F365584

General Info

Members Datasets Scaffolds Average Seq Length
255 171 510 79

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10447069|Ga0075364_104470692
Length 94
Sequence MARASEPVPEKGLKMPLDPQLLEILACPQDKGPLLYFADEDVLYNPRLKRRYEVRDDIPIMLIDEATGVDDAEHERLLAKADADGVRPTFEPSP

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
77 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
78 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
79 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
168 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.37
Nodule 0
Rhizoplane 6.27
Rhizosphere 79.61
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10447069 3300006051 Bacteria 883
2 JGI25405J52794_10051786 3300003911 Bacteria 881
3 Ga0070683_102408077 3300005329 Bacteria 505
4 Ga0068869_100442499 3300005334 Bacteria 1076
5 Ga0068869_100601335 3300005334 Bacteria 929
6 Ga0070659_100953227 3300005366 Bacteria 752
7 Ga0070713_100574488 3300005436 Bacteria 1069
8 Ga0070681_10095198 3300005458 Bacteria 2926
9 Ga0070681_10445108 3300005458 Bacteria 1207
10 Ga0068867_102093938 3300005459 Bacteria 536
11 Ga0070706_100167969 3300005467 Bacteria 2048
12 Ga0070707_101089364 3300005468 Bacteria 765
13 Ga0070698_100763944 3300005471 Bacteria 910
14 Ga0070684_101482811 3300005535 Bacteria 639
15 Ga0070684_101812309 3300005535 Bacteria 576
16 Ga0068853_100848996 3300005539 Bacteria 876
17 Ga0070704_102149221 3300005549 Bacteria 519
18 Ga0068855_101239495 3300005563 Bacteria 774
19 Ga0068855_101754104 3300005563 Bacteria 632
20 Ga0068857_102179098 3300005577 Bacteria 544
21 Ga0068854_100574870 3300005578 Bacteria 959
22 Ga0068852_101457595 3300005616 Bacteria 707
23 Ga0068858_100702673 3300005842 Bacteria 984
24 Ga0068860_101437087 3300005843 Bacteria 711
25 Ga0081455_10006705 3300005937 Bacteria 12303
26 Ga0075365_10052636 3300006038 Bacteria 2694
27 Ga0075365_10160472 3300006038 Bacteria 1566
28 Ga0075365_10224031 3300006038 Bacteria 1319
29 Ga0075368_10451849 3300006042 Bacteria 569
30 Ga0075364_10376006 3300006051 Bacteria 969
31 Ga0075364_10681164 3300006051 Bacteria 702
32 Ga0075367_10304772 3300006178 Bacteria 1003
33 Ga0075367_10561152 3300006178 Bacteria 725
34 Ga0075367_10743350 3300006178 Bacteria 624
35 Ga0075367_11060325 3300006178 Bacteria 518
36 Ga0075428_100004474 3300006844 Bacteria 15427
37 Ga0075428_101755335 3300006844 Bacteria 647
38 Ga0075430_100000650 3300006846 Bacteria 26507
39 Ga0075430_100040950 3300006846 Bacteria 3920
40 Ga0075430_100814389 3300006846 Bacteria 769
41 Ga0075431_100000237 3300006847 Bacteria 41441
42 Ga0075431_100009720 3300006847 Bacteria 9660
43 Ga0075431_100236435 3300006847 Bacteria 1860
44 Ga0075434_100543159 3300006871 Bacteria 1182
45 Ga0075434_102387604 3300006871 Bacteria 531
46 Ga0075429_100007147 3300006880 Bacteria 9689
47 Ga0075429_100050224 3300006880 Bacteria 3629
