F365613

General Info

Members Datasets Scaffolds Average Seq Length
255 189 255 65

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100454653|Ga0075434_1004546532
Length 68
Sequence MTERKGVLLRLDPSVHDALARWASDELRSTNAQIEFLLRRALSEAGRLPRDAKQMRRPGRPPRDSTTY

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
186 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.16
Nodule 0
Rhizoplane 4.71
Rhizosphere 75.29
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1004986 3300002738 Bacteria 2215
2 JGI25157J39369_1000020 3300002741 Bacteria 173287
3 rootH1_10046157 3300003316 Bacteria 2174
4 rootL2_10020231 3300003322 Bacteria 2799
5 rootH1_10004784 3300003323 Bacteria 10415
6 Ga0055539_1005534 3300003752 Bacteria 1638
7 Ga0055535_1010297 3300003761 Bacteria 1547
8 Ga0070690_100018360 3300005330 Bacteria 4224
9 Ga0070690_100186916 3300005330 Bacteria 1434
10 Ga0070670_100008784 3300005331 Bacteria 8623
11 Ga0070670_100774977 3300005331 Bacteria 865
12 Ga0070677_10072286 3300005333 Bacteria 1454
13 Ga0068869_100000626 3300005334 Bacteria 19973
14 Ga0070666_10432372 3300005335 Bacteria 949
15 Ga0070666_10749159 3300005335 Bacteria 718
16 Ga0068868_100067134 3300005338 Bacteria 2854
17 Ga0070660_100154365 3300005339 Bacteria 1847
18 Ga0070689_100070570 3300005340 Bacteria 2728
19 Ga0070661_100766146 3300005344 Bacteria 790
20 Ga0070661_101332776 3300005344 Bacteria 603
21 Ga0070668_100100187 3300005347 Bacteria 2295
22 Ga0070669_100602905 3300005353 Bacteria 920
23 Ga0070671_100787144 3300005355 Unclassified 828
24 Ga0070674_100153995 3300005356 Bacteria 1737
25 Ga0070673_100393993 3300005364 Bacteria 1237
26 Ga0070667_100014915 3300005367 Bacteria 6419
27 Ga0070711_101405881 3300005439 Bacteria 607
28 Ga0070705_100028571 3300005440 Bacteria 3056
29 Ga0070708_100411642 3300005445 Bacteria 1275
30 Ga0070663_100586447 3300005455 Bacteria 936
31 Ga0070662_100054036 3300005457 Bacteria 2910
32 Ga0068867_100004877 3300005459 Bacteria 9443
33 Ga0070707_101809207 3300005468 Bacteria 578
34 Ga0070699_102114889 3300005518 Unclassified 514
35 Ga0070697_100459275 3300005536 Bacteria 1110
36 Ga0068853_100358166 3300005539 Bacteria 1358
37 Ga0070672_100087793 3300005543 Bacteria 2503
38 Ga0070672_100369023 3300005543 Bacteria 1226
39 Ga0070672_101676397 3300005543 Bacteria 571
40 Ga0070686_100661786 3300005544 Bacteria 829
41 Ga0070686_101294699 3300005544 Unclassified 608
42 Ga0070695_100698086 3300005545 Bacteria 805
43 Ga0070665_101994413 3300005548 Bacteria 586
44 Ga0070704_100871544 3300005549 Unclassified 808
45 Ga0068855_100000646 3300005563 Bacteria 42580
46 Ga0068855_100032827 3300005563 Bacteria 6198
47 Ga0068855_100523543 3300005563 Bacteria 1286
48 Ga0068855_101850146 3300005563 Bacteria 612
49 Ga0070664_100408708 3300005564 Bacteria 1242
50 Ga0068857_100005658 3300005577 Bacteria 10685
51 Ga0068857_100034085 3300005577 Bacteria 4505
52 Ga0068854_100048994 3300005578 Bacteria 3016
53 Ga0068854_100200824 3300005578 Bacteria 1567
54 Ga0068854_100813038 3300005578 Bacteria 815
55 Ga0068856_100002942 3300005614 Bacteria 17457
56 Ga0068856_102027592 3300005614 Bacteria 585
57 Ga0070702_100310063 3300005615 Bacteria 1095
58 Ga0068852_100025494 3300005616 Bacteria 4791
59 Ga0068859_100004854 3300005617 Bacteria 13681
60 Ga0068859_100696191 3300005617 Bacteria 1107
61 Ga0068864_100001041 3300005618 Bacteria 23265
62 Ga0068861_100013270 3300005719 Bacteria 5765
63 Ga0068861_100021912 3300005719 Bacteria 4597
64 Ga0068870_10057376 3300005840 Bacteria 2081
65 Ga0068863_100005340 3300005841 Bacteria 12674
66 Ga0068858_100002220 3300005842 Bacteria 19643
67 Ga0068858_100783383 3300005842 Bacteria 930
