F365613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 189 | 255 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100454653|Ga0075434_1004546532 |
| Length | 68 |
| Sequence | MTERKGVLLRLDPSVHDALARWASDELRSTNAQIEFLLRRALSEAGRLPRDAKQMRRPGRPPRDSTTY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 2 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 129 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 132 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 137 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 146 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 149 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 150 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 175 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 179 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 180 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 185 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 186 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 187 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 188 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 189 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0.39 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.16 |
| Nodule | 0 |
| Rhizoplane | 4.71 |
| Rhizosphere | 75.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1004986 | 3300002738 | Bacteria | 2215 |
| 2 | JGI25157J39369_1000020 | 3300002741 | Bacteria | 173287 |
| 3 | rootH1_10046157 | 3300003316 | Bacteria | 2174 |
| 4 | rootL2_10020231 | 3300003322 | Bacteria | 2799 |
| 5 | rootH1_10004784 | 3300003323 | Bacteria | 10415 |
| 6 | Ga0055539_1005534 | 3300003752 | Bacteria | 1638 |
| 7 | Ga0055535_1010297 | 3300003761 | Bacteria | 1547 |
| 8 | Ga0070690_100018360 | 3300005330 | Bacteria | 4224 |
| 9 | Ga0070690_100186916 | 3300005330 | Bacteria | 1434 |
| 10 | Ga0070670_100008784 | 3300005331 | Bacteria | 8623 |
| 11 | Ga0070670_100774977 | 3300005331 | Bacteria | 865 |
| 12 | Ga0070677_10072286 | 3300005333 | Bacteria | 1454 |
| 13 | Ga0068869_100000626 | 3300005334 | Bacteria | 19973 |
| 14 | Ga0070666_10432372 | 3300005335 | Bacteria | 949 |
| 15 | Ga0070666_10749159 | 3300005335 | Bacteria | 718 |
| 16 | Ga0068868_100067134 | 3300005338 | Bacteria | 2854 |
| 17 | Ga0070660_100154365 | 3300005339 | Bacteria | 1847 |
| 18 | Ga0070689_100070570 | 3300005340 | Bacteria | 2728 |
| 19 | Ga0070661_100766146 | 3300005344 | Bacteria | 790 |
| 20 | Ga0070661_101332776 | 3300005344 | Bacteria | 603 |
| 21 | Ga0070668_100100187 | 3300005347 | Bacteria | 2295 |
| 22 | Ga0070669_100602905 | 3300005353 | Bacteria | 920 |
| 23 | Ga0070671_100787144 | 3300005355 | Unclassified | 828 |
| 24 | Ga0070674_100153995 | 3300005356 | Bacteria | 1737 |
| 25 | Ga0070673_100393993 | 3300005364 | Bacteria | 1237 |
| 26 | Ga0070667_100014915 | 3300005367 | Bacteria | 6419 |
| 27 | Ga0070711_101405881 | 3300005439 | Bacteria | 607 |
| 28 | Ga0070705_100028571 | 3300005440 | Bacteria | 3056 |
| 29 | Ga0070708_100411642 | 3300005445 | Bacteria | 1275 |
| 30 | Ga0070663_100586447 | 3300005455 | Bacteria | 936 |
| 31 | Ga0070662_100054036 | 3300005457 | Bacteria | 2910 |
| 32 | Ga0068867_100004877 | 3300005459 | Bacteria | 9443 |
| 33 | Ga0070707_101809207 | 3300005468 | Bacteria | 578 |
| 34 | Ga0070699_102114889 | 3300005518 | Unclassified | 514 |
| 35 | Ga0070697_100459275 | 3300005536 | Bacteria | 1110 |
| 36 | Ga0068853_100358166 | 3300005539 | Bacteria | 1358 |
| 37 | Ga0070672_100087793 | 3300005543 | Bacteria | 2503 |
| 38 | Ga0070672_100369023 | 3300005543 | Bacteria | 1226 |
| 39 | Ga0070672_101676397 | 3300005543 | Bacteria | 571 |
| 40 | Ga0070686_100661786 | 3300005544 | Bacteria | 829 |
| 41 | Ga0070686_101294699 | 3300005544 | Unclassified | 608 |
| 42 | Ga0070695_100698086 | 3300005545 | Bacteria | 805 |
| 43 | Ga0070665_101994413 | 3300005548 | Bacteria | 586 |
| 44 | Ga0070704_100871544 | 3300005549 | Unclassified | 808 |
| 45 | Ga0068855_100000646 | 3300005563 | Bacteria | 42580 |
| 46 | Ga0068855_100032827 | 3300005563 | Bacteria | 6198 |
| 47 | Ga0068855_100523543 | 3300005563 | Bacteria | 1286 |
| 48 | Ga0068855_101850146 | 3300005563 | Bacteria | 612 |
| 49 | Ga0070664_100408708 | 3300005564 | Bacteria | 1242 |
| 50 | Ga0068857_100005658 | 3300005577 | Bacteria | 10685 |
| 51 | Ga0068857_100034085 | 3300005577 | Bacteria | 4505 |
| 52 | Ga0068854_100048994 | 3300005578 | Bacteria | 3016 |
| 53 | Ga0068854_100200824 | 3300005578 | Bacteria | 1567 |
| 54 | Ga0068854_100813038 | 3300005578 | Bacteria | 815 |