48 Ga0075435_101029459 3300007076 Bacteria 719
49 Ga0075435_101102466 3300007076 Bacteria 694
50 Ga0105245_10125194 3300009098 Bacteria 2405
51 Ga0114129_10586538 3300009147 Bacteria 1446
52 Ga0105241_10289518 3300009174 Bacteria 1402
53 Ga0105241_10779488 3300009174 Bacteria 879
54 Ga0105242_10014691 3300009176 Bacteria 6063
55 Ga0105242_11259410 3300009176 Bacteria 761
56 Ga0105249_12723838 3300009553 Bacteria 566
57 Ga0105239_10681620 3300010375 Bacteria 1175
58 Ga0105239_10904699 3300010375 Bacteria 1013
59 Ga0105239_12863143 3300010375 Bacteria 563
60 Ga0157369_10840788 3300013105 Bacteria 942
61 Ga0157374_10488710 3300013296 Bacteria 1235
62 Ga0157378_10182261 3300013297 Bacteria 1976
63 Ga0157372_10448113 3300013307 Bacteria 1504
64 Ga0157380_12286509 3300014326 Bacteria 605
65 Ga0157377_11665478 3300014745 Bacteria 513
66 Ga0157376_11080429 3300014969 Bacteria 828
67 Ga0157376_11563454 3300014969 Bacteria 693
68 Ga0163161_11574643 3300017792 Bacteria 579
69 Ga0206356_10211431 3300020070 Bacteria 752
70 Ga0213873_10123746 3300021358 Bacteria 761
71 Ga0213876_10241452 3300021384 Bacteria 960
72 Ga0207684_10026488 3300025910 Bacteria 4943
73 Ga0207654_10809606 3300025911 Bacteria 677
74 Ga0207707_10621472 3300025912 Bacteria 913
75 Ga0207707_11216230 3300025912 Bacteria 609
76 Ga0207662_11013453 3300025918 Bacteria 590
77 Ga0207652_10475657 3300025921 Bacteria 1125
78 Ga0207687_11334069 3300025927 Bacteria 617
79 Ga0207700_10802841 3300025928 Bacteria 842
80 Ga0207664_11782241 3300025929 Bacteria 538
81 Ga0207686_10339133 3300025934 Bacteria 1128
82 Ga0207665_10870281 3300025939 Bacteria 714
83 Ga0207689_10237360 3300025942 Bacteria 1507
84 Ga0207689_10964272 3300025942 Bacteria 719
85 Ga0207661_11306041 3300025944 Bacteria 667
86 Ga0207640_11619048 3300025981 Bacteria 584
87 Ga0207703_10625872 3300026035 Bacteria 1019
88 Ga0207702_10276881 3300026078 Bacteria 1585
89 Ga0207674_11283053 3300026116 Bacteria 702
90 Ga0265762_1198676 3300030760 Bacteria 502
91 Ga0307408_100697243 3300031548 Bacteria 912
92 Ga0316575_10217192 3300031665 Bacteria 798
93 Ga0316575_10509918 3300031665 Bacteria 522
94 Ga0316575_10514986 3300031665 Bacteria 520
95 Ga0316576_10172489 3300031727 Bacteria 1632
96 Ga0316576_10226382 3300031727 Bacteria 1406
97 Ga0316578_10806004 3300031728 Bacteria 544
98 Ga0307405_10459162 3300031731 Bacteria 1012
99 Ga0307405_10737963 3300031731 Bacteria 819
100 Ga0307413_10734262 3300031824 Bacteria 824
101 Ga0307410_10023116 3300031852 Bacteria 3858
102 Ga0307410_11051393 3300031852 Bacteria 704
103 Ga0307410_11325002 3300031852 Unclassified 630
104 Ga0307406_10066344 3300031901 Bacteria 2349
105 Ga0307407_10068706 3300031903 Bacteria 2100
106 Ga0307407_10809905 3300031903 Bacteria 713
107 Ga0307409_100135311 3300031995 Bacteria 2113
108 Ga0307409_100967867 3300031995 Bacteria 868
109 Ga0307409_102074497 3300031995 Bacteria 598