68 Ga0068860_100001257 3300005843 Bacteria 27649
69 Ga0068860_100946937 3300005843 Bacteria 878
70 Ga0068862_100021434 3300005844 Bacteria 5399
71 Ga0068862_100179798 3300005844 Bacteria 1898
72 Ga0075365_10050084 3300006038 Bacteria 2755
73 Ga0075365_11087629 3300006038 Bacteria 563
74 Ga0075365_11245096 3300006038 Unclassified 523
75 Ga0070712_100354757 3300006175 Bacteria 1201
76 Ga0075362_10096483 3300006177 Bacteria 1378
77 Ga0075362_10166702 3300006177 Bacteria 1063
78 Ga0075367_10227648 3300006178 Bacteria 1167
79 Ga0075366_10008604 3300006195 Bacteria 5682
80 Ga0075366_10187175 3300006195 Bacteria 1258
81 Ga0075366_10761732 3300006195 Bacteria 602
82 Ga0097621_100198129 3300006237 Bacteria 1742
83 Ga0075370_10041016 3300006353 Bacteria 2613
84 Ga0075370_10899981 3300006353 Bacteria 541
85 Ga0075434_100454653 3300006871 Bacteria 1302
86 Ga0097620_100004854 3300006931 Bacteria 13681
87 Ga0097620_100696171 3300006931 Bacteria 1107
88 Ga0075435_100355195 3300007076 Bacteria 1257
89 Ga0075435_100682332 3300007076 Bacteria 892
90 Ga0105240_10020464 3300009093 Bacteria 8824
91 Ga0105240_10029042 3300009093 Bacteria 7212
92 Ga0105240_10031498 3300009093 Bacteria 6878
93 Ga0105245_11437695 3300009098 Unclassified 740
94 Ga0105247_10306439 3300009101 Bacteria 1103
95 Ga0105243_10148675 3300009148 Bacteria 2007
96 Ga0105243_10198429 3300009148 Bacteria 1758
97 Ga0105243_11758348 3300009148 Bacteria 650
98 Ga0105241_10114943 3300009174 Bacteria 2160
99 Ga0105248_10036403 3300009177 Bacteria 5504
100 Ga0105248_12540934 3300009177 Bacteria 584
101 Ga0105237_12241810 3300009545 Bacteria 556
102 Ga0105238_12014573 3300009551 Bacteria 611
103 Ga0105249_10572520 3300009553 Bacteria 1182
104 Ga0105239_10087384 3300010375 Bacteria 3437
105 Ga0105246_10835216 3300011119 Bacteria 820
106 Ga0157369_10086004 3300013105 Bacteria 3359
107 Ga0157378_10135198 3300013297 Bacteria 2285
108 Ga0157378_10449056 3300013297 Bacteria 1279
109 Ga0157378_10882322 3300013297 Bacteria 924
110 Ga0163162_10076914 3300013306 Bacteria 3400
111 Ga0163163_10218553 3300014325 Bacteria 1954
112 Ga0157380_12971532 3300014326 Bacteria 540
113 Ga0157379_10002622 3300014968 Bacteria 15119
114 Ga0157379_10614457 3300014968 Bacteria 1015
115 Ga0157376_11201914 3300014969 Bacteria 786
116 Ga0157376_11440210 3300014969 Bacteria 721
117 Ga0207427_101842 3300025231 Bacteria 6745
118 Ga0209258_100655 3300025242 Bacteria 25327
119 Ga0209646_1000062 3300025246 Bacteria 252045
120 Ga0209026_1000026 3300025250 Bacteria 352109
121 Ga0209677_100116 3300025253 Bacteria 82606
122 Ga0209759_1000050 3300025256 Bacteria 215979
123 Ga0209759_1054671 3300025256 Bacteria 594
124 Ga0207697_10081332 3300025315 Bacteria 1365
125 Ga0207680_10540648 3300025903 Bacteria 831
126 Ga0207680_10583943 3300025903 Bacteria 799
127 Ga0207645_10035872 3300025907 Bacteria 3184
128 Ga0207643_10049702 3300025908 Bacteria 2376
129 Ga0207684_10640866 3300025910 Bacteria 906
130 Ga0207654_10092584 3300025911 Bacteria 1846
131 Ga0207695_10013770 3300025913 Bacteria 9623
132 Ga0207695_10015985 3300025913 Bacteria 8809
133 Ga0207695_10789152 3300025913 Bacteria 830
134 Ga0207671_10945751 3300025914 Bacteria 680
135 Ga0207693_10618390 3300025915 Unclassified 843
136 Ga0207662_10370812 3300025918 Bacteria 965
137 Ga0207657_10434577 3300025919 Bacteria 1031
138 Ga0207681_10026867 3300025923 Bacteria 3716
139 Ga0207694_10039003 3300025924 Bacteria 3654
140 Ga0207650_10097277 3300025925 Bacteria 2259
141 Ga0207644_10358963 3300025931 Bacteria 1185
142 Ga0207644_11302131 3300025931 Bacteria 611
143 Ga0207709_10198136 3300025935 Bacteria 1432
144 Ga0207709_11012366 3300025935 Bacteria 679