| 55 | Ga0068856_100002942 | 3300005614 | Bacteria | 17457 |
| 56 | Ga0068856_102027592 | 3300005614 | Bacteria | 585 |
| 57 | Ga0070702_100310063 | 3300005615 | Bacteria | 1095 |
| 58 | Ga0068852_100025494 | 3300005616 | Bacteria | 4791 |
| 59 | Ga0068859_100004854 | 3300005617 | Bacteria | 13681 |
| 60 | Ga0068859_100696191 | 3300005617 | Bacteria | 1107 |
| 61 | Ga0068864_100001041 | 3300005618 | Bacteria | 23265 |
| 62 | Ga0068861_100013270 | 3300005719 | Bacteria | 5765 |
| 63 | Ga0068861_100021912 | 3300005719 | Bacteria | 4597 |
| 64 | Ga0068870_10057376 | 3300005840 | Bacteria | 2081 |
| 65 | Ga0068863_100005340 | 3300005841 | Bacteria | 12674 |
| 66 | Ga0068858_100002220 | 3300005842 | Bacteria | 19643 |
| 67 | Ga0068858_100783383 | 3300005842 | Bacteria | 930 |
| 68 | Ga0068860_100001257 | 3300005843 | Bacteria | 27649 |
| 69 | Ga0068860_100946937 | 3300005843 | Bacteria | 878 |
| 70 | Ga0068862_100021434 | 3300005844 | Bacteria | 5399 |
| 71 | Ga0068862_100179798 | 3300005844 | Bacteria | 1898 |
| 72 | Ga0075365_10050084 | 3300006038 | Bacteria | 2755 |
| 73 | Ga0075365_11087629 | 3300006038 | Bacteria | 563 |
| 74 | Ga0075365_11245096 | 3300006038 | Unclassified | 523 |
| 75 | Ga0070712_100354757 | 3300006175 | Bacteria | 1201 |
| 76 | Ga0075362_10096483 | 3300006177 | Bacteria | 1378 |
| 77 | Ga0075362_10166702 | 3300006177 | Bacteria | 1063 |
| 78 | Ga0075367_10227648 | 3300006178 | Bacteria | 1167 |
| 79 | Ga0075366_10008604 | 3300006195 | Bacteria | 5682 |
| 80 | Ga0075366_10187175 | 3300006195 | Bacteria | 1258 |
| 81 | Ga0075366_10761732 | 3300006195 | Bacteria | 602 |
| 82 | Ga0097621_100198129 | 3300006237 | Bacteria | 1742 |
| 83 | Ga0075370_10041016 | 3300006353 | Bacteria | 2613 |
| 84 | Ga0075370_10899981 | 3300006353 | Bacteria | 541 |
| 85 | Ga0075434_100454653 | 3300006871 | Bacteria | 1302 |
| 86 | Ga0097620_100004854 | 3300006931 | Bacteria | 13681 |
| 87 | Ga0097620_100696171 | 3300006931 | Bacteria | 1107 |
| 88 | Ga0075435_100355195 | 3300007076 | Bacteria | 1257 |
| 89 | Ga0075435_100682332 | 3300007076 | Bacteria | 892 |
| 90 | Ga0105240_10020464 | 3300009093 | Bacteria | 8824 |
| 91 | Ga0105240_10029042 | 3300009093 | Bacteria | 7212 |
| 92 | Ga0105240_10031498 | 3300009093 | Bacteria | 6878 |
| 93 | Ga0105245_11437695 | 3300009098 | Unclassified | 740 |
| 94 | Ga0105247_10306439 | 3300009101 | Bacteria | 1103 |
| 95 | Ga0105243_10148675 | 3300009148 | Bacteria | 2007 |
| 96 | Ga0105243_10198429 | 3300009148 | Bacteria | 1758 |
| 97 | Ga0105243_11758348 | 3300009148 | Bacteria | 650 |
| 98 | Ga0105241_10114943 | 3300009174 | Bacteria | 2160 |
| 99 | Ga0105248_10036403 | 3300009177 | Bacteria | 5504 |
| 100 | Ga0105248_12540934 | 3300009177 | Bacteria | 584 |
| 101 | Ga0105237_12241810 | 3300009545 | Bacteria | 556 |
| 102 | Ga0105238_12014573 | 3300009551 | Bacteria | 611 |
| 103 | Ga0105249_10572520 | 3300009553 | Bacteria | 1182 |
| 104 | Ga0105239_10087384 | 3300010375 | Bacteria | 3437 |
| 105 | Ga0105246_10835216 | 3300011119 | Bacteria | 820 |
| 106 | Ga0157369_10086004 | 3300013105 | Bacteria | 3359 |
| 107 | Ga0157378_10135198 | 3300013297 | Bacteria | 2285 |
| 108 | Ga0157378_10449056 | 3300013297 | Bacteria | 1279 |
| 109 | Ga0157378_10882322 | 3300013297 | Bacteria | 924 |
| 110 | Ga0163162_10076914 | 3300013306 | Bacteria | 3400 |
| 111 | Ga0163163_10218553 | 3300014325 | Bacteria | 1954 |
| 112 | Ga0157380_12971532 | 3300014326 | Bacteria | 540 |
| 113 | Ga0157379_10002622 | 3300014968 | Bacteria | 15119 |
| 114 | Ga0157379_10614457 | 3300014968 | Bacteria | 1015 |
| 115 | Ga0157376_11201914 | 3300014969 | Bacteria | 786 |
| 116 | Ga0157376_11440210 | 3300014969 | Bacteria | 721 |
| 117 | Ga0207427_101842 | 3300025231 | Bacteria | 6745 |
| 118 | Ga0209258_100655 | 3300025242 | Bacteria | 25327 |
| 119 | Ga0209646_1000062 | 3300025246 | Bacteria | 252045 |
| 120 | Ga0209026_1000026 | 3300025250 | Bacteria | 352109 |
| 121 | Ga0209677_100116 | 3300025253 | Bacteria | 82606 |
| 122 | Ga0209759_1000050 | 3300025256 | Bacteria | 215979 |
| 123 | Ga0209759_1054671 | 3300025256 | Bacteria | 594 |
| 124 | Ga0207697_10081332 | 3300025315 | Bacteria | 1365 |
| 125 | Ga0207680_10540648 | 3300025903 | Bacteria | 831 |
| 126 | Ga0207680_10583943 | 3300025903 | Bacteria | 799 |
| 127 | Ga0207645_10035872 | 3300025907 | Bacteria | 3184 |
| 128 | Ga0207643_10049702 | 3300025908 | Bacteria | 2376 |
| 129 | Ga0207684_10640866 | 3300025910 | Bacteria | 906 |
| 130 | Ga0207654_10092584 | 3300025911 | Bacteria | 1846 |
