741801 214
21 3300028381 Ga0268264_10119963 Ga0268264_101199632 214
22 3300009098 Ga0105245_10082286 Ga0105245_100822861 215
23 3300013308 Ga0157375_10035526 Ga0157375_100355262 215
24 3300025961 Ga0207712_10233284 Ga0207712_102332842 215
25 3300044684 Ga0466966_0369658 Ga0466966_0369658_21_707 215
26 3300046459 Ga0495629_0061612 Ga0495629_0061612_396_1241 215
27 3300048911 Ga0496108_0578709 Ga0496108_0578709_118_963 215
28 3300048912 Ga0496109_0218475 Ga0496109_0218475_329_1174 215
29 3300048917 Ga0496114_0130297 Ga0496114_0130297_118_963 215
30 3300048917 Ga0496114_0189663 Ga0496114_0189663_117_962 215
31 3300048918 Ga0496115_0287699 Ga0496115_0287699_318_1163 215
32 3300005434 Ga0070709_10256986 Ga0070709_102569862 216
33 3300005435 Ga0070714_100168433 Ga0070714_1001684332 216
34 3300005436 Ga0070713_100023799 Ga0070713_1000237992 216
35 3300005439 Ga0070711_100037144 Ga0070711_1000371443 216
36 3300006028 Ga0070717_10098840 Ga0070717_100988402 216
37 3300025915 Ga0207693_10144212 Ga0207693_101442122 216
38 3300025929 Ga0207664_10237054 Ga0207664_102370542 216
39 3300037068 Ga0373925_0240148 Ga0373925_0240148_179_904 216
40 3300005327 Ga0070658_10071845 Ga0070658_100718452 218
41 3300005563 Ga0068855_100003444 Ga0068855_1000034443 218
42 3300025909 Ga0207705_10029478 Ga0207705_100294781 218
43 3300025949 Ga0207667_10019999 Ga0207667_100199995 218
44 3300009148 Ga0105243_10004245 Ga0105243_100042455 222
45 3300009176 Ga0105242_10164804 Ga0105242_101648042 222
46 3300025935 Ga0207709_10008863 Ga0207709_100088634 222
47 3300031456 Ga0307513_10040521 Ga0307513_100405214 222
48 3300044673 Ga0453683_0065724 Ga0453683_0065724_760_1539 222
49 3300047323 Ga0495683_0000575 Ga0495683_0000575_23293_24072 222
50 3300048918 Ga0496115_0079003 Ga0496115_0079003_1180_1998 222
51 iso_pu_bacteria 2738543011 2739238130 222
52 iso_pu_bacteria 2889300758 2889303252 222
53 iso_pu_bacteria 2904765812 2904766512 222
54 iso_pu_bacteria 2904770941 2904772680 222
55 iso_pu_bacteria 2908811453 2908811472 222
56 iso_pu_bacteria 2919420072 2919421052 222
57 iso_pu_bacteria 2919432681 2919433190 222
58 iso_pu_bacteria 2939743619 2939745859 222
59 3300005334 Ga0068869_100015042 Ga0068869_1000150424 223
60 3300005336 Ga0070680_100055709 Ga0070680_1000557092 223
61 3300005337 Ga0070682_100031825 Ga0070682_1000318253 223
62 3300005341 Ga0070691_10010253 Ga0070691_100102532 223
63 3300005366 Ga0070659_100478277 Ga0070659_1004782772 223
64 3300005441 Ga0070700_100067946 Ga0070700_1000679462 223
65 3300005456 Ga0070678_100008452 Ga0070678_1000084523 223
66 3300005458 Ga0070681_10084866 Ga0070681_100848662 223
67 3300005530 Ga0070679_100092840 Ga0070679_1000928401 223
68 3300005547 Ga0070693_100011395 Ga0070693_1000113954 223
69 3300005548 Ga0070665_100032761 Ga0070665_1000327612 223
70 3300005615 Ga0070702_100021087 Ga0070702_1000210872 223
71 3300005616 Ga0068852_100581886 Ga0068852_1005818862 223
72 3300005840 Ga0068870_10004653 Ga0068870_100046533 223
73 3300006058 Ga0075432_10012204 Ga0075432_100122043 223
74 3300006237 Ga0097621_100017881 Ga0097621_1000178813 223