145 Ga0207670_10384069 3300025936 Bacteria 1119
146 Ga0207669_10971707 3300025937 Bacteria 712
147 Ga0207691_10105432 3300025940 Bacteria 2511
148 Ga0207691_10792952 3300025940 Bacteria 796
149 Ga0207711_10007628 3300025941 Bacteria 9048
150 Ga0207689_10001714 3300025942 Bacteria 20752
151 Ga0207679_10303708 3300025945 Bacteria 1377
152 Ga0207667_10002910 3300025949 Bacteria 21258
153 Ga0207667_10459884 3300025949 Bacteria 1293
154 Ga0207667_10799068 3300025949 Bacteria 940
155 Ga0207651_10353929 3300025960 Bacteria 1237
156 Ga0207712_10862327 3300025961 Unclassified 799
157 Ga0207668_10043906 3300025972 Bacteria 3037
158 Ga0207640_10032282 3300025981 Bacteria 3245
159 Ga0207640_10058008 3300025981 Bacteria 2549
160 Ga0207658_10279073 3300025986 Bacteria 1431
161 Ga0207677_10029999 3300026023 Bacteria 3465
162 Ga0207703_10005691 3300026035 Bacteria 10001
163 Ga0207639_10418742 3300026041 Bacteria 1210
164 Ga0207639_10849268 3300026041 Bacteria 852
165 Ga0207702_10000225 3300026078 Bacteria 65968
166 Ga0207641_10012019 3300026088 Bacteria 7103
167 Ga0207648_10007143 3300026089 Bacteria 11013
168 Ga0207676_10002201 3300026095 Bacteria 14062
169 Ga0207676_11283137 3300026095 Bacteria 727
170 Ga0207674_10015221 3300026116 Bacteria 8462
171 Ga0207674_10029422 3300026116 Bacteria 5783
172 Ga0207675_100002566 3300026118 Bacteria 17991
173 Ga0207675_100037104 3300026118 Bacteria 4546
174 Ga0207698_10014413 3300026142 Bacteria 5254
175 Ga0268266_10653841 3300028379 Bacteria 1012
176 Ga0268265_10063583 3300028380 Bacteria 2839
177 Ga0268264_10025956 3300028381 Bacteria 4783
178 Ga0307515_10001683 3300028794 Bacteria 49294
179 Ga0307511_10237963 3300030521 Bacteria 892
180 Ga0307408_100000008 3300031548 Bacteria 456355
181 Ga0307408_100844571 3300031548 Unclassified 834
182 Ga0307408_101044007 3300031548 Bacteria 755
183 Ga0307408_101305233 3300031548 Bacteria 680
184 Ga0307514_10019908 3300031649 Bacteria 5487
185 Ga0307516_10003374 3300031730 Bacteria 20612
186 Ga0307516_10831793 3300031730 Bacteria 586
187 Ga0307416_101163495 3300032002 Bacteria 877
188 Ga0307411_10913702 3300032005 Bacteria 781
189 Ga0373934_0426596 3300035086 Bacteria 555
190 Ga0373944_0067812 3300035089 Bacteria 1156
191 Ga0373924_0445698 3300035410 Unclassified 580
192 Ga0373927_0034761 3300035695 Bacteria 3278
193 Ga0373927_0691032 3300035695 Bacteria 674
194 Ga0373947_0173591 3300035725 Bacteria 1400
195 Ga0373925_0146062 3300037068 Bacteria 1854
196 Ga0395898_0104510 3300037466 Bacteria 2716
197 Ga0395905_0148473 3300037471 Bacteria 2205
198 Ga0395905_0384955 3300037471 Bacteria 1297
199 Ga0395901_0009036 3300038443 Bacteria 10088
200 Ga0436365_1387471 3300039437 Bacteria 2430
201 Ga0436361_1070611 3300039447 Bacteria 3518
202 Ga0451793_0287153 3300041452 Unclassified 618
203 Ga0451798_0707521 3300041458 Bacteria 576
204 Ga0451843_1725638 3300041509 Bacteria 500
205 Ga0451853_1625822 3300041512 Bacteria 2018
206 Ga0451853_1738764 3300041512 Bacteria 658
207 Ga0451853_3640036 3300041512 Bacteria 752
208 Ga0450902_070829 3300042137 Bacteria 608
209 Ga0451576_0071529 3300045051 Bacteria 3610
210 Ga0451576_0300472 3300045051 Bacteria 1679
211 Ga0495664_0053979 3300046477 Bacteria 2390
212 Ga0495583_0000210 3300046506 Bacteria 98597
213 Ga0495606_0002539 3300046507 Bacteria 21003
214 Ga0495616_0004435 3300046513 Bacteria 8840
215 Ga0495652_0948484 3300046529 Bacteria 565
216 Ga0495586_0144856 3300046535 Bacteria 1335
217 Ga0495598_0421975 3300046537 Bacteria 524
218 Ga0495621_0033999 3300046539 Bacteria 1760
219 Ga0495621_0250654 3300046539 Bacteria 723
220 Ga0495668_0105020 3300046616 Bacteria 1545
221 Ga0495625_0008037 3300046660 Bacteria 9050