| 131 | Ga0207695_10013770 | 3300025913 | Bacteria | 9623 |
| 132 | Ga0207695_10015985 | 3300025913 | Bacteria | 8809 |
| 133 | Ga0207695_10789152 | 3300025913 | Bacteria | 830 |
| 134 | Ga0207671_10945751 | 3300025914 | Bacteria | 680 |
| 135 | Ga0207693_10618390 | 3300025915 | Unclassified | 843 |
| 136 | Ga0207662_10370812 | 3300025918 | Bacteria | 965 |
| 137 | Ga0207657_10434577 | 3300025919 | Bacteria | 1031 |
| 138 | Ga0207681_10026867 | 3300025923 | Bacteria | 3716 |
| 139 | Ga0207694_10039003 | 3300025924 | Bacteria | 3654 |
| 140 | Ga0207650_10097277 | 3300025925 | Bacteria | 2259 |
| 141 | Ga0207644_10358963 | 3300025931 | Bacteria | 1185 |
| 142 | Ga0207644_11302131 | 3300025931 | Bacteria | 611 |
| 143 | Ga0207709_10198136 | 3300025935 | Bacteria | 1432 |
| 144 | Ga0207709_11012366 | 3300025935 | Bacteria | 679 |
| 145 | Ga0207670_10384069 | 3300025936 | Bacteria | 1119 |
| 146 | Ga0207669_10971707 | 3300025937 | Bacteria | 712 |
| 147 | Ga0207691_10105432 | 3300025940 | Bacteria | 2511 |
| 148 | Ga0207691_10792952 | 3300025940 | Bacteria | 796 |
| 149 | Ga0207711_10007628 | 3300025941 | Bacteria | 9048 |
| 150 | Ga0207689_10001714 | 3300025942 | Bacteria | 20752 |
| 151 | Ga0207679_10303708 | 3300025945 | Bacteria | 1377 |
| 152 | Ga0207667_10002910 | 3300025949 | Bacteria | 21258 |
| 153 | Ga0207667_10459884 | 3300025949 | Bacteria | 1293 |
| 154 | Ga0207667_10799068 | 3300025949 | Bacteria | 940 |
| 155 | Ga0207651_10353929 | 3300025960 | Bacteria | 1237 |
| 156 | Ga0207712_10862327 | 3300025961 | Unclassified | 799 |
| 157 | Ga0207668_10043906 | 3300025972 | Bacteria | 3037 |
| 158 | Ga0207640_10032282 | 3300025981 | Bacteria | 3245 |
| 159 | Ga0207640_10058008 | 3300025981 | Bacteria | 2549 |
| 160 | Ga0207658_10279073 | 3300025986 | Bacteria | 1431 |
| 161 | Ga0207677_10029999 | 3300026023 | Bacteria | 3465 |
| 162 | Ga0207703_10005691 | 3300026035 | Bacteria | 10001 |
| 163 | Ga0207639_10418742 | 3300026041 | Bacteria | 1210 |
| 164 | Ga0207639_10849268 | 3300026041 | Bacteria | 852 |
| 165 | Ga0207702_10000225 | 3300026078 | Bacteria | 65968 |
| 166 | Ga0207641_10012019 | 3300026088 | Bacteria | 7103 |
| 167 | Ga0207648_10007143 | 3300026089 | Bacteria | 11013 |
| 168 | Ga0207676_10002201 | 3300026095 | Bacteria | 14062 |
| 169 | Ga0207676_11283137 | 3300026095 | Bacteria | 727 |
| 170 | Ga0207674_10015221 | 3300026116 | Bacteria | 8462 |
| 171 | Ga0207674_10029422 | 3300026116 | Bacteria | 5783 |
| 172 | Ga0207675_100002566 | 3300026118 | Bacteria | 17991 |
| 173 | Ga0207675_100037104 | 3300026118 | Bacteria | 4546 |
| 174 | Ga0207698_10014413 | 3300026142 | Bacteria | 5254 |
| 175 | Ga0268266_10653841 | 3300028379 | Bacteria | 1012 |
| 176 | Ga0268265_10063583 | 3300028380 | Bacteria | 2839 |
| 177 | Ga0268264_10025956 | 3300028381 | Bacteria | 4783 |
| 178 | Ga0307515_10001683 | 3300028794 | Bacteria | 49294 |
| 179 | Ga0307511_10237963 | 3300030521 | Bacteria | 892 |
| 180 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 181 | Ga0307408_100844571 | 3300031548 | Unclassified | 834 |
| 182 | Ga0307408_101044007 | 3300031548 | Bacteria | 755 |
| 183 | Ga0307408_101305233 | 3300031548 | Bacteria | 680 |
| 184 | Ga0307514_10019908 | 3300031649 | Bacteria | 5487 |
| 185 | Ga0307516_10003374 | 3300031730 | Bacteria | 20612 |
| 186 | Ga0307516_10831793 | 3300031730 | Bacteria | 586 |
| 187 | Ga0307416_101163495 | 3300032002 | Bacteria | 877 |
| 188 | Ga0307411_10913702 | 3300032005 | Bacteria | 781 |
| 189 | Ga0373934_0426596 | 3300035086 | Bacteria | 555 |
| 190 | Ga0373944_0067812 | 3300035089 | Bacteria | 1156 |
| 191 | Ga0373924_0445698 | 3300035410 | Unclassified | 580 |
| 192 | Ga0373927_0034761 | 3300035695 | Bacteria | 3278 |
| 193 | Ga0373927_0691032 | 3300035695 | Bacteria | 674 |
| 194 | Ga0373947_0173591 | 3300035725 | Bacteria | 1400 |
| 195 | Ga0373925_0146062 | 3300037068 | Bacteria | 1854 |
| 196 | Ga0395898_0104510 | 3300037466 | Bacteria | 2716 |
| 197 | Ga0395905_0148473 | 3300037471 | Bacteria | 2205 |
| 198 | Ga0395905_0384955 | 3300037471 | Bacteria | 1297 |
| 199 | Ga0395901_0009036 | 3300038443 | Bacteria | 10088 |
| 200 | Ga0436365_1387471 | 3300039437 | Bacteria | 2430 |
| 201 | Ga0436361_1070611 | 3300039447 | Bacteria | 3518 |
| 202 | Ga0451793_0287153 | 3300041452 | Unclassified | 618 |
| 203 | Ga0451798_0707521 | 3300041458 | Bacteria | 576 |
| 204 | Ga0451843_1725638 | 3300041509 | Bacteria | 500 |
| 205 | Ga0451853_1625822 | 3300041512 | Bacteria | 2018 |
| 206 | Ga0451853_1738764 | 3300041512 | Bacteria | 658 |