75 3300006358 Ga0068871_100053086 Ga0068871_1000530863 223
76 3300006844 Ga0075428_100249427 Ga0075428_1002494272 223
77 3300006871 Ga0075434_100013991 Ga0075434_1000139916 223
78 3300006880 Ga0075429_100035941 Ga0075429_1000359414 223
79 3300009101 Ga0105247_10096604 Ga0105247_100966042 223
80 3300009147 Ga0114129_10346024 Ga0114129_103460242 223
81 3300009174 Ga0105241_10008456 Ga0105241_100084562 223
82 3300009177 Ga0105248_10188046 Ga0105248_101880462 223
83 3300009545 Ga0105237_10027719 Ga0105237_100277192 223
84 3300010375 Ga0105239_10129991 Ga0105239_101299911 223
85 3300011119 Ga0105246_10034223 Ga0105246_100342232 223
86 3300013100 Ga0157373_10050605 Ga0157373_100506052 223
87 3300014745 Ga0157377_10031738 Ga0157377_100317382 223
88 3300014968 Ga0157379_10066796 Ga0157379_100667962 223
89 3300020081 Ga0206354_10667412 Ga0206354_106674122 223
90 3300020082 Ga0206353_10737186 Ga0206353_107371861 223
91 3300025900 Ga0207710_10061106 Ga0207710_100611062 223
92 3300025908 Ga0207643_10000496 Ga0207643_1000049611 223
93 3300025909 Ga0207705_10140007 Ga0207705_101400072 223
94 3300025917 Ga0207660_10382013 Ga0207660_103820132 223
95 3300025921 Ga0207652_10207747 Ga0207652_102077472 223
96 3300025924 Ga0207694_10298820 Ga0207694_102988202 223
97 3300025925 Ga0207650_10282785 Ga0207650_102827852 223
98 3300025926 Ga0207659_10087783 Ga0207659_100877832 223
99 3300025927 Ga0207687_10301038 Ga0207687_103010382 223
100 3300025932 Ga0207690_10151566 Ga0207690_101515662 223
101 3300025933 Ga0207706_10126304 Ga0207706_101263042 223
102 3300025935 Ga0207709_10247439 Ga0207709_102474391 223
103 3300025941 Ga0207711_10075469 Ga0207711_100754692 223
104 3300025942 Ga0207689_10003762 Ga0207689_100037629 223
105 3300026075 Ga0207708_10029237 Ga0207708_100292373 223
106 3300026078 Ga0207702_10003958 Ga0207702_100039588 223
107 3300026095 Ga0207676_10014007 Ga0207676_100140073 223
108 3300026121 Ga0207683_10001397 Ga0207683_1000139710 223
109 3300026142 Ga0207698_10084669 Ga0207698_100846692 223
110 3300027907 Ga0207428_10029774 Ga0207428_100297742 223
111 3300028379 Ga0268266_10377199 Ga0268266_103771991 223
112 3300035083 Ga0373926_0004555 Ga0373926_0004555_2756_3670 223
113 3300035692 Ga0373935_0003132 Ga0373935_0003132_1363_2277 223
114 3300035725 Ga0373947_0000009 Ga0373947_0000009_93062_93976 223
115 3300042005 Ga0439448_0010475 Ga0439448_0010475_524_1291 223
116 3300042016 Ga0439463_009843 Ga0439463_009843_1374_2180 223
117 3300042993 Ga0439440_0038783 Ga0439440_0038783_275_1081 223
118 3300044694 Ga0466963_0244582 Ga0466963_0244582_318_1148 223
119 3300044842 Ga0466957_0016885 Ga0466957_0016885_2051_2881 223
120 3300045836 Ga0466958_0090339 Ga0466958_0090339_713_1543 223
121 3300045976 Ga0466967_0000569 Ga0466967_0000569_2862_3689 223
122 3300045976 Ga0466967_0219029 Ga0466967_0219029_913_1743 223
123 3300048904 Ga0496101_0055037 Ga0496101_0055037_757_1524 223
124 3300048905 Ga0496102_0080057 Ga0496102_0080057_2155_2922 223
125 3300048909 Ga0496106_0066208 Ga0496106_0066208_1942_2709 223