222 Ga0495658_0097234 3300046683 Bacteria 1752
223 Ga0495649_0002088 3300046694 Bacteria 14355
224 Ga0495589_0018249 3300046794 Bacteria 3599
225 Ga0496102_0011097 3300048905 Bacteria 7759
226 Ga0496103_0038424 3300048906 Bacteria 2937
227 Ga0496104_0949664 3300048907 Bacteria 764
228 Ga0496106_0606598 3300048909 Bacteria 876
229 Ga0496107_0584359 3300048910 Bacteria 826
230 Ga0496108_1019615 3300048911 Bacteria 706
231 Ga0496109_0148699 3300048912 Bacteria 2192
232 Ga0496109_0623542 3300048912 Bacteria 1015
233 Ga0496110_1308341 3300048913 Unclassified 634
234 Ga0496112_0659139 3300048915 Bacteria 976
235 Ga0496118_0302540 3300048921 Bacteria 877
236 Ga0501310_010201 3300049130 Bacteria 1045
237 Ga0501042_0002056 3300049578 Bacteria 12207
238 nmdc:mga03683_20961_c1 3300050489 Bacteria 2513
239 nmdc:mga03683_287554_c1 3300050489 Bacteria 769
240 nmdc:mga0yw44_1066338_c1 3300050492 Bacteria 546
241 nmdc:mga0yw44_14471_c1 3300050492 Bacteria 4191
242 nmdc:mga0yw44_657151_c1 3300050492 Bacteria 712
243 nmdc:mga0k408_56020_c1 3300050493 Bacteria 2287
244 nmdc:mga06z11_240436_c1 3300050494 Bacteria 1063
245 nmdc:mga07m45_2438_c1 3300050496 Bacteria 8725
246 nmdc:mga07m45_37733_c1 3300050496 Bacteria 2695
247 nmdc:mga07m45_707033_c1 3300050496 Bacteria 579
248 nmdc:mga0n895_317333_c1 3300050512 Bacteria 1579
249 nmdc:mga0rr50_632926_c1 3300050513 Bacteria 912
250 Ga0500578_0667662 3300053086 Bacteria 563
251 Ga0500594_0000451 3300053118 Bacteria 9065
252 Ga0500638_180605 3300053162 Bacteria 911
253 Ga0500636_0045163 3300053177 Bacteria 2599
254 Ga0500661_018268 3300055283 Bacteria 1250
255 Ga0501082_1161646 3300060353 Bacteria 675

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005333 Ga0070677_10072286 Ga0070677_100722863 55
2 3300011119 Ga0105246_10835216 Ga0105246_108352161 55
3 3300046537 Ga0495598_0421975 Ga0495598_0421975_299_487 55
4 3300014326 Ga0157380_12971532 Ga0157380_129715322 57
5 3300006038 Ga0075365_11087629 Ga0075365_110876292 59
6 3300005356 Ga0070674_100153995 Ga0070674_1001539953 60
7 3300005468 Ga0070707_101809207 Ga0070707_1018092072 60
8 3300005543 Ga0070672_100369023 Ga0070672_1003690232 60
9 3300006175 Ga0070712_100354757 Ga0070712_1003547573 60
10 3300006177 Ga0075362_10166702 Ga0075362_101667022 60
11 3300006195 Ga0075366_10187175 Ga0075366_101871752 60
12 3300006195 Ga0075366_10761732 Ga0075366_107617322 60
13 3300006353 Ga0075370_10041016 Ga0075370_100410163 60
14 3300014969 Ga0157376_11201914 Ga0157376_112019142 60
15 3300025915 Ga0207693_10618390 Ga0207693_106183902 60
16 3300025937 Ga0207669_10971707 Ga0207669_109717072 60
17 3300031548 Ga0307408_101044007 Ga0307408_1010440072 60
18 3300037471 Ga0395905_0148473 Ga0395905_0148473_413_598 60
19 3300041452 Ga0451793_0287153 Ga0451793_0287153_205_399 60
20 3300041458 Ga0451798_0707521 Ga0451798_0707521_345_539 60
21 3300041512 Ga0451853_3640036 Ga0451853_3640036_113_307 60
22 3300049578 Ga0501042_0002056 Ga0501042_0002056_3816_4016 60
23 3300050489 nmdc:mga03683_20961_c1 nmdc:mga03683_20961_c1_398_583 60
24 3300050496 nmdc:mga07m45_37733_c1 nmdc:mga07m45_37733_c1_1943_2128 60
25 3300005518 Ga0070699_102114889 Ga0070699_1021148892 61
26 3300005545 Ga0070695_100698086 Ga0070695_1006980862 61
27 3300005548 Ga0070665_101994413 Ga0070665_1019944131 61
28 3300006871 Ga0075434_100454653 Ga0075434_1004546532 61
29 3300007076 Ga0075435_100355195 Ga0075435_1003551952 61
30 3300009177 Ga0105248_12540934 Ga0105248_125409341 61
31 3300013297 Ga0157378_10135198 Ga0157378_101351984 61
32 3300028379 Ga0268266_10653841 Ga0268266_106538412 61
33 3300032005 Ga0307411_10913702 Ga0307411_109137022 61
34 3300035410 Ga0373924_0445698 Ga0373924_0445698_160_351 61