| 207 | Ga0451853_3640036 | 3300041512 | Bacteria | 752 |
| 208 | Ga0450902_070829 | 3300042137 | Bacteria | 608 |
| 209 | Ga0451576_0071529 | 3300045051 | Bacteria | 3610 |
| 210 | Ga0451576_0300472 | 3300045051 | Bacteria | 1679 |
| 211 | Ga0495664_0053979 | 3300046477 | Bacteria | 2390 |
| 212 | Ga0495583_0000210 | 3300046506 | Bacteria | 98597 |
| 213 | Ga0495606_0002539 | 3300046507 | Bacteria | 21003 |
| 214 | Ga0495616_0004435 | 3300046513 | Bacteria | 8840 |
| 215 | Ga0495652_0948484 | 3300046529 | Bacteria | 565 |
| 216 | Ga0495586_0144856 | 3300046535 | Bacteria | 1335 |
| 217 | Ga0495598_0421975 | 3300046537 | Bacteria | 524 |
| 218 | Ga0495621_0033999 | 3300046539 | Bacteria | 1760 |
| 219 | Ga0495621_0250654 | 3300046539 | Bacteria | 723 |
| 220 | Ga0495668_0105020 | 3300046616 | Bacteria | 1545 |
| 221 | Ga0495625_0008037 | 3300046660 | Bacteria | 9050 |
| 222 | Ga0495658_0097234 | 3300046683 | Bacteria | 1752 |
| 223 | Ga0495649_0002088 | 3300046694 | Bacteria | 14355 |
| 224 | Ga0495589_0018249 | 3300046794 | Bacteria | 3599 |
| 225 | Ga0496102_0011097 | 3300048905 | Bacteria | 7759 |
| 226 | Ga0496103_0038424 | 3300048906 | Bacteria | 2937 |
| 227 | Ga0496104_0949664 | 3300048907 | Bacteria | 764 |
| 228 | Ga0496106_0606598 | 3300048909 | Bacteria | 876 |
| 229 | Ga0496107_0584359 | 3300048910 | Bacteria | 826 |
| 230 | Ga0496108_1019615 | 3300048911 | Bacteria | 706 |
| 231 | Ga0496109_0148699 | 3300048912 | Bacteria | 2192 |
| 232 | Ga0496109_0623542 | 3300048912 | Bacteria | 1015 |
| 233 | Ga0496110_1308341 | 3300048913 | Unclassified | 634 |
| 234 | Ga0496112_0659139 | 3300048915 | Bacteria | 976 |
| 235 | Ga0496118_0302540 | 3300048921 | Bacteria | 877 |
| 236 | Ga0501310_010201 | 3300049130 | Bacteria | 1045 |
| 237 | Ga0501042_0002056 | 3300049578 | Bacteria | 12207 |
| 238 | nmdc:mga03683_20961_c1 | 3300050489 | Bacteria | 2513 |
| 239 | nmdc:mga03683_287554_c1 | 3300050489 | Bacteria | 769 |
| 240 | nmdc:mga0yw44_1066338_c1 | 3300050492 | Bacteria | 546 |
| 241 | nmdc:mga0yw44_14471_c1 | 3300050492 | Bacteria | 4191 |
| 242 | nmdc:mga0yw44_657151_c1 | 3300050492 | Bacteria | 712 |
| 243 | nmdc:mga0k408_56020_c1 | 3300050493 | Bacteria | 2287 |
| 244 | nmdc:mga06z11_240436_c1 | 3300050494 | Bacteria | 1063 |
| 245 | nmdc:mga07m45_2438_c1 | 3300050496 | Bacteria | 8725 |
| 246 | nmdc:mga07m45_37733_c1 | 3300050496 | Bacteria | 2695 |
| 247 | nmdc:mga07m45_707033_c1 | 3300050496 | Bacteria | 579 |
| 248 | nmdc:mga0n895_317333_c1 | 3300050512 | Bacteria | 1579 |
| 249 | nmdc:mga0rr50_632926_c1 | 3300050513 | Bacteria | 912 |
| 250 | Ga0500578_0667662 | 3300053086 | Bacteria | 563 |
| 251 | Ga0500594_0000451 | 3300053118 | Bacteria | 9065 |
| 252 | Ga0500638_180605 | 3300053162 | Bacteria | 911 |
| 253 | Ga0500636_0045163 | 3300053177 | Bacteria | 2599 |
| 254 | Ga0500661_018268 | 3300055283 | Bacteria | 1250 |
| 255 | Ga0501082_1161646 | 3300060353 | Bacteria | 675 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005333 | Ga0070677_10072286 | Ga0070677_100722863 | 55 |
| 2 | 3300011119 | Ga0105246_10835216 | Ga0105246_108352161 | 55 |
| 3 | 3300046537 | Ga0495598_0421975 | Ga0495598_0421975_299_487 | 55 |
| 4 | 3300014326 | Ga0157380_12971532 | Ga0157380_129715322 | 57 |
| 5 | 3300006038 | Ga0075365_11087629 | Ga0075365_110876292 | 59 |
| 6 | 3300005356 | Ga0070674_100153995 | Ga0070674_1001539953 | 60 |
| 7 | 3300005468 | Ga0070707_101809207 | Ga0070707_1018092072 | 60 |
| 8 | 3300005543 | Ga0070672_100369023 | Ga0070672_1003690232 | 60 |
| 9 | 3300006175 | Ga0070712_100354757 | Ga0070712_1003547573 | 60 |
| 10 | 3300006177 | Ga0075362_10166702 | Ga0075362_101667022 | 60 |
| 11 | 3300006195 | Ga0075366_10187175 | Ga0075366_101871752 | 60 |
| 12 | 3300006195 | Ga0075366_10761732 | Ga0075366_107617322 | 60 |
| 13 | 3300006353 | Ga0075370_10041016 | Ga0075370_100410163 | 60 |
| 14 | 3300014969 | Ga0157376_11201914 | Ga0157376_112019142 | 60 |
| 15 | 3300025915 | Ga0207693_10618390 | Ga0207693_106183902 | 60 |
| 16 | 3300025937 | Ga0207669_10971707 | Ga0207669_109717072 | 60 |
| 17 | 3300031548 | Ga0307408_101044007 | Ga0307408_1010440072 | 60 |
| 18 | 3300037471 | Ga0395905_0148473 | Ga0395905_0148473_413_598 | 60 |
| 19 | 3300041452 | Ga0451793_0287153 | Ga0451793_0287153_205_399 | 60 |
| 20 | 3300041458 | Ga0451798_0707521 | Ga0451798_0707521_345_539 | 60 |
| 21 | 3300041512 | Ga0451853_3640036 | Ga0451853_3640036_113_307 | 60 |
| 22 | 3300049578 | Ga0501042_0002056 | Ga0501042_0002056_3816_4016 | 60 |
| 23 | 3300050489 | nmdc:mga03683_20961_c1 | nmdc:mga03683_20961_c1_398_583 | 60 |