110 Ga0307416_101686068 3300032002 Bacteria 739
111 Ga0307416_102033871 3300032002 Bacteria 677
112 Ga0373930_0029583 3300034816 Bacteria 1120
113 Ga0373938_0067213 3300034957 Bacteria 850
114 Ga0373929_0001071 3300035085 Bacteria 5316
115 Ga0373949_0118049 3300035090 Bacteria 742
116 Ga0373932_0000106 3300035112 Bacteria 22777
117 Ga0373932_0017084 3300035112 Bacteria 1858
118 Ga0373953_0392935 3300035117 Bacteria 610
119 Ga0373943_0411575 3300035170 Bacteria 782
120 Ga0316574_0083624 3300035398 Bacteria 2029
121 Ga0316574_0882798 3300035398 Bacteria 542
122 Ga0373931_0000010 3300035691 Bacteria 334069
123 Ga0373931_0000052 3300035691 Bacteria 60603
124 Ga0373935_0487586 3300035692 Bacteria 894
125 Ga0373937_0551386 3300036401 Bacteria 1095
126 Ga0316584_1183112 3300036712 Bacteria 505
127 Ga0373925_0992651 3300037068 Bacteria 691
128 Ga0400485_03436 3300038735 Bacteria 13885
129 Ga0436365_0695824 3300039437 Bacteria 1134
130 Ga0436365_1607094 3300039437 Bacteria 1554
131 Ga0436365_1625733 3300039437 Bacteria 983
132 Ga0436360_0940197 3300039438 Bacteria 511
133 Ga0436362_0674806 3300039453 Bacteria 2138
134 Ga0439447_086867 3300041407 Bacteria 720
135 Ga0451800_0301288 3300041459 Bacteria 545
136 Ga0451853_0401380 3300041512 Bacteria 759
137 Ga0451853_0999191 3300041512 Bacteria 1573
138 Ga0439432_133136 3300042006 Bacteria 733
139 Ga0439462_0242385 3300042015 Bacteria 518
140 Ga0439446_0092099 3300042156 Bacteria 950
141 Ga0439434_0002016 3300042435 Bacteria 5870
142 Ga0495651_0965002 3300046462 Bacteria 519
143 Ga0495653_0115244 3300046463 Bacteria 1924
144 Ga0495653_0127905 3300046463 Bacteria 1802
145 Ga0495662_0589971 3300046476 Bacteria 544
146 Ga0495608_0305239 3300046511 Bacteria 985
147 Ga0495618_0138338 3300046514 Bacteria 1558
148 Ga0495628_0222840 3300046516 Bacteria 1416
149 Ga0495628_0251824 3300046516 Bacteria 1318
150 Ga0495628_1111612 3300046516 Unclassified 539
151 Ga0495630_0045010 3300046517 Bacteria 3298
152 Ga0495630_0269570 3300046517 Bacteria 1301
153 Ga0495652_0253834 3300046529 Bacteria 1302
154 Ga0495640_0627648 3300046533 Bacteria 648
155 Ga0495587_0522054 3300046536 Bacteria 656
156 Ga0495645_0250732 3300046543 Bacteria 1177
157 Ga0495667_0112648 3300046559 Bacteria 1758
158 Ga0495667_0448965 3300046559 Bacteria 810
159 Ga0495635_0506998 3300046663 Bacteria 794
160 Ga0495657_0106044 3300046675 Bacteria 1785
161 Ga0495657_0320091 3300046675 Bacteria 922
162 Ga0495657_0580638 3300046675 Bacteria 649
163 Ga0495646_0352758 3300046680 Bacteria 770
164 Ga0495669_0488892 3300046684 Bacteria 598
165 Ga0495613_0379190 3300046689 Bacteria 967
166 Ga0495589_0064297 3300046794 Bacteria 1799
167 Ga0495600_0328465 3300046809 Bacteria 961
168 Ga0495604_0579449 3300047317 Bacteria 721
169 Ga0495674_0136032 3300047319 Bacteria 2068
170 Ga0495674_0410460 3300047319 Bacteria 1092
171 Ga0495676_1000853 3300047321 Bacteria 533