126 3300048910 Ga0496107_0016397 Ga0496107_0016397_2255_3022 223
127 3300048911 Ga0496108_0599199 Ga0496108_0599199_31_891 223
128 3300048913 Ga0496110_0457058 Ga0496110_0457058_86_853 223
129 3300048914 Ga0496111_0173935 Ga0496111_0173935_500_1267 223
130 3300048915 Ga0496112_0847385 Ga0496112_0847385_89_814 223
131 3300048916 Ga0496113_0264409 Ga0496113_0264409_417_1184 223
132 3300050489 nmdc:mga03683_71457_c1 nmdc:mga03683_71457_c1_579_1382 223
133 3300050507 nmdc:mga05p37_124481_c1 nmdc:mga05p37_124481_c1_2233_3000 223
134 3300050512 nmdc:mga0n895_301737_c1 nmdc:mga0n895_301737_c1_321_1088 223
135 3300053139 Ga0500568_0003332 Ga0500568_0003332_5326_6159 223
136 3300005327 Ga0070658_10003440 Ga0070658_1000344013 224
137 3300005337 Ga0070682_100168474 Ga0070682_1001684742 224
138 3300005437 Ga0070710_10000680 Ga0070710_100006809 224
139 3300005458 Ga0070681_10519525 Ga0070681_105195251 224
140 3300009093 Ga0105240_10637101 Ga0105240_106371011 224
141 3300009545 Ga0105237_10155548 Ga0105237_101555482 224
142 3300009551 Ga0105238_10003581 Ga0105238_100035812 224
143 3300010375 Ga0105239_10441724 Ga0105239_104417242 224
144 3300025898 Ga0207692_10004117 Ga0207692_100041175 224
145 3300026041 Ga0207639_10052156 Ga0207639_100521562 224
146 3300028800 Ga0265338_10152102 Ga0265338_101521022 224
147 3300030521 Ga0307511_10001096 Ga0307511_1000109626 224
148 3300030731 Ga0316177_1032656 Ga0316177_10326562 224
149 3300030732 Ga0316176_1115732 Ga0316176_11157322 224
150 3300030733 Ga0314311_1019512 Ga0314311_10195127 224
151 3300030736 Ga0316180_1060881 Ga0316180_10608812 224
152 3300031241 Ga0265325_10031528 Ga0265325_100315282 224
153 3300031507 Ga0307509_10290750 Ga0307509_102907502 224
154 3300044656 Ga0466969_0033105 Ga0466969_0033105_1460_2236 224
155 3300044658 Ga0466972_0001280 Ga0466972_0001280_11149_11970 224
156 3300044683 Ga0466965_0001241 Ga0466965_0001241_4189_5010 224
157 3300044684 Ga0466966_0002517 Ga0466966_0002517_9367_10191 224
158 3300044693 Ga0466961_0001725 Ga0466961_0001725_855_1679 224
159 3300044706 Ga0466964_0112126 Ga0466964_0112126_388_1164 224
160 3300044765 Ga0466970_0073169 Ga0466970_0073169_331_1155 224
161 3300045049 Ga0466959_0034348 Ga0466959_0034348_2199_3023 224
162 3300061719 Ga0466962_0067449 Ga0466962_0067449_765_1589 224
163 iso_pu_bacteria 2558860280 2559427178 224
164 iso_pu_bacteria 2917736166 2917739800 224
165 3300025916 Ga0207663_10047167 Ga0207663_100471672 225
166 3300041443 Ga0451789_1022707 Ga0451789_1022707_48_893 225
167 3300041451 Ga0451791_0457924 Ga0451791_0457924_79_924 225
168 3300041452 Ga0451793_0999238 Ga0451793_0999238_170_1015 225
169 3300041453 Ga0451797_0608614 Ga0451797_0608614_978_1823 225
170 3300041494 Ga0451837_0838264 Ga0451837_0838264_132_977 225
171 3300041509 Ga0451843_0186514 Ga0451843_0186514_766_1611 225
172 3300046680 Ga0495646_0178406 Ga0495646_0178406_193_1038 225
173 3300047319 Ga0495674_0196917 Ga0495674_0196917_172_1017 225
174 3300048907 Ga0496104_0021752 Ga0496104_0021752_853_1698 225
175 3300048908 Ga0496105_0118338 Ga0496105_0118338_373_1218 225