| 24 | 3300050496 | nmdc:mga07m45_37733_c1 | nmdc:mga07m45_37733_c1_1943_2128 | 60 |
| 25 | 3300005518 | Ga0070699_102114889 | Ga0070699_1021148892 | 61 |
| 26 | 3300005545 | Ga0070695_100698086 | Ga0070695_1006980862 | 61 |
| 27 | 3300005548 | Ga0070665_101994413 | Ga0070665_1019944131 | 61 |
| 28 | 3300006871 | Ga0075434_100454653 | Ga0075434_1004546532 | 61 |
| 29 | 3300007076 | Ga0075435_100355195 | Ga0075435_1003551952 | 61 |
| 30 | 3300009177 | Ga0105248_12540934 | Ga0105248_125409341 | 61 |
| 31 | 3300013297 | Ga0157378_10135198 | Ga0157378_101351984 | 61 |
| 32 | 3300028379 | Ga0268266_10653841 | Ga0268266_106538412 | 61 |
| 33 | 3300032005 | Ga0307411_10913702 | Ga0307411_109137022 | 61 |
| 34 | 3300035410 | Ga0373924_0445698 | Ga0373924_0445698_160_351 | 61 |
| 35 | 3300039437 | Ga0436365_1387471 | Ga0436365_1387471_1190_1378 | 61 |
| 36 | 3300046539 | Ga0495621_0250654 | Ga0495621_0250654_155_352 | 61 |
| 37 | 3300050512 | nmdc:mga0n895_317333_c1 | nmdc:mga0n895_317333_c1_1031_1237 | 61 |
| 38 | 3300050513 | nmdc:mga0rr50_632926_c1 | nmdc:mga0rr50_632926_c1_160_366 | 61 |
| 39 | 3300005330 | Ga0070690_100186916 | Ga0070690_1001869162 | 62 |
| 40 | 3300005331 | Ga0070670_100008784 | Ga0070670_1000087846 | 62 |
| 41 | 3300005331 | Ga0070670_100774977 | Ga0070670_1007749772 | 62 |
| 42 | 3300005334 | Ga0068869_100000626 | Ga0068869_10000062612 | 62 |
| 43 | 3300005335 | Ga0070666_10432372 | Ga0070666_104323722 | 62 |
| 44 | 3300005338 | Ga0068868_100067134 | Ga0068868_1000671344 | 62 |
| 45 | 3300005340 | Ga0070689_100070570 | Ga0070689_1000705703 | 62 |
| 46 | 3300005344 | Ga0070661_100766146 | Ga0070661_1007661463 | 62 |
| 47 | 3300005347 | Ga0070668_100100187 | Ga0070668_1001001873 | 62 |
| 48 | 3300005353 | Ga0070669_100602905 | Ga0070669_1006029051 | 62 |
| 49 | 3300005355 | Ga0070671_100787144 | Ga0070671_1007871442 | 62 |
| 50 | 3300005364 | Ga0070673_100393993 | Ga0070673_1003939931 | 62 |
| 51 | 3300005367 | Ga0070667_100014915 | Ga0070667_1000149157 | 62 |
| 52 | 3300005440 | Ga0070705_100028571 | Ga0070705_1000285713 | 62 |
| 53 | 3300005445 | Ga0070708_100411642 | Ga0070708_1004116423 | 62 |
| 54 | 3300005457 | Ga0070662_100054036 | Ga0070662_1000540362 | 62 |
| 55 | 3300005459 | Ga0068867_100004877 | Ga0068867_1000048777 | 62 |
| 56 | 3300005536 | Ga0070697_100459275 | Ga0070697_1004592752 | 62 |
| 57 | 3300005543 | Ga0070672_100087793 | Ga0070672_1000877933 | 62 |
| 58 | 3300005544 | Ga0070686_101294699 | Ga0070686_1012946992 | 62 |
| 59 | 3300005549 | Ga0070704_100871544 | Ga0070704_1008715442 | 62 |
| 60 | 3300005563 | Ga0068855_100523543 | Ga0068855_1005235432 | 62 |
| 61 | 3300005564 | Ga0070664_100408708 | Ga0070664_1004087081 | 62 |
| 62 | 3300005577 | Ga0068857_100034085 | Ga0068857_1000340853 | 62 |
| 63 | 3300005578 | Ga0068854_100200824 | Ga0068854_1002008243 | 62 |
| 64 | 3300005615 | Ga0070702_100310063 | Ga0070702_1003100632 | 62 |
| 65 | 3300005617 | Ga0068859_100004854 | Ga0068859_1000048543 | 62 |
| 66 | 3300005617 | Ga0068859_100696191 | Ga0068859_1006961912 | 62 |
| 67 | 3300005618 | Ga0068864_100001041 | Ga0068864_1000010414 | 62 |
| 68 | 3300005719 | Ga0068861_100013270 | Ga0068861_1000132707 | 62 |
| 69 | 3300005840 | Ga0068870_10057376 | Ga0068870_100573765 | 62 |
| 70 | 3300005841 | Ga0068863_100005340 | Ga0068863_1000053404 | 62 |
| 71 | 3300005842 | Ga0068858_100002220 | Ga0068858_10000222015 | 62 |
| 72 | 3300005842 | Ga0068858_100783383 | Ga0068858_1007833832 | 62 |
| 73 | 3300005843 | Ga0068860_100001257 | Ga0068860_1000012577 | 62 |
| 74 | 3300005843 | Ga0068860_100946937 | Ga0068860_1009469372 | 62 |
| 75 | 3300005844 | Ga0068862_100021434 | Ga0068862_1000214344 | 62 |
| 76 | 3300006038 | Ga0075365_10050084 | Ga0075365_100500842 | 62 |
| 77 | 3300006038 | Ga0075365_11245096 | Ga0075365_112450961 | 62 |
| 78 | 3300006177 | Ga0075362_10096483 | Ga0075362_100964832 | 62 |
| 79 | 3300006178 | Ga0075367_10227648 | Ga0075367_102276482 | 62 |
| 80 | 3300006237 | Ga0097621_100198129 | Ga0097621_1001981294 | 62 |
| 81 | 3300006931 | Ga0097620_100004854 | Ga0097620_10000485410 | 62 |
| 82 | 3300006931 | Ga0097620_100696171 | Ga0097620_1006961712 | 62 |
| 83 | 3300007076 | Ga0075435_100682332 | Ga0075435_1006823322 | 62 |
| 84 | 3300009098 | Ga0105245_11437695 | Ga0105245_114376951 | 62 |
| 85 | 3300009101 | Ga0105247_10306439 | Ga0105247_103064393 | 62 |
| 86 | 3300009148 | Ga0105243_11758348 | Ga0105243_117583481 | 62 |
| 87 | 3300009177 | Ga0105248_10036403 | Ga0105248_100364036 | 62 |