35 3300039437 Ga0436365_1387471 Ga0436365_1387471_1190_1378 61
36 3300046539 Ga0495621_0250654 Ga0495621_0250654_155_352 61
37 3300050512 nmdc:mga0n895_317333_c1 nmdc:mga0n895_317333_c1_1031_1237 61
38 3300050513 nmdc:mga0rr50_632926_c1 nmdc:mga0rr50_632926_c1_160_366 61
39 3300005330 Ga0070690_100186916 Ga0070690_1001869162 62
40 3300005331 Ga0070670_100008784 Ga0070670_1000087846 62
41 3300005331 Ga0070670_100774977 Ga0070670_1007749772 62
42 3300005334 Ga0068869_100000626 Ga0068869_10000062612 62
43 3300005335 Ga0070666_10432372 Ga0070666_104323722 62
44 3300005338 Ga0068868_100067134 Ga0068868_1000671344 62
45 3300005340 Ga0070689_100070570 Ga0070689_1000705703 62
46 3300005344 Ga0070661_100766146 Ga0070661_1007661463 62
47 3300005347 Ga0070668_100100187 Ga0070668_1001001873 62
48 3300005353 Ga0070669_100602905 Ga0070669_1006029051 62
49 3300005355 Ga0070671_100787144 Ga0070671_1007871442 62
50 3300005364 Ga0070673_100393993 Ga0070673_1003939931 62
51 3300005367 Ga0070667_100014915 Ga0070667_1000149157 62
52 3300005440 Ga0070705_100028571 Ga0070705_1000285713 62
53 3300005445 Ga0070708_100411642 Ga0070708_1004116423 62
54 3300005457 Ga0070662_100054036 Ga0070662_1000540362 62
55 3300005459 Ga0068867_100004877 Ga0068867_1000048777 62
56 3300005536 Ga0070697_100459275 Ga0070697_1004592752 62
57 3300005543 Ga0070672_100087793 Ga0070672_1000877933 62
58 3300005544 Ga0070686_101294699 Ga0070686_1012946992 62
59 3300005549 Ga0070704_100871544 Ga0070704_1008715442 62
60 3300005563 Ga0068855_100523543 Ga0068855_1005235432 62
61 3300005564 Ga0070664_100408708 Ga0070664_1004087081 62
62 3300005577 Ga0068857_100034085 Ga0068857_1000340853 62
63 3300005578 Ga0068854_100200824 Ga0068854_1002008243 62
64 3300005615 Ga0070702_100310063 Ga0070702_1003100632 62
65 3300005617 Ga0068859_100004854 Ga0068859_1000048543 62
66 3300005617 Ga0068859_100696191 Ga0068859_1006961912 62
67 3300005618 Ga0068864_100001041 Ga0068864_1000010414 62
68 3300005719 Ga0068861_100013270 Ga0068861_1000132707 62
69 3300005840 Ga0068870_10057376 Ga0068870_100573765 62
70 3300005841 Ga0068863_100005340 Ga0068863_1000053404 62
71 3300005842 Ga0068858_100002220 Ga0068858_10000222015 62
72 3300005842 Ga0068858_100783383 Ga0068858_1007833832 62
73 3300005843 Ga0068860_100001257 Ga0068860_1000012577 62
74 3300005843 Ga0068860_100946937 Ga0068860_1009469372 62
75 3300005844 Ga0068862_100021434 Ga0068862_1000214344 62
76 3300006038 Ga0075365_10050084 Ga0075365_100500842 62
77 3300006038 Ga0075365_11245096 Ga0075365_112450961 62
78 3300006177 Ga0075362_10096483 Ga0075362_100964832 62
79 3300006178 Ga0075367_10227648 Ga0075367_102276482 62
80 3300006237 Ga0097621_100198129 Ga0097621_1001981294 62
81 3300006931 Ga0097620_100004854 Ga0097620_10000485410 62
82 3300006931 Ga0097620_100696171 Ga0097620_1006961712 62
83 3300007076 Ga0075435_100682332 Ga0075435_1006823322 62
84 3300009098 Ga0105245_11437695 Ga0105245_114376951 62
85 3300009101 Ga0105247_10306439 Ga0105247_103064393 62
86 3300009148 Ga0105243_11758348 Ga0105243_117583481 62
87 3300009177 Ga0105248_10036403 Ga0105248_100364036 62
88 3300009551 Ga0105238_12014573 Ga0105238_120145732 62
89 3300009553 Ga0105249_10572520 Ga0105249_105725203 62
90 3300013297 Ga0157378_10449056 Ga0157378_104490563 62
91 3300013306 Ga0163162_10076914 Ga0163162_100769144 62
92 3300014325 Ga0163163_10218553 Ga0163163_102185531 62
93 3300014968 Ga0157379_10002622 Ga0157379_100026229 62
94 3300025315 Ga0207697_10081332 Ga0207697_100813321 62
95 3300025903 Ga0207680_10540648 Ga0207680_105406482 62
96 3300025907 Ga0207645_10035872 Ga0207645_100358724 62
97 3300025908 Ga0207643_10049702 Ga0207643_100497022 62