176 3300048909 Ga0496106_0354996 Ga0496106_0354996_18_803 225
177 3300048911 Ga0496108_0005804 Ga0496108_0005804_6684_7529 225
178 3300048912 Ga0496109_0000540 Ga0496109_0000540_22866_23711 225
179 3300048913 Ga0496110_0000523 Ga0496110_0000523_23322_24167 225
180 3300048914 Ga0496111_0000211 Ga0496111_0000211_23195_24040 225
181 3300048916 Ga0496113_0017341 Ga0496113_0017341_433_1278 225
182 3300048917 Ga0496114_0067002 Ga0496114_0067002_227_1075 225
183 3300048917 Ga0496114_0140522 Ga0496114_0140522_74_919 225
184 iso_pu_bacteria 2775506925 2776370292 225
185 iso_pu_bacteria 2863067949 2863069122 225
186 iso_pu_bacteria 2866552031 2866552924 225
187 iso_pu_bacteria 8056207758 8056209136 225
188 3300031838 Ga0307518_10143807 Ga0307518_101438072 226
189 3300053136 Ga0500559_0003724 Ga0500559_0003724_1765_2628 226
190 3300021388 Ga0213875_10038992 Ga0213875_100389922 227
191 3300025937 Ga0207669_10489687 Ga0207669_104896871 227
192 3300037853 Ga0436364_1275546 Ga0436364_1275546_340_1083 227
193 3300046531 Ga0495665_0010587 Ga0495665_0010587_1779_2657 227
194 3300048903 Ga0496100_0377434 Ga0496100_0377434_195_1043 227
195 3300048908 Ga0496105_0053852 Ga0496105_0053852_2375_3223 227
196 3300048917 Ga0496114_0002902 Ga0496114_0002902_10188_11036 227
197 3300005337 Ga0070682_100258014 Ga0070682_1002580141 228
198 3300005338 Ga0068868_100148950 Ga0068868_1001489501 228
199 3300005347 Ga0070668_100004638 Ga0070668_1000046382 228
200 3300005841 Ga0068863_100113425 Ga0068863_1001134251 228
201 3300006186 Ga0075369_10006131 Ga0075369_100061312 228
202 3300014969 Ga0157376_10290131 Ga0157376_102901312 228
203 3300025972 Ga0207668_10005151 Ga0207668_100051514 228
204 3300026088 Ga0207641_10026152 Ga0207641_100261524 228
205 3300026121 Ga0207683_10322662 Ga0207683_103226622 228
206 3300028794 Ga0307515_10104833 Ga0307515_101048331 228
207 3300031838 Ga0307518_10000036 Ga0307518_1000003685 228
208 3300032005 Ga0307411_10041293 Ga0307411_100412932 228
209 3300033179 Ga0307507_10008178 Ga0307507_100081784 228
210 3300033179 Ga0307507_10022675 Ga0307507_100226752 228
211 3300042007 Ga0439449_0011077 Ga0439449_0011077_739_1521 228
212 3300044683 Ga0466965_0247085 Ga0466965_0247085_158_946 228
213 3300048088 Ga0495602_0532106 Ga0495602_0532106_17_757 228
214 3300061734 Ga0530510_0078190 Ga0530510_0078190_1242_2057 228
215 iso_pu_bacteria 2582580736 2583149470 228
216 iso_pu_bacteria 2585427649 2586058141 228
217 iso_pu_bacteria 2751185734 2753074473 228
218 iso_pu_bacteria 2808606522 2809593012 228
219 iso_pu_bacteria 2870721527 2870728928 228
220 iso_pu_bacteria 2899359706 2899364879 228
221 iso_pu_bacteria 2915768154 2915768281 228
222 iso_pu_bacteria 8047710418 8047715293 228
223 3300044765 Ga0466970_0007488 Ga0466970_0007488_4527_5381 229
224 3300050510 nmdc:mga06r32_44_c4 nmdc:mga06r32_44_c4_6491_7288 230
225 3300044684 Ga0466966_0001110 Ga0466966_0001110_15709_16551 231
226 3300044693 Ga0466961_0040214 Ga0466961_0040214_721_1563 231
227 3300044694 Ga0466963_0001724 Ga0466963_0001724_5438_6280 231