| 88 | 3300009551 | Ga0105238_12014573 | Ga0105238_120145732 | 62 |
| 89 | 3300009553 | Ga0105249_10572520 | Ga0105249_105725203 | 62 |
| 90 | 3300013297 | Ga0157378_10449056 | Ga0157378_104490563 | 62 |
| 91 | 3300013306 | Ga0163162_10076914 | Ga0163162_100769144 | 62 |
| 92 | 3300014325 | Ga0163163_10218553 | Ga0163163_102185531 | 62 |
| 93 | 3300014968 | Ga0157379_10002622 | Ga0157379_100026229 | 62 |
| 94 | 3300025315 | Ga0207697_10081332 | Ga0207697_100813321 | 62 |
| 95 | 3300025903 | Ga0207680_10540648 | Ga0207680_105406482 | 62 |
| 96 | 3300025907 | Ga0207645_10035872 | Ga0207645_100358724 | 62 |
| 97 | 3300025908 | Ga0207643_10049702 | Ga0207643_100497022 | 62 |
| 98 | 3300025910 | Ga0207684_10640866 | Ga0207684_106408661 | 62 |
| 99 | 3300025914 | Ga0207671_10945751 | Ga0207671_109457511 | 62 |
| 100 | 3300025918 | Ga0207662_10370812 | Ga0207662_103708123 | 62 |
| 101 | 3300025923 | Ga0207681_10026867 | Ga0207681_100268675 | 62 |
| 102 | 3300025925 | Ga0207650_10097277 | Ga0207650_100972773 | 62 |
| 103 | 3300025931 | Ga0207644_10358963 | Ga0207644_103589632 | 62 |
| 104 | 3300025936 | Ga0207670_10384069 | Ga0207670_103840693 | 62 |
| 105 | 3300025940 | Ga0207691_10105432 | Ga0207691_101054323 | 62 |
| 106 | 3300025941 | Ga0207711_10007628 | Ga0207711_100076286 | 62 |
| 107 | 3300025942 | Ga0207689_10001714 | Ga0207689_1000171412 | 62 |
| 108 | 3300025945 | Ga0207679_10303708 | Ga0207679_103037081 | 62 |
| 109 | 3300025949 | Ga0207667_10459884 | Ga0207667_104598843 | 62 |
| 110 | 3300025960 | Ga0207651_10353929 | Ga0207651_103539293 | 62 |
| 111 | 3300025961 | Ga0207712_10862327 | Ga0207712_108623272 | 62 |
| 112 | 3300025972 | Ga0207668_10043906 | Ga0207668_100439063 | 62 |
| 113 | 3300025981 | Ga0207640_10058008 | Ga0207640_100580082 | 62 |
| 114 | 3300025986 | Ga0207658_10279073 | Ga0207658_102790733 | 62 |
| 115 | 3300026023 | Ga0207677_10029999 | Ga0207677_100299994 | 62 |
| 116 | 3300026035 | Ga0207703_10005691 | Ga0207703_100056913 | 62 |
| 117 | 3300026088 | Ga0207641_10012019 | Ga0207641_100120198 | 62 |
| 118 | 3300026089 | Ga0207648_10007143 | Ga0207648_100071438 | 62 |
| 119 | 3300026095 | Ga0207676_10002201 | Ga0207676_100022014 | 62 |
| 120 | 3300026116 | Ga0207674_10029422 | Ga0207674_100294228 | 62 |
| 121 | 3300026118 | Ga0207675_100002566 | Ga0207675_1000025667 | 62 |
| 122 | 3300028380 | Ga0268265_10063583 | Ga0268265_100635835 | 62 |
| 123 | 3300028381 | Ga0268264_10025956 | Ga0268264_100259564 | 62 |
| 124 | 3300028794 | Ga0307515_10001683 | Ga0307515_1000168342 | 62 |
| 125 | 3300031649 | Ga0307514_10019908 | Ga0307514_100199084 | 62 |
| 126 | 3300031730 | Ga0307516_10003374 | Ga0307516_1000337414 | 62 |
| 127 | 3300031730 | Ga0307516_10831793 | Ga0307516_108317931 | 62 |
| 128 | 3300041509 | Ga0451843_1725638 | Ga0451843_1725638_17_208 | 62 |
| 129 | 3300042137 | Ga0450902_070829 | Ga0450902_070829_333_584 | 62 |
| 130 | 3300046513 | Ga0495616_0004435 | Ga0495616_0004435_6378_6578 | 62 |
| 131 | 3300046539 | Ga0495621_0033999 | Ga0495621_0033999_494_694 | 62 |
| 132 | 3300048905 | Ga0496102_0011097 | Ga0496102_0011097_2344_2538 | 62 |
| 133 | 3300048906 | Ga0496103_0038424 | Ga0496103_0038424_940_1134 | 62 |
| 134 | 3300048909 | Ga0496106_0606598 | Ga0496106_0606598_311_505 | 62 |
| 135 | 3300048910 | Ga0496107_0584359 | Ga0496107_0584359_256_450 | 62 |
| 136 | 3300048911 | Ga0496108_1019615 | Ga0496108_1019615_275_466 | 62 |
| 137 | 3300048912 | Ga0496109_0148699 | Ga0496109_0148699_890_1084 | 62 |
| 138 | 3300048912 | Ga0496109_0623542 | Ga0496109_0623542_410_601 | 62 |
| 139 | 3300048913 | Ga0496110_1308341 | Ga0496110_1308341_394_588 | 62 |
| 140 | 3300048915 | Ga0496112_0659139 | Ga0496112_0659139_496_687 | 62 |
| 141 | 3300048921 | Ga0496118_0302540 | Ga0496118_0302540_624_824 | 62 |
| 142 | 3300049130 | Ga0501310_010201 | Ga0501310_010201_615_812 | 62 |
| 143 | 3300050489 | nmdc:mga03683_287554_c1 | nmdc:mga03683_287554_c1_23_217 | 62 |
| 144 | 3300050492 | nmdc:mga0yw44_1066338_c1 | nmdc:mga0yw44_1066338_c1_270_464 | 62 |
| 145 | 3300050492 | nmdc:mga0yw44_14471_c1 | nmdc:mga0yw44_14471_c1_3634_3828 | 62 |
| 146 | 3300050492 | nmdc:mga0yw44_657151_c1 | nmdc:mga0yw44_657151_c1_244_438 | 62 |
| 147 | 3300050494 | nmdc:mga06z11_240436_c1 | nmdc:mga06z11_240436_c1_108_302 | 62 |
| 148 | 3300050496 | nmdc:mga07m45_707033_c1 | nmdc:mga07m45_707033_c1_300_494 | 62 |
| 149 | 3300053118 | Ga0500594_0000451 | Ga0500594_0000451_8360_8560 | 62 |
| 150 | 3300035089 | Ga0373944_0067812 | Ga0373944_0067812_579_782 | 63 |