172 Ga0495676_1094134 3300047321 Bacteria 507
173 Ga0495680_0103817 3300047322 Bacteria 2115
174 Ga0495680_0174668 3300047322 Bacteria 1554
175 Ga0495684_0935757 3300047471 Bacteria 555
176 Ga0495614_0391309 3300048089 Bacteria 652
177 Ga0496102_0066926 3300048905 Bacteria 3294
178 Ga0496102_0439027 3300048905 Bacteria 1225
179 Ga0496105_0703098 3300048908 Bacteria 776
180 Ga0496108_1061710 3300048911 Bacteria 690
181 Ga0496108_1505385 3300048911 Bacteria 560
182 Ga0496109_2050038 3300048912 Unclassified 504
183 Ga0496110_0106683 3300048913 Bacteria 2514
184 Ga0496110_0289351 3300048913 Bacteria 1492
185 Ga0496111_0301308 3300048914 Bacteria 1188
186 Ga0496111_0640768 3300048914 Bacteria 776
187 Ga0496113_0703525 3300048916 Bacteria 806
188 Ga0496114_0215365 3300048917 Bacteria 1685
189 Ga0496114_0971413 3300048917 Bacteria 732
190 Ga0496114_1353729 3300048917 Bacteria 599
191 Ga0496115_0723723 3300048918 Bacteria 780
192 Ga0501033_0004120 3300049570 Bacteria 11721
193 Ga0501034_0199955 3300049571 Bacteria 1957
194 Ga0501034_0326426 3300049571 Bacteria 1467
195 Ga0501034_1064493 3300049571 Bacteria 691
196 Ga0501036_0389597 3300049572 Bacteria 1163
197 Ga0501038_0523653 3300049574 Bacteria 904
198 Ga0501039_1171081 3300049575 Bacteria 595
199 Ga0501039_1403597 3300049575 Bacteria 538
200 Ga0501040_0346038 3300049576 Bacteria 1065
201 Ga0501040_0830166 3300049576 Bacteria 669
202 Ga0501042_0337370 3300049578 Bacteria 1090
203 Ga0501047_0441687 3300049581 Bacteria 1131
204 Ga0501047_1130891 3300049581 Bacteria 596
205 Ga0501048_0951927 3300049582 Bacteria 618
206 Ga0501069_0008605 3300049585 Bacteria 5369
207 Ga0501070_0454921 3300049586 Bacteria 1032
208 Ga0501071_0131179 3300049587 Bacteria 1862
209 Ga0501072_0314808 3300049588 Bacteria 1244
210 Ga0501073_0611356 3300049589 Bacteria 753
211 Ga0501076_0378955 3300049592 Bacteria 1163
212 Ga0501202_124148 3300049652 Bacteria 652
213 Ga0501080_0139135 3300049742 Bacteria 2245
214 Ga0501083_0028515 3300049744 Bacteria 3846
215 Ga0501044_0004465 3300049823 Bacteria 15643
216 nmdc:mga03n38_930840_c1 3300050490 Bacteria 512
217 nmdc:mga00v17_151281_c1 3300050491 Bacteria 1491
218 nmdc:mga00v17_330717_c1 3300050491 Bacteria 990
219 nmdc:mga00v17_569728_c1 3300050491 Bacteria 731
220 nmdc:mga00v17_603944_c1 3300050491 Unclassified 707
221 nmdc:mga00v17_993814_c1 3300050491 Bacteria 528
222 nmdc:mga0yw44_1122908_c1 3300050492 Bacteria 531
223 nmdc:mga0yw44_158598_c1 3300050492 Bacteria 1480
224 nmdc:mga0yw44_268988_c1 3300050492 Bacteria 1137
225 nmdc:mga0yw44_44662_c1 3300050492 Bacteria 2651
226 nmdc:mga0yw44_464171_c1 3300050492 Bacteria 858
227 nmdc:mga06z11_211424_c1 3300050494 Bacteria 1130
228 nmdc:mga06z11_437482_c1 3300050494 Bacteria 789
229 nmdc:mga06z11_969544_c1 3300050494 Bacteria 518
230 nmdc:mga04h51_369092_c1 3300050495 Bacteria 596