228 3300044719 Ga0466971_0000990 Ga0466971_0000990_1742_2584 231
229 3300044735 Ga0466968_0041831 Ga0466968_0041831_65_889 231
230 3300044842 Ga0466957_0002460 Ga0466957_0002460_1271_2113 231
231 3300045049 Ga0466959_0010237 Ga0466959_0010237_5314_6156 231
232 3300045049 Ga0466959_0203394 Ga0466959_0203394_517_1275 231
233 3300045836 Ga0466958_0000135 Ga0466958_0000135_711_1553 231
234 3300045976 Ga0466967_0000549 Ga0466967_0000549_2469_3227 231
235 3300045976 Ga0466967_0026273 Ga0466967_0026273_3431_4273 231
236 3300045976 Ga0466967_0099515 Ga0466967_0099515_1813_2604 231
237 3300061719 Ga0466962_0015047 Ga0466962_0015047_254_1096 231
238 3300005435 Ga0070714_100001968 Ga0070714_1000019683 232
239 3300005436 Ga0070713_100148019 Ga0070713_1001480192 232
240 3300006028 Ga0070717_10244245 Ga0070717_102442452 232
241 3300025928 Ga0207700_10286007 Ga0207700_102860072 232
242 3300021358 Ga0213873_10000423 Ga0213873_100004232 234
243 3300021384 Ga0213876_10020823 Ga0213876_100208233 234
244 3300031456 Ga0307513_10125584 Ga0307513_101255842 234
245 3300039437 Ga0436365_0022630 Ga0436365_0022630_2345_3217 234
246 3300039453 Ga0436362_0375916 Ga0436362_0375916_18534_19406 234
247 iso_pu_bacteria 2795385470 2795779966 234
248 3300003203 JGI25406J46586_10001180 JGI25406J46586_100011808 235
249 3300005985 Ga0081539_10000907 Ga0081539_1000090730 235
250 3300031824 Ga0307413_10111760 Ga0307413_101117602 235
251 3300033179 Ga0307507_10036220 Ga0307507_100362202 235
252 3300044901 Ga0466960_0047662 Ga0466960_0047662_801_1658 235
253 iso_pu_bacteria 2791354901 2791914343 235
254 iso_pu_bacteria 2795385472 2795793416 235
255 iso_pu_bacteria 2899370129 2899370269 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

31

287

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.8772 2 220
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.8677 2 224
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.8607 2 222
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.8521 2 223
2xio-assembly1.cif.gz_A structure of putative deoxyribonuclease tatdn1 isoform a 0.8511 2 220
ID Description Score Start End Superfamily
af_I1MNS0_5_296_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8999 2 189 3.20.20.140
af_A0A1D8PS00_9_414_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8835 10 185 3.20.20.140
af_Q9VDC1_36_319_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8748 2 223 3.20.20.140
af_O08343_1_262_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8711 2 225 3.20.20.140
af_G5EG18_4_286_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8695 2 223 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A523VG11-F1-model_v4 TatD family deoxyribonuclease 0.9905 2 137 GO:0005829
GO:0016788
AF-A0A349GAX6-F1-model_v4 Hydrolase TatD 0.9815 2 151 GO:0005829
GO:0016788
AF-A0A7V6RP70-F1-model_v4 TatD family hydrolase 0.9815 3 124 GO:0005829
GO:0016788
AF-A0A1Y1QBB3-F1-model_v4 Hydrolase TatD 0.9805 2 123 GO:0005829
GO:0016788
AF-A0A3B9QH37-F1-model_v4 Hydrolase TatD 0.9784 2 182 GO:0005829
GO:0016788
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map