| 151 | 3300035695 | Ga0373927_0034761 | Ga0373927_0034761_660_863 | 63 |
| 152 | 3300035725 | Ga0373947_0173591 | Ga0373947_0173591_1172_1375 | 63 |
| 153 | 3300037068 | Ga0373925_0146062 | Ga0373925_0146062_1262_1465 | 63 |
| 154 | 3300045051 | Ga0451576_0300472 | Ga0451576_0300472_1403_1609 | 63 |
| 155 | 3300046477 | Ga0495664_0053979 | Ga0495664_0053979_2150_2353 | 63 |
| 156 | 3300046535 | Ga0495586_0144856 | Ga0495586_0144856_483_692 | 63 |
| 157 | 3300046683 | Ga0495658_0097234 | Ga0495658_0097234_1463_1666 | 63 |
| 158 | 3300060353 | Ga0501082_1161646 | Ga0501082_1161646_460_663 | 63 |
| 159 | 3300005844 | Ga0068862_100179798 | Ga0068862_1001797981 | 64 |
| 160 | 3300006195 | Ga0075366_10008604 | Ga0075366_100086043 | 64 |
| 161 | 3300009148 | Ga0105243_10148675 | Ga0105243_101486752 | 64 |
| 162 | 3300025935 | Ga0207709_10198136 | Ga0207709_101981362 | 64 |
| 163 | 3300039447 | Ga0436361_1070611 | Ga0436361_1070611_1998_2195 | 64 |
| 164 | 3300050493 | nmdc:mga0k408_56020_c1 | nmdc:mga0k408_56020_c1_567_773 | 64 |
| 165 | 3300005543 | Ga0070672_101676397 | Ga0070672_1016763972 | 65 |
| 166 | 3300014969 | Ga0157376_11440210 | Ga0157376_114402102 | 65 |
| 167 | 3300025940 | Ga0207691_10792952 | Ga0207691_107929523 | 65 |
| 168 | 3300030521 | Ga0307511_10237963 | Ga0307511_102379631 | 65 |
| 169 | 3300031548 | Ga0307408_100844571 | Ga0307408_1008445712 | 65 |
| 170 | 3300032002 | Ga0307416_101163495 | Ga0307416_1011634952 | 65 |
| 171 | 3300035695 | Ga0373927_0691032 | Ga0373927_0691032_156_353 | 65 |
| 172 | 3300037466 | Ga0395898_0104510 | Ga0395898_0104510_2443_2640 | 65 |
| 173 | 3300038443 | Ga0395901_0009036 | Ga0395901_0009036_5683_5880 | 65 |
| 174 | 3300046506 | Ga0495583_0000210 | Ga0495583_0000210_10569_10766 | 65 |
| 175 | 3300046507 | Ga0495606_0002539 | Ga0495606_0002539_10473_10670 | 65 |
| 176 | 3300046616 | Ga0495668_0105020 | Ga0495668_0105020_675_872 | 65 |
| 177 | 3300046660 | Ga0495625_0008037 | Ga0495625_0008037_8705_8902 | 65 |
| 178 | 3300046694 | Ga0495649_0002088 | Ga0495649_0002088_10642_10839 | 65 |
| 179 | 3300046794 | Ga0495589_0018249 | Ga0495589_0018249_3038_3235 | 65 |
| 180 | 3300053086 | Ga0500578_0667662 | Ga0500578_0667662_112_309 | 65 |
| 181 | 3300053162 | Ga0500638_180605 | Ga0500638_180605_654_851 | 65 |
| 182 | 3300053177 | Ga0500636_0045163 | Ga0500636_0045163_1472_1669 | 65 |
| 183 | 3300055283 | Ga0500661_018268 | Ga0500661_018268_221_418 | 65 |
| 184 | 3300002738 | JGI25154J39366_1004986 | JGI25154J39366_10049861 | 66 |
| 185 | 3300002741 | JGI25157J39369_1000020 | JGI25157J39369_1000020135 | 66 |
| 186 | 3300003316 | rootH1_10046157 | rootH1_100461574 | 66 |
| 187 | 3300003322 | rootL2_10020231 | rootL2_100202314 | 66 |
| 188 | 3300003323 | rootH1_10004784 | rootH1_100047843 | 66 |
| 189 | 3300003752 | Ga0055539_1005534 | Ga0055539_10055342 | 66 |
| 190 | 3300003761 | Ga0055535_1010297 | Ga0055535_10102973 | 66 |
| 191 | 3300005330 | Ga0070690_100018360 | Ga0070690_1000183602 | 66 |
| 192 | 3300005335 | Ga0070666_10749159 | Ga0070666_107491592 | 66 |
| 193 | 3300005339 | Ga0070660_100154365 | Ga0070660_1001543652 | 66 |
| 194 | 3300005344 | Ga0070661_101332776 | Ga0070661_1013327761 | 66 |
| 195 | 3300005439 | Ga0070711_101405881 | Ga0070711_1014058812 | 66 |
| 196 | 3300005455 | Ga0070663_100586447 | Ga0070663_1005864471 | 66 |
| 197 | 3300005539 | Ga0068853_100358166 | Ga0068853_1003581662 | 66 |
| 198 | 3300005544 | Ga0070686_100661786 | Ga0070686_1006617861 | 66 |
| 199 | 3300005563 | Ga0068855_100000646 | Ga0068855_10000064634 | 66 |
| 200 | 3300005563 | Ga0068855_100032827 | Ga0068855_1000328274 | 66 |
| 201 | 3300005563 | Ga0068855_101850146 | Ga0068855_1018501462 | 66 |
| 202 | 3300005577 | Ga0068857_100005658 | Ga0068857_1000056589 | 66 |
| 203 | 3300005578 | Ga0068854_100048994 | Ga0068854_1000489942 | 66 |
| 204 | 3300005578 | Ga0068854_100813038 | Ga0068854_1008130382 | 66 |
| 205 | 3300005614 | Ga0068856_100002942 | Ga0068856_1000029423 | 66 |
| 206 | 3300005614 | Ga0068856_102027592 | Ga0068856_1020275922 | 66 |
| 207 | 3300005616 | Ga0068852_100025494 | Ga0068852_1000254944 | 66 |
| 208 | 3300005719 | Ga0068861_100021912 | Ga0068861_1000219125 | 66 |
| 209 | 3300006353 | Ga0075370_10899981 | Ga0075370_108999812 | 66 |
| 210 | 3300009093 | Ga0105240_10020464 | Ga0105240_100204641 | 66 |
| 211 | 3300009093 | Ga0105240_10029042 | Ga0105240_100290426 | 66 |
| 212 | 3300009093 | Ga0105240_10031498 | Ga0105240_100314982 | 66 |
| 213 | 3300009148 | Ga0105243_10198429 | Ga0105243_101984292 | 66 |
| 214 | 3300009174 | Ga0105241_10114943 | Ga0105241_101149432 | 66 |