231 nmdc:mga05p37_140235_c1 3300050507 Bacteria 2962
232 nmdc:mga05p37_181215_c1 3300050507 Bacteria 2562
233 nmdc:mga05p37_1931003_c1 3300050507 Bacteria 562
234 nmdc:mga05p37_231485_c1 3300050507 Bacteria 2226
235 nmdc:mga09592_1062148_c1 3300050508 Bacteria 674
236 nmdc:mga09592_128515_c1 3300050508 Bacteria 2179
237 nmdc:mga09592_2046_c1 3300050508 Bacteria 16269
238 nmdc:mga0qj67_734_c1 3300050509 Bacteria 22312
239 nmdc:mga0qj67_765197_c1 3300050509 Bacteria 766
240 nmdc:mga06r32_273132_c1 3300050510 Bacteria 1678
241 nmdc:mga06r32_344600_c1 3300050510 Bacteria 1475
242 nmdc:mga06r32_681_c1 3300050510 Bacteria 29588
243 nmdc:mga0n895_1337541_c1 3300050512 Bacteria 686
244 nmdc:mga0rr50_883502_c1 3300050513 Bacteria 762
245 nmdc:mga0rr50_902746_c1 3300050513 Bacteria 753
246 Ga0495601_0167074 3300053077 Bacteria 1438
247 Ga0495601_0456668 3300053077 Bacteria 826
248 Ga0495619_0008040 3300053085 Bacteria 6675
249 Ga0495619_0056328 3300053085 Bacteria 2606
250 Ga0500583_0087778 3300053092 Bacteria 1511
251 Ga0500566_0001466 3300053094 Bacteria 13814
252 Ga0500650_0105523 3300053098 Bacteria 1317
253 Ga0501084_0435922 3300054114 Bacteria 1108
254 Ga0501082_0844945 3300060353 Bacteria 801
255 Ga0530510_0018213 3300061734 Bacteria 4979
256 Ga0075364_10447069
257 JGI25405J52794_10051786
258 Ga0070683_102408077
259 Ga0068869_100442499
260 Ga0068869_100601335
261 Ga0070659_100953227
262 Ga0070713_100574488
263 Ga0070681_10095198
264 Ga0070681_10445108
265 Ga0068867_102093938
266 Ga0070706_100167969
267 Ga0070707_101089364
268 Ga0070698_100763944
269 Ga0070684_101482811
270 Ga0070684_101812309
271 Ga0068853_100848996
272 Ga0070704_102149221
273 Ga0068855_101239495
274 Ga0068855_101754104
275 Ga0068857_102179098
276 Ga0068854_100574870
277 Ga0068852_101457595
278 Ga0068858_100702673
279 Ga0068860_101437087
280 Ga0081455_10006705
281 Ga0075365_10052636
282 Ga0075365_10160472
283 Ga0075365_10224031
284 Ga0075368_10451849
285 Ga0075364_10376006
286 Ga0075364_10681164
287 Ga0075367_10304772
288 Ga0075367_10561152
289 Ga0075367_10743350
290 Ga0075367_11060325
291 Ga0075428_100004474
292 Ga0075428_101755335
293 Ga0075430_100000650
294 Ga0075430_100040950
295 Ga0075430_100814389
296 Ga0075431_100000237
297 Ga0075431_100009720
298 Ga0075431_100236435
299 Ga0075434_100543159
300 Ga0075434_102387604
301 Ga0075429_100007147
302 Ga0075429_100050224
303 Ga0075435_101029459
304 Ga0075435_101102466
305 Ga0105245_10125194
306 Ga0114129_10586538
307 Ga0105241_10289518
308 Ga0105241_10779488
309 Ga0105242_10014691
310 Ga0105242_11259410
311 Ga0105249_12723838
312 Ga0105239_10681620
313 Ga0105239_10904699
314 Ga0105239_12863143
315 Ga0157369_10840788
316 Ga0157374_10488710
317 Ga0157378_10182261
318 Ga0157372_10448113
319 Ga0157380_12286509
320 Ga0157377_11665478
321 Ga0157376_11080429
322 Ga0157376_11563454
323 Ga0163161_11574643
324 Ga0206356_10211431
325 Ga0213873_10123746
326 Ga0213876_10241452
327 Ga0207684_10026488
328 Ga0207654_10809606
329 Ga0207707_10621472
330 Ga0207707_11216230
331 Ga0207662_11013453
332 Ga0207652_10475657
333 Ga0207687_11334069
334 Ga0207700_10802841
335 Ga0207664_11782241
336 Ga0207686_10339133
337 Ga0207665_10870281
338 Ga0207689_10237360
339 Ga0207689_10964272
340 Ga0207661_11306041
341 Ga0207640_11619048
342 Ga0207703_10625872
343 Ga0207702_10276881
344 Ga0207674_11283053
345 Ga0265762_1198676
346 Ga0307408_100697243
347 Ga0316575_10217192
348 Ga0316575_10509918
349 Ga0316575_10514986
350 Ga0316576_10172489
351 Ga0316576_10226382
352 Ga0316578_10806004
353 Ga0307405_10459162
354 Ga0307405_10737963
355 Ga0307413_10734262
356 Ga0307410_10023116
357 Ga0307410_11051393
358 Ga0307410_11325002
359 Ga0307406_10066344
360 Ga0307407_10068706
361 Ga0307407_10809905
362 Ga0307409_100135311
363 Ga0307409_100967867
364 Ga0307409_102074497
365 Ga0307416_101686068
366 Ga0307416_102033871
367 Ga0373930_0029583
368 Ga0373938_0067213
369 Ga0373929_0001071
370 Ga0373949_0118049
371 Ga0373932_0000106
372 Ga0373932_0017084
373 Ga0373953_0392935
374 Ga0373943_0411575
375 Ga0316574_0083624
376 Ga0316574_0882798
377 Ga0373931_0000010
378 Ga0373931_0000052
379 Ga0373935_0487586
380 Ga0373937_0551386
381 Ga0316584_1183112
382 Ga0373925_0992651
383 Ga0400485_03436
384 Ga0436365_0695824
385 Ga0436365_1607094
386 Ga0436365_1625733
387 Ga0436360_0940197
388 Ga0436362_0674806
389 Ga0439447_086867
390 Ga0451800_0301288
391 Ga0451853_0401380
392 Ga0451853_0999191
393 Ga0439432_133136
394 Ga0439462_0242385
395 Ga0439446_0092099
396 Ga0439434_0002016
397 Ga0495651_0965002
398 Ga0495653_0115244
399 Ga0495653_0127905
400 Ga0495662_0589971
401 Ga0495608_0305239
402 Ga0495618_0138338
403 Ga0495628_0222840
404 Ga0495628_0251824
405 Ga0495628_1111612
406 Ga0495630_0045010
407 Ga0495630_0269570
408 Ga0495652_0253834
409 Ga0495640_0627648
410 Ga0495587_0522054
411 Ga0495645_0250732
412 Ga0495667_0112648
413 Ga0495667_0448965
414 Ga0495635_0506998
415 Ga0495657_0106044
416 Ga0495657_0320091
417 Ga0495657_0580638
418 Ga0495646_0352758
419 Ga0495669_0488892
420 Ga0495613_0379190
421 Ga0495589_0064297
422 Ga0495600_0328465
423 Ga0495604_0579449
424 Ga0495674_0136032
425 Ga0495674_0410460
426 Ga0495676_1000853
427 Ga0495676_1094134
428 Ga0495680_0103817
429 Ga0495680_0174668
430 Ga0495684_0935757
431 Ga0495614_0391309
432 Ga0496102_0066926
433 Ga0496102_0439027
434 Ga0496105_0703098
435 Ga0496108_1061710
436 Ga0496108_1505385
437 Ga0496109_2050038
438 Ga0496110_0106683
439 Ga0496110_0289351
440 Ga0496111_0301308
441 Ga0496111_0640768
442 Ga0496113_0703525
443 Ga0496114_0215365
444 Ga0496114_0971413
445 Ga0496114_1353729
446 Ga0496115_0723723
447 Ga0501033_0004120
448 Ga0501034_0199955
449 Ga0501034_0326426
450 Ga0501034_1064493
451 Ga0501036_0389597
452 Ga0501038_0523653
453 Ga0501039_1171081
454 Ga0501039_1403597
455 Ga0501040_0346038
456 Ga0501040_0830166
457 Ga0501042_0337370
458 Ga0501047_0441687
459 Ga0501047_1130891
460 Ga0501048_0951927
461 Ga0501069_0008605
462 Ga0501070_0454921
463 Ga0501071_0131179
464 Ga0501072_0314808
465 Ga0501073_0611356
466 Ga0501076_0378955
467 Ga0501202_124148
468 Ga0501080_0139135
469 Ga0501083_0028515
470 Ga0501044_0004465
471 nmdc:mga03n38_930840_c1
472 nmdc:mga00v17_151281_c1
473 nmdc:mga00v17_330717_c1
474 nmdc:mga00v17_569728_c1
475 nmdc:mga00v17_603944_c1
476 nmdc:mga00v17_993814_c1
477 nmdc:mga0yw44_1122908_c1
478 nmdc:mga0yw44_158598_c1
479 nmdc:mga0yw44_268988_c1
480 nmdc:mga0yw44_44662_c1
481 nmdc:mga0yw44_464171_c1
482 nmdc:mga06z11_211424_c1
483 nmdc:mga06z11_437482_c1
484 nmdc:mga06z11_969544_c1
485 nmdc:mga04h51_369092_c1
486 nmdc:mga05p37_140235_c1
487 nmdc:mga05p37_181215_c1
488 nmdc:mga05p37_1931003_c1
489 nmdc:mga05p37_231485_c1
490 nmdc:mga09592_1062148_c1
491 nmdc:mga09592_128515_c1
492 nmdc:mga09592_2046_c1
493 nmdc:mga0qj67_734_c1
494 nmdc:mga0qj67_765197_c1
495 nmdc:mga06r32_273132_c1
496 nmdc:mga06r32_344600_c1
497 nmdc:mga06r32_681_c1
498 nmdc:mga0n895_1337541_c1
499 nmdc:mga0rr50_883502_c1
500 nmdc:mga0rr50_902746_c1
501 Ga0495601_0167074
502 Ga0495601_0456668
503 Ga0495619_0008040
504 Ga0495619_0056328
505 Ga0500583_0087778
506 Ga0500566_0001466
507 Ga0500650_0105523
508 Ga0501084_0435922
509 Ga0501082_0844945
510 Ga0530510_0018213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03966

Trm112p

Trm112p-like protein

18

57

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b4b-assembly1.cif.gz_X toxr bacterial transcriptional regulator bound to 19 bp ompu promoter dna 0.8019 20 69
8b4b-assembly1.cif.gz_Y toxr bacterial transcriptional regulator bound to 19 bp ompu promoter dna 0.8002 20 69
2pk7-assembly1.cif.gz_A crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 0.7334 7 60
2pk7-assembly1.cif.gz_B crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 0.7307 7 60
5nqd-assembly2.cif.gz_D arsenite oxidase aioab from rhizobium sp. str. nt-26 mutant aiobf108a 0.7254 13 39
ID Description Score Start End Superfamily
2hf1B01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8016 11 63 2.20.25.10
af_Q8LG27_23_76_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7998 11 57 2.20.25.10
af_O33186_9_68_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7752 11 65 2.20.25.10
2jr6A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7742 11 63 2.20.25.10
af_K7KYJ1_359_467_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7687 51 69 1.10.10.10
ID Description Score Start End GO Terms
AF-X8FFN3-F1-model_v4 deleted 0.9625 28 66
AF-A0A6N7G197-F1-model_v4 Trm112 family protein 0.951 19 78
AF-A0A519YNJ9-F1-model_v4 deleted 0.9373 17 57
AF-A0A6N7G197-F1-model_v4 Trm112 family protein 0.9357 19 78
AF-A0A093QPQ4-F1-model_v4 Protein preY, mitochondrial 0.9353 19 56

Map