98 3300025910 Ga0207684_10640866 Ga0207684_106408661 62
99 3300025914 Ga0207671_10945751 Ga0207671_109457511 62
100 3300025918 Ga0207662_10370812 Ga0207662_103708123 62
101 3300025923 Ga0207681_10026867 Ga0207681_100268675 62
102 3300025925 Ga0207650_10097277 Ga0207650_100972773 62
103 3300025931 Ga0207644_10358963 Ga0207644_103589632 62
104 3300025936 Ga0207670_10384069 Ga0207670_103840693 62
105 3300025940 Ga0207691_10105432 Ga0207691_101054323 62
106 3300025941 Ga0207711_10007628 Ga0207711_100076286 62
107 3300025942 Ga0207689_10001714 Ga0207689_1000171412 62
108 3300025945 Ga0207679_10303708 Ga0207679_103037081 62
109 3300025949 Ga0207667_10459884 Ga0207667_104598843 62
110 3300025960 Ga0207651_10353929 Ga0207651_103539293 62
111 3300025961 Ga0207712_10862327 Ga0207712_108623272 62
112 3300025972 Ga0207668_10043906 Ga0207668_100439063 62
113 3300025981 Ga0207640_10058008 Ga0207640_100580082 62
114 3300025986 Ga0207658_10279073 Ga0207658_102790733 62
115 3300026023 Ga0207677_10029999 Ga0207677_100299994 62
116 3300026035 Ga0207703_10005691 Ga0207703_100056913 62
117 3300026088 Ga0207641_10012019 Ga0207641_100120198 62
118 3300026089 Ga0207648_10007143 Ga0207648_100071438 62
119 3300026095 Ga0207676_10002201 Ga0207676_100022014 62
120 3300026116 Ga0207674_10029422 Ga0207674_100294228 62
121 3300026118 Ga0207675_100002566 Ga0207675_1000025667 62
122 3300028380 Ga0268265_10063583 Ga0268265_100635835 62
123 3300028381 Ga0268264_10025956 Ga0268264_100259564 62
124 3300028794 Ga0307515_10001683 Ga0307515_1000168342 62
125 3300031649 Ga0307514_10019908 Ga0307514_100199084 62
126 3300031730 Ga0307516_10003374 Ga0307516_1000337414 62
127 3300031730 Ga0307516_10831793 Ga0307516_108317931 62
128 3300041509 Ga0451843_1725638 Ga0451843_1725638_17_208 62
129 3300042137 Ga0450902_070829 Ga0450902_070829_333_584 62
130 3300046513 Ga0495616_0004435 Ga0495616_0004435_6378_6578 62
131 3300046539 Ga0495621_0033999 Ga0495621_0033999_494_694 62
132 3300048905 Ga0496102_0011097 Ga0496102_0011097_2344_2538 62
133 3300048906 Ga0496103_0038424 Ga0496103_0038424_940_1134 62
134 3300048909 Ga0496106_0606598 Ga0496106_0606598_311_505 62
135 3300048910 Ga0496107_0584359 Ga0496107_0584359_256_450 62
136 3300048911 Ga0496108_1019615 Ga0496108_1019615_275_466 62
137 3300048912 Ga0496109_0148699 Ga0496109_0148699_890_1084 62
138 3300048912 Ga0496109_0623542 Ga0496109_0623542_410_601 62
139 3300048913 Ga0496110_1308341 Ga0496110_1308341_394_588 62
140 3300048915 Ga0496112_0659139 Ga0496112_0659139_496_687 62
141 3300048921 Ga0496118_0302540 Ga0496118_0302540_624_824 62
142 3300049130 Ga0501310_010201 Ga0501310_010201_615_812 62
143 3300050489 nmdc:mga03683_287554_c1 nmdc:mga03683_287554_c1_23_217 62
144 3300050492 nmdc:mga0yw44_1066338_c1 nmdc:mga0yw44_1066338_c1_270_464 62
145 3300050492 nmdc:mga0yw44_14471_c1 nmdc:mga0yw44_14471_c1_3634_3828 62
146 3300050492 nmdc:mga0yw44_657151_c1 nmdc:mga0yw44_657151_c1_244_438 62
147 3300050494 nmdc:mga06z11_240436_c1 nmdc:mga06z11_240436_c1_108_302 62
148 3300050496 nmdc:mga07m45_707033_c1 nmdc:mga07m45_707033_c1_300_494 62
149 3300053118 Ga0500594_0000451 Ga0500594_0000451_8360_8560 62
150 3300035089 Ga0373944_0067812 Ga0373944_0067812_579_782 63
151 3300035695 Ga0373927_0034761 Ga0373927_0034761_660_863 63
152 3300035725 Ga0373947_0173591 Ga0373947_0173591_1172_1375 63
153 3300037068 Ga0373925_0146062 Ga0373925_0146062_1262_1465 63
154 3300045051 Ga0451576_0300472 Ga0451576_0300472_1403_1609 63
155 3300046477 Ga0495664_0053979 Ga0495664_0053979_2150_2353 63
156 3300046535 Ga0495586_0144856 Ga0495586_0144856_483_692 63
157 3300046683 Ga0495658_0097234 Ga0495658_0097234_1463_1666 63
158 3300060353 Ga0501082_1161646 Ga0501082_1161646_460_663 63
159 3300005844 Ga0068862_100179798 Ga0068862_1001797981 64
160 3300006195 Ga0075366_10008604 Ga0075366_100086043 64
161 3300009148 Ga0105243_10148675 Ga0105243_101486752 64
162 3300025935 Ga0207709_10198136 Ga0207709_101981362 64
163 3300039447 Ga0436361_1070611 Ga0436361_1070611_1998_2195 64
164 3300050493 nmdc:mga0k408_56020_c1 nmdc:mga0k408_56020_c1_567_773 64
165 3300005543 Ga0070672_101676397 Ga0070672_1016763972 65
166 3300014969 Ga0157376_11440210 Ga0157376_114402102 65
167 3300025940 Ga0207691_10792952 Ga0207691_107929523 65
168 3300030521 Ga0307511_10237963 Ga0307511_102379631 65
169 3300031548 Ga0307408_100844571 Ga0307408_1008445712 65
170 3300032002 Ga0307416_101163495 Ga0307416_1011634952 65
171 3300035695 Ga0373927_0691032 Ga0373927_0691032_156_353 65
172 3300037466 Ga0395898_0104510 Ga0395898_0104510_2443_2640 65
173 3300038443 Ga0395901_0009036 Ga0395901_0009036_5683_5880 65
174 3300046506 Ga0495583_0000210 Ga0495583_0000210_10569_10766 65
175 3300046507 Ga0495606_0002539 Ga0495606_0002539_10473_10670 65
176 3300046616 Ga0495668_0105020 Ga0495668_0105020_675_872 65
177 3300046660 Ga0495625_0008037 Ga0495625_0008037_8705_8902 65
178 3300046694 Ga0495649_0002088 Ga0495649_0002088_10642_10839 65
179 3300046794 Ga0495589_0018249 Ga0495589_0018249_3038_3235 65
180 3300053086 Ga0500578_0667662 Ga0500578_0667662_112_309 65
181 3300053162 Ga0500638_180605 Ga0500638_180605_654_851 65
182 3300053177 Ga0500636_0045163 Ga0500636_0045163_1472_1669 65
183 3300055283 Ga0500661_018268 Ga0500661_018268_221_418 65
184 3300002738 JGI25154J39366_1004986 JGI25154J39366_10049861 66
185 3300002741 JGI25157J39369_1000020 JGI25157J39369_1000020135 66
186 3300003316 rootH1_10046157 rootH1_100461574 66
187 3300003322 rootL2_10020231 rootL2_100202314 66
188 3300003323 rootH1_10004784 rootH1_100047843 66
189 3300003752 Ga0055539_1005534 Ga0055539_10055342 66
190 3300003761 Ga0055535_1010297 Ga0055535_10102973 66
191 3300005330 Ga0070690_100018360 Ga0070690_1000183602 66
192 3300005335 Ga0070666_10749159 Ga0070666_107491592 66
193 3300005339 Ga0070660_100154365 Ga0070660_1001543652 66
194 3300005344 Ga0070661_101332776 Ga0070661_1013327761 66
195 3300005439 Ga0070711_101405881 Ga0070711_1014058812 66
196 3300005455 Ga0070663_100586447 Ga0070663_1005864471 66
197 3300005539 Ga0068853_100358166 Ga0068853_1003581662 66
198 3300005544 Ga0070686_100661786 Ga0070686_1006617861 66
199 3300005563 Ga0068855_100000646 Ga0068855_10000064634 66
200 3300005563 Ga0068855_100032827 Ga0068855_1000328274 66
201 3300005563 Ga0068855_101850146 Ga0068855_1018501462 66
202 3300005577 Ga0068857_100005658 Ga0068857_1000056589 66
203 3300005578 Ga0068854_100048994 Ga0068854_1000489942 66
204 3300005578 Ga0068854_100813038 Ga0068854_1008130382 66
205 3300005614 Ga0068856_100002942 Ga0068856_1000029423 66
206 3300005614 Ga0068856_102027592 Ga0068856_1020275922 66
207 3300005616 Ga0068852_100025494 Ga0068852_1000254944 66
208 3300005719 Ga0068861_100021912 Ga0068861_1000219125 66
209 3300006353 Ga0075370_10899981 Ga0075370_108999812 66
210 3300009093 Ga0105240_10020464 Ga0105240_100204641 66
211 3300009093 Ga0105240_10029042 Ga0105240_100290426 66
212 3300009093 Ga0105240_10031498 Ga0105240_100314982 66
213 3300009148 Ga0105243_10198429 Ga0105243_101984292 66
214 3300009174 Ga0105241_10114943 Ga0105241_101149432 66
215 3300009545 Ga0105237_12241810 Ga0105237_122418102 66
216 3300010375 Ga0105239_10087384 Ga0105239_100873843 66
217 3300013105 Ga0157369_10086004 Ga0157369_100860042 66
218 3300013297 Ga0157378_10882322 Ga0157378_108823221 66
219 3300014968 Ga0157379_10614457 Ga0157379_106144571 66
220 3300025231 Ga0207427_101842 Ga0207427_1018424 66
221 3300025242 Ga0209258_100655 Ga0209258_1006555 66
222 3300025246 Ga0209646_1000062 Ga0209646_100006258 66
223 3300025250 Ga0209026_1000026 Ga0209026_1000026155 66
224 3300025253 Ga0209677_100116 Ga0209677_10011645 66
225 3300025256 Ga0209759_1000050 Ga0209759_100005027 66
226 3300025256 Ga0209759_1054671 Ga0209759_10546712 66
227 3300025903 Ga0207680_10583943 Ga0207680_105839432 66
228 3300025911 Ga0207654_10092584 Ga0207654_100925842 66
229 3300025913 Ga0207695_10013770 Ga0207695_100137704 66
230 3300025913 Ga0207695_10015985 Ga0207695_100159856 66
231 3300025913 Ga0207695_10789152 Ga0207695_107891521 66
232 3300025919 Ga0207657_10434577 Ga0207657_104345772 66
233 3300025924 Ga0207694_10039003 Ga0207694_100390033 66
234 3300025931 Ga0207644_11302131 Ga0207644_113021312 66
235 3300025935 Ga0207709_11012366 Ga0207709_110123662 66
236 3300025949 Ga0207667_10002910 Ga0207667_100029103 66
237 3300025949 Ga0207667_10799068 Ga0207667_107990682 66
238 3300025981 Ga0207640_10032282 Ga0207640_100322822 66
239 3300026041 Ga0207639_10418742 Ga0207639_104187422 66
240 3300026041 Ga0207639_10849268 Ga0207639_108492682 66
241 3300026078 Ga0207702_10000225 Ga0207702_1000022534 66
242 3300026095 Ga0207676_11283137 Ga0207676_112831372 66
243 3300026116 Ga0207674_10015221 Ga0207674_100152214 66
244 3300026118 Ga0207675_100037104 Ga0207675_1000371045 66
245 3300026142 Ga0207698_10014413 Ga0207698_100144132 66
246 3300031548 Ga0307408_100000008 Ga0307408_100000008366 66
247 3300031548 Ga0307408_101305233 Ga0307408_1013052332 66
248 3300035086 Ga0373934_0426596 Ga0373934_0426596_167_367 66
249 3300037471 Ga0395905_0384955 Ga0395905_0384955_176_376 66
250 3300041512 Ga0451853_1625822 Ga0451853_1625822_118_348 66
251 3300041512 Ga0451853_1738764 Ga0451853_1738764_168_368 66
252 3300045051 Ga0451576_0071529 Ga0451576_0071529_1270_1485 66
253 3300046529 Ga0495652_0948484 Ga0495652_0948484_59_259 66
254 3300048907 Ga0496104_0949664 Ga0496104_0949664_21_221 66
255 3300050496 nmdc:mga07m45_2438_c1 nmdc:mga07m45_2438_c1_5002_5202 66

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ywy-assembly1.cif.gz_44 the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.5606 32 56
7u46-assembly1.cif.gz_B cryo-em structure of cenp-a nucleosome (palindromic alpha satellite dna) in complex with cenp-n 0.3757 12 55
7u46-assembly1.cif.gz_B cryo-em structure of cenp-a nucleosome (palindromic alpha satellite dna) in complex with cenp-n 0.2694 12 55
6ywy-assembly1.cif.gz_44 the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.2606 32 56
ID Description Score Start End Superfamily
af_K7MYI1_1_131_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.9475 28 55 1.20.120.160
af_Q2FX00_16_208_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7069 38 55 3.40.50.880
af_Q9CAT6_64_523_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6116 29 60 1.20.1250.20
af_Q9LU98_1_150_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5838 1 58 3.40.50.620
af_Q9LU98_1_150_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5109 1 58 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3C1EQJ1-F1-model_v4 Uncharacterized protein 0.6283 1 53
AF-A0A3C1EQJ1-F1-model_v4 Uncharacterized protein 0.514 1 53
AF-A0A7W8HWP7-F1-model_v4 Arc-like DNA binding domain-containing protein 0.4988 11 65 GO:0006355
AF-A0A7W8HWP7-F1-model_v4 Arc-like DNA binding domain-containing protein 0.4905 11 65 GO:0006355
AF-A0A3D1P0V5-F1-model_v4 Toxin-antitoxin system HicB family antitoxin 0.4784 1 58 GO:0006355

Feature Viewer

pLDDT pTM Quality
79.92 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map