| 215 | 3300009545 | Ga0105237_12241810 | Ga0105237_122418102 | 66 |
| 216 | 3300010375 | Ga0105239_10087384 | Ga0105239_100873843 | 66 |
| 217 | 3300013105 | Ga0157369_10086004 | Ga0157369_100860042 | 66 |
| 218 | 3300013297 | Ga0157378_10882322 | Ga0157378_108823221 | 66 |
| 219 | 3300014968 | Ga0157379_10614457 | Ga0157379_106144571 | 66 |
| 220 | 3300025231 | Ga0207427_101842 | Ga0207427_1018424 | 66 |
| 221 | 3300025242 | Ga0209258_100655 | Ga0209258_1006555 | 66 |
| 222 | 3300025246 | Ga0209646_1000062 | Ga0209646_100006258 | 66 |
| 223 | 3300025250 | Ga0209026_1000026 | Ga0209026_1000026155 | 66 |
| 224 | 3300025253 | Ga0209677_100116 | Ga0209677_10011645 | 66 |
| 225 | 3300025256 | Ga0209759_1000050 | Ga0209759_100005027 | 66 |
| 226 | 3300025256 | Ga0209759_1054671 | Ga0209759_10546712 | 66 |
| 227 | 3300025903 | Ga0207680_10583943 | Ga0207680_105839432 | 66 |
| 228 | 3300025911 | Ga0207654_10092584 | Ga0207654_100925842 | 66 |
| 229 | 3300025913 | Ga0207695_10013770 | Ga0207695_100137704 | 66 |
| 230 | 3300025913 | Ga0207695_10015985 | Ga0207695_100159856 | 66 |
| 231 | 3300025913 | Ga0207695_10789152 | Ga0207695_107891521 | 66 |
| 232 | 3300025919 | Ga0207657_10434577 | Ga0207657_104345772 | 66 |
| 233 | 3300025924 | Ga0207694_10039003 | Ga0207694_100390033 | 66 |
| 234 | 3300025931 | Ga0207644_11302131 | Ga0207644_113021312 | 66 |
| 235 | 3300025935 | Ga0207709_11012366 | Ga0207709_110123662 | 66 |
| 236 | 3300025949 | Ga0207667_10002910 | Ga0207667_100029103 | 66 |
| 237 | 3300025949 | Ga0207667_10799068 | Ga0207667_107990682 | 66 |
| 238 | 3300025981 | Ga0207640_10032282 | Ga0207640_100322822 | 66 |
| 239 | 3300026041 | Ga0207639_10418742 | Ga0207639_104187422 | 66 |
| 240 | 3300026041 | Ga0207639_10849268 | Ga0207639_108492682 | 66 |
| 241 | 3300026078 | Ga0207702_10000225 | Ga0207702_1000022534 | 66 |
| 242 | 3300026095 | Ga0207676_11283137 | Ga0207676_112831372 | 66 |
| 243 | 3300026116 | Ga0207674_10015221 | Ga0207674_100152214 | 66 |
| 244 | 3300026118 | Ga0207675_100037104 | Ga0207675_1000371045 | 66 |
| 245 | 3300026142 | Ga0207698_10014413 | Ga0207698_100144132 | 66 |
| 246 | 3300031548 | Ga0307408_100000008 | Ga0307408_100000008366 | 66 |
| 247 | 3300031548 | Ga0307408_101305233 | Ga0307408_1013052332 | 66 |
| 248 | 3300035086 | Ga0373934_0426596 | Ga0373934_0426596_167_367 | 66 |
| 249 | 3300037471 | Ga0395905_0384955 | Ga0395905_0384955_176_376 | 66 |
| 250 | 3300041512 | Ga0451853_1625822 | Ga0451853_1625822_118_348 | 66 |
| 251 | 3300041512 | Ga0451853_1738764 | Ga0451853_1738764_168_368 | 66 |
| 252 | 3300045051 | Ga0451576_0071529 | Ga0451576_0071529_1270_1485 | 66 |
| 253 | 3300046529 | Ga0495652_0948484 | Ga0495652_0948484_59_259 | 66 |
| 254 | 3300048907 | Ga0496104_0949664 | Ga0496104_0949664_21_221 | 66 |
| 255 | 3300050496 | nmdc:mga07m45_2438_c1 | nmdc:mga07m45_2438_c1_5002_5202 | 66 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ywy-assembly1.cif.gz_44 | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.5606 | 32 | 56 |
| 7u46-assembly1.cif.gz_B | cryo-em structure of cenp-a nucleosome (palindromic alpha satellite dna) in complex with cenp-n | 0.3757 | 12 | 55 |
| 7u46-assembly1.cif.gz_B | cryo-em structure of cenp-a nucleosome (palindromic alpha satellite dna) in complex with cenp-n | 0.2694 | 12 | 55 |
| 6ywy-assembly1.cif.gz_44 | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.2606 | 32 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MYI1_1_131_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.9475 | 28 | 55 | 1.20.120.160 |
| af_Q2FX00_16_208_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.7069 | 38 | 55 | 3.40.50.880 |
| af_Q9CAT6_64_523_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6116 | 29 | 60 | 1.20.1250.20 |
| af_Q9LU98_1_150_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.5838 | 1 | 58 | 3.40.50.620 |
| af_Q9LU98_1_150_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.5109 | 1 | 58 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1EQJ1-F1-model_v4 | Uncharacterized protein | 0.6283 | 1 | 53 |
|
| AF-A0A3C1EQJ1-F1-model_v4 | Uncharacterized protein | 0.514 | 1 | 53 |
|
| AF-A0A7W8HWP7-F1-model_v4 | Arc-like DNA binding domain-containing protein | 0.4988 | 11 | 65 |
GO:0006355
|
| AF-A0A7W8HWP7-F1-model_v4 | Arc-like DNA binding domain-containing protein | 0.4905 | 11 | 65 |
GO:0006355
|
| AF-A0A3D1P0V5-F1-model_v4 | Toxin-antitoxin system HicB family antitoxin | 0.4784 | 1 | 58 |
GO:0006355
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar