F365583

General Info

Members Datasets Scaffolds Average Seq Length
255 198 255 126

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10024236|Ga0075365_100242363
Length 129
Sequence MSSLIHTCYRVYDLDSSIAFYEKLGMEELRRLPIGDEAVNVFMGLEGDGPRLELTYNFDQDEPYEIGSGYGHIALTVDDMDAALERLAADGITPEKPPYTVSEGGSRLCFVRDPDGYRIELIERDPGTG

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
126 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 0
Rhizoplane 9.41
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1018453 3300000549 Unclassified 812
2 JGI24746J21847_1000018 3300001977 Bacteria 15938
3 JGI24740J21852_10006411 3300001979 Bacteria 4875
4 JGI25407J50210_10024929 3300003373 Bacteria 1551
5 JGI25404J52841_10002317 3300003659 Bacteria 3583
6 Ga0070683_100464934 3300005329 Bacteria 1207
7 Ga0068869_100134553 3300005334 Bacteria 1903
8 Ga0070680_100124717 3300005336 Bacteria 2151
9 Ga0070682_100049031 3300005337 Bacteria 2631
10 Ga0070691_10000105 3300005341 Bacteria 24902
11 Ga0070691_10200980 3300005341 Bacteria 1047
12 Ga0070661_100205628 3300005344 Bacteria 1506
13 Ga0070673_100002074 3300005364 Bacteria 12077
14 Ga0070659_100050228 3300005366 Bacteria 3279
15 Ga0070659_100503117 3300005366 Bacteria 1033
16 Ga0070714_100242893 3300005435 Bacteria 1662
17 Ga0070713_101077914 3300005436 Bacteria 776
18 Ga0070711_100001334 3300005439 Bacteria 13487
19 Ga0070711_100001483 3300005439 Bacteria 12864
20 Ga0070700_100020283 3300005441 Bacteria 3848
21 Ga0070700_100289480 3300005441 Bacteria 1191
22 Ga0070662_100272887 3300005457 Bacteria 1366
23 Ga0070681_10771773 3300005458 Bacteria 878
24 Ga0070679_100014900 3300005530 Bacteria 7466
25 Ga0070679_100417417 3300005530 Bacteria 1287
26 Ga0068853_100247032 3300005539 Bacteria 1637
27 Ga0070672_100000004 3300005543 Bacteria 129970
28 Ga0070686_100177209 3300005544 Bacteria 1512
29 Ga0070665_100377461 3300005548 Bacteria 1425
30 Ga0070704_101335172 3300005549 Bacteria 657
31 Ga0068855_100689971 3300005563 Bacteria 1094
32 Ga0070664_102323565 3300005564 Bacteria 509
33 Ga0068857_100544761 3300005577 Bacteria 1093
34 Ga0068856_100216525 3300005614 Bacteria 1930
35 Ga0070702_100039418 3300005615 Bacteria 2636
36 Ga0068852_100060008 3300005616 Bacteria 3300
37 Ga0068859_101049016 3300005617 Bacteria 896
38 Ga0068864_100000023 3300005618 Bacteria 257064
39 Ga0068861_100049601 3300005719 Bacteria 3179
40 Ga0068863_100000004 3300005841 Bacteria 272478
41 Ga0068863_100020939 3300005841 Bacteria 6246
42 Ga0068863_100152865 3300005841 Bacteria 2209
43 Ga0068858_100000033 3300005842 Bacteria 142748
44 Ga0068860_100156096 3300005843 Bacteria 2199
45 Ga0068862_100713134 3300005844 Bacteria 973
46 Ga0081538_10000176 3300005981 Bacteria 69195
47 Ga0081540_1000006 3300005983 Bacteria 208724
48 Ga0075365_10024236 3300006038 Bacteria 3824
49 Ga0075365_10155812 3300006038 Bacteria 1590
50 Ga0075364_10396157 3300006051 Bacteria 942
51 Ga0075429_101144368 3300006880 Bacteria 680
52 Ga0097620_101049053 3300006931 Bacteria 896
53 Ga0105251_10161291 3300009011 Bacteria 1011
54 Ga0105245_10004340 3300009098 Bacteria 12553
55 Ga0114129_11948731 3300009147 Bacteria 711
56 Ga0114129_12529393 3300009147 Bacteria 613
57 Ga0105242_10000605 3300009176 Bacteria 28087
58 Ga0105242_10733598 3300009176 Bacteria 970
59 Ga0105242_11657166 3300009176 Bacteria 675
60 Ga0105237_10081802 3300009545 Bacteria 3220
61 Ga0105238_10180289 3300009551 Bacteria 2089
62 Ga0105249_10021263 3300009553 Bacteria 5809
63 Ga0105239_10063875 3300010375 Bacteria 4041
64 Ga0105239_10231337 3300010375 Bacteria 2074
65 Ga0105239_10292875 3300010375 Bacteria 1833
66 Ga0105246_10173274 3300011119 Bacteria 1654
67 Ga0157373_10939965 3300013100 Bacteria 643
68 Ga0157371_10622427 3300013102 Bacteria 804
69 Ga0157370_10002243 3300013104 Bacteria 23500
70 Ga0157370_11010046 3300013104 Bacteria 753
71 Ga0157369_10052843 3300013105 Bacteria 4394
72 Ga0157378_10002534 3300013297 Bacteria 16255
73 Ga0157372_10175868 3300013307 Bacteria 2477
74 Ga0157372_10291143 3300013307 Bacteria 1899
75 Ga0157372_11487296 3300013307 Bacteria 780
76 Ga0157375_10000109 3300013308 Bacteria 80349
77 Ga0157375_10003079 3300013308 Bacteria 14478
78 Ga0163163_10322063 3300014325 Bacteria 1600
79 Ga0163163_12444093 3300014325 Bacteria 581
80 Ga0157380_10000028 3300014326 Bacteria 99836
81 Ga0157376_10010369 3300014969 Bacteria 6811
82 Ga0163161_10531501 3300017792 Bacteria 961
83 Ga0163161_10804047 3300017792 Bacteria 790
84 Ga0206356_10675504 3300020070 Bacteria 1118
85 Ga0206349_1315344 3300020075 Bacteria 530
86 Ga0206354_11531925 3300020081 Bacteria 1152
87 Ga0206353_10026354 3300020082 Bacteria 2261
88 Ga0207653_10071559 3300025885 Bacteria 1186
89 Ga0207707_11101986 3300025912 Bacteria 647
90 Ga0207671_10395355 3300025914 Bacteria 1099
91 Ga0207663_10004129 3300025916 Bacteria 7190
92 Ga0207660_10681904 3300025917 Bacteria 838
93 Ga0207657_10030463 3300025919 Bacteria 4897
94 Ga0207649_11506241 3300025920 Bacteria 532
95 Ga0207652_10046458 3300025921 Bacteria 3704
96 Ga0207652_10408334 3300025921 Bacteria 1225
97 Ga0207694_10335804 3300025924 Bacteria 1249
98 Ga0207687_10007674 3300025927 Bacteria 7087
99 Ga0207700_10539022 3300025928 Bacteria 1035
100 Ga0207664_10234031 3300025929 Bacteria 1597
101 Ga0207644_11340994 3300025931 Bacteria 601
102 Ga0207690_10012785 3300025932 Bacteria 5029
103 Ga0207686_10000032 3300025934 Bacteria 150341
104 Ga0207686_10004766 3300025934 Bacteria 7278
105 Ga0207704_10668701 3300025938 Bacteria 857
106 Ga0207691_10000020 3300025940 Bacteria 133465
107 Ga0207689_10116021 3300025942 Bacteria 2201
108 Ga0207661_10035850 3300025944 Bacteria 3868
109 Ga0207679_11381680 3300025945 Bacteria 646
110 Ga0207651_10006181 3300025960 Bacteria 6234
111 Ga0207712_10009873 3300025961 Bacteria 6051
112 Ga0207668_10039309 3300025972 Bacteria 3183
113 Ga0207658_10089618 3300025986 Bacteria 2382
114 Ga0207703_10000577 3300026035 Bacteria 37419
115 Ga0207639_10121465 3300026041 Bacteria 2147
116 Ga0207678_10364254 3300026067 Bacteria 1248
117 Ga0207708_10052585 3300026075 Bacteria 3102
118 Ga0207708_10627490 3300026075 Bacteria 913
119 Ga0207702_10553829 3300026078 Bacteria 1125
120 Ga0207641_10000170 3300026088 Bacteria 91128
121 Ga0207641_10005462 3300026088 Bacteria 10840
122 Ga0207676_10000025 3300026095 Bacteria 261714
123 Ga0207675_100001319 3300026118 Bacteria 24876
124 Ga0207698_10000041 3300026142 Bacteria 97882
125 Ga0207698_12178989 3300026142 Bacteria 567
126 Ga0268266_10167276 3300028379 Bacteria 1993
127 Ga0268264_10610754 3300028381 Bacteria 1076
128 Ga0265337_1000012 3300028556 Bacteria 85395
129 Ga0265326_10000007 3300028558 Bacteria 223057
130 Ga0265319_1000028 3300028563 Bacteria 135557
131 Ga0265319_1066218 3300028563 Bacteria 1164
132 Ga0265322_10000001 3300028654 Bacteria 543854
133 Ga0265338_10000230 3300028800 Bacteria 103891
134 Ga0265324_10001098 3300029957 Bacteria 16258
135 Ga0265332_10009620 3300031238 Bacteria 4313
136 Ga0265328_10004653 3300031239 Bacteria 5938
137 Ga0265320_10000002 3300031240 Bacteria 542875
138 Ga0265320_10205960 3300031240 Bacteria 878
139 Ga0265325_10020561 3300031241 Bacteria 3638
140 Ga0265329_10009449 3300031242 Bacteria 3641
141 Ga0265331_10003048 3300031250 Bacteria 10998
142 Ga0265331_10030950 3300031250 Bacteria 2662
143 Ga0265327_10000011 3300031251 Bacteria 543807
144 Ga0265313_10083897 3300031595 Bacteria 1442
145 Ga0265314_10000224 3300031711 Bacteria 84325
146 Ga0316576_10014947 3300031727 Bacteria 5195
147 Ga0316577_10204252 3300031733 Bacteria 1117
148 Ga0307409_100244947 3300031995 Bacteria 1635
149 Ga0316574_0190881 3300035398 Bacteria 1317
150 Ga0316574_0639414 3300035398 Bacteria 655
151 Ga0373937_0277184 3300036401 Bacteria 1583
152 Ga0316584_0000992 3300036712 Bacteria 16328
153 Ga0451789_0085906 3300041443 Bacteria 852
154 Ga0451849_1552654 3300041505 Bacteria 1409
155 Ga0451853_0165291 3300041512 Unclassified 2202
156 Ga0466960_0105420 3300044901 Bacteria 1457
157 Ga0495603_0001792 3300046455 Bacteria 12677
158 Ga0495603_0160438 3300046455 Bacteria 1304
159 Ga0495591_046165 3300046458 Bacteria 1211
160 Ga0495629_0005342 3300046459 Bacteria 9594
161 Ga0495641_0027087 3300046461 Bacteria 2791
162 Ga0495641_0385493 3300046461 Bacteria 635
163 Ga0495651_0052514 3300046462 Bacteria 3139
164 Ga0495651_0203904 3300046462 Bacteria 1382
165 Ga0495653_0061469 3300046463 Bacteria 2842
166 Ga0495653_0214669 3300046463 Bacteria 1297
167 Ga0495664_0347546 3300046477 Bacteria 893
168 Ga0495585_0275671 3300046492 Bacteria 833
169 Ga0495594_0000013 3300046499 Bacteria 103201
170 Ga0495608_0383449 3300046511 Bacteria 861
171 Ga0495608_0578400 3300046511 Bacteria 675
172 Ga0495620_0336408 3300046515 Bacteria 573
173 Ga0495628_0000093 3300046516 Bacteria 71181
174 Ga0495630_0312202 3300046517 Bacteria 1202
175 Ga0495652_0000003 3300046529 Bacteria 597094
176 Ga0495587_0005387 3300046536 Bacteria 8361
177 Ga0495587_0008634 3300046536 Bacteria 6547
178 Ga0495621_0000623 3300046539 Bacteria 8912
179 Ga0495645_0014564 3300046543 Bacteria 5582
180 Ga0495622_0000014 3300046557 Bacteria 182142
181 Ga0495667_0000022 3300046559 Bacteria 176919
182 Ga0495667_0023628 3300046559 Bacteria 4140
183 Ga0495656_0000132 3300046615 Bacteria 27907
184 Ga0495634_0000212 3300046642 Bacteria 53864
185 Ga0495634_0002325 3300046642 Bacteria 15909
186 Ga0495635_0384715 3300046663 Bacteria 933
187 Ga0495657_0021394 3300046675 Bacteria 4641
188 Ga0495599_0119008 3300046678 Bacteria 1642
189 Ga0495623_0178574 3300046679 Bacteria 1235
190 Ga0495613_0260850 3300046689 Bacteria 1207
191 Ga0495676_0002782 3300047321 Bacteria 15729
192 Ga0495676_0173646 3300047321 Bacteria 1515
193 Ga0495676_0300681 3300047321 Bacteria 1082
194 Ga0495680_0009767 3300047322 Bacteria 8605
195 Ga0495680_0038562 3300047322 Bacteria 3817
196 Ga0495675_0522839 3300047444 Bacteria 679
197 Ga0495686_0045321 3300047472 Bacteria 2783
198 Ga0495602_0000474 3300048088 Bacteria 37136
199 Ga0495602_0166948 3300048088 Bacteria 1712
200 Ga0495614_0034674 3300048089 Bacteria 2169
201 Ga0496100_0000049 3300048903 Bacteria 75590
202 Ga0496101_0000010 3300048904 Bacteria 281990
203 Ga0496102_0000632 3300048905 Bacteria 35806
204 Ga0496102_0692327 3300048905 Bacteria 942
205 Ga0496103_0000043 3300048906 Bacteria 167983
206 Ga0496103_0249820 3300048906 Bacteria 1141
207 Ga0496104_0000002 3300048907 Bacteria 686017
208 Ga0496104_0009920 3300048907 Bacteria 8503
209 Ga0496105_0000001 3300048908 Bacteria 1328178
210 Ga0496105_0000488 3300048908 Bacteria 26096
211 Ga0496106_0000018 3300048909 Bacteria 175028
212 Ga0496106_0000286 3300048909 Bacteria 35738
213 Ga0496107_0000032 3300048910 Bacteria 99848
214 Ga0496107_0398608 3300048910 Bacteria 1023
215 Ga0496108_0000213 3300048911 Bacteria 52787
216 Ga0496109_0000021 3300048912 Bacteria 189945
217 Ga0496112_1130113 3300048915 Bacteria 701
218 Ga0496113_0204673 3300048916 Bacteria 1569
219 Ga0496114_0000014 3300048917 Bacteria 297902
220 Ga0496114_0130308 3300048917 Bacteria 2171
221 Ga0496115_0000020 3300048918 Bacteria 171995
222 Ga0496115_0001011 3300048918 Bacteria 20397
223 Ga0496115_1225241 3300048918 Bacteria 563
224 Ga0501034_0011242 3300049571 Bacteria 9293
225 Ga0501034_0102701 3300049571 Bacteria 2852
226 Ga0501034_0411627 3300049571 Bacteria 1274
227 Ga0501038_0127947 3300049574 Bacteria 2089
228 Ga0501047_0080839 3300049581 Bacteria 3124
229 Ga0501048_0392295 3300049582 Bacteria 992
230 Ga0501067_0727675 3300049583 Bacteria 558
231 Ga0501068_0398407 3300049584 Bacteria 887
232 Ga0501070_0030764 3300049586 Bacteria 4496
233 Ga0501074_0913336 3300049590 Bacteria 618
234 Ga0501075_0334666 3300049591 Bacteria 1154
235 Ga0501076_0418538 3300049592 Bacteria 1102
236 Ga0501080_1029749 3300049742 Bacteria 713
237 Ga0501081_0803403 3300049743 Bacteria 708
238 Ga0501044_0410606 3300049823 Bacteria 1265
239 nmdc:mga00v17_73485_c1 3300050491 Bacteria 2123
240 nmdc:mga00v17_95419_c1 3300050491 Bacteria 1872
241 nmdc:mga0yw44_1131478_c1 3300050492 Unclassified 529
242 nmdc:mga0yw44_75252_c1 3300050492 Bacteria 2105
243 nmdc:mga0yw44_826085_c1 3300050492 Bacteria 629
244 nmdc:mga09592_1127513_c1 3300050508 Bacteria 651
245 Ga0495601_0003669 3300053077 Bacteria 8826
246 Ga0495601_0050811 3300053077 Bacteria 2616
247 Ga0495601_0171897 3300053077 Bacteria 1416
248 Ga0495612_0140970 3300053078 Bacteria 1045
249 Ga0495655_0000011 3300053083 Bacteria 118490
250 Ga0495595_0350282 3300053084 Bacteria 745
251 Ga0495619_0000001 3300053085 Bacteria 586054
252 Ga0495619_0012035 3300053085 Bacteria 5451
253 Ga0500641_0005719 3300053096 Bacteria 4404
254 Ga0500628_000032 3300053129 Bacteria 52752
255 Ga0530510_0576544 3300061734 Bacteria 855

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0803403 Ga0501081_0803403_11_367 114
2 3300009176 Ga0105242_11657166 Ga0105242_116571662 122
3 3300020082 Ga0206353_10026354 Ga0206353_100263543 122
4 3300005435 Ga0070714_100242893 Ga0070714_1002428932 123
5 3300005436 Ga0070713_101077914 Ga0070713_1010779142 123
6 3300005439 Ga0070711_100001334 Ga0070711_1000013349 123
7 3300005457 Ga0070662_100272887 Ga0070662_1002728872 123
8 3300005458 Ga0070681_10771773 Ga0070681_107717732 123
9 3300005530 Ga0070679_100014900 Ga0070679_1000149008 123
10 3300025921 Ga0207652_10046458 Ga0207652_100464585 123
11 3300025928 Ga0207700_10539022 Ga0207700_105390222 123
12 3300046539 Ga0495621_0000623 Ga0495621_0000623_5737_6123 123
13 3300047321 Ga0495676_0173646 Ga0495676_0173646_756_1130 123
14 3300048916 Ga0496113_0204673 Ga0496113_0204673_648_1034 123
15 3300048918 Ga0496115_1225241 Ga0496115_1225241_157_537 123
16 3300049591 Ga0501075_0334666 Ga0501075_0334666_498_875 123
17 3300001977 JGI24746J21847_1000018 JGI24746J21847_10000189 124
18 3300001979 JGI24740J21852_10006411 JGI24740J21852_100064114 124
19 3300003373 JGI25407J50210_10024929 JGI25407J50210_100249291 124
20 3300005329 Ga0070683_100464934 Ga0070683_1004649342 124
21 3300005334 Ga0068869_100134553 Ga0068869_1001345533 124
22 3300005336 Ga0070680_100124717 Ga0070680_1001247172 124
23 3300005337 Ga0070682_100049031 Ga0070682_1000490314 124
24 3300005341 Ga0070691_10000105 Ga0070691_100001056 124
25 3300005341 Ga0070691_10200980 Ga0070691_102009801 124
26 3300005344 Ga0070661_100205628 Ga0070661_1002056282 124
27 3300005364 Ga0070673_100002074 Ga0070673_10000207411 124
28 3300005366 Ga0070659_100050228 Ga0070659_1000502282 124
29 3300005366 Ga0070659_100503117 Ga0070659_1005031172 124
30 3300005439 Ga0070711_100001483 Ga0070711_1000014838 124
31 3300005441 Ga0070700_100020283 Ga0070700_1000202833 124
32 3300005441 Ga0070700_100289480 Ga0070700_1002894802 124
33 3300005530 Ga0070679_100417417 Ga0070679_1004174172 124
34 3300005539 Ga0068853_100247032 Ga0068853_1002470322 124
35 3300005543 Ga0070672_100000004 Ga0070672_10000000457 124
36 3300005544 Ga0070686_100177209 Ga0070686_1001772092 124
37 3300005548 Ga0070665_100377461 Ga0070665_1003774612 124
38 3300005549 Ga0070704_101335172 Ga0070704_1013351721 124
39 3300005563 Ga0068855_100689971 Ga0068855_1006899712 124
40 3300005564 Ga0070664_102323565 Ga0070664_1023235651 124
41 3300005577 Ga0068857_100544761 Ga0068857_1005447612 124
42 3300005614 Ga0068856_100216525 Ga0068856_1002165252 124
43 3300005615 Ga0070702_100039418 Ga0070702_1000394183 124
44 3300005616 Ga0068852_100060008 Ga0068852_1000600083 124
45 3300005617 Ga0068859_101049016 Ga0068859_1010490162 124
46 3300005618 Ga0068864_100000023 Ga0068864_10000002322 124
47 3300005719 Ga0068861_100049601 Ga0068861_1000496012 124
48 3300005841 Ga0068863_100000004 Ga0068863_100000004154 124
49 3300005841 Ga0068863_100020939 Ga0068863_1000209396 124
50 3300005842 Ga0068858_100000033 Ga0068858_10000003346 124
51 3300005844 Ga0068862_100713134 Ga0068862_1007131343 124
52 3300005981 Ga0081538_10000176 Ga0081538_1000017648 124
53 3300006038 Ga0075365_10024236 Ga0075365_100242363 124
54 3300006038 Ga0075365_10155812 Ga0075365_101558122 124
55 3300006051 Ga0075364_10396157 Ga0075364_103961573 124
56 3300006931 Ga0097620_101049053 Ga0097620_1010490532 124
57 3300009098 Ga0105245_10004340 Ga0105245_100043408 124
58 3300009147 Ga0114129_11948731 Ga0114129_119487312 124
59 3300009147 Ga0114129_12529393 Ga0114129_125293932 124
60 3300009176 Ga0105242_10000605 Ga0105242_1000060510 124
61 3300009176 Ga0105242_10733598 Ga0105242_107335982 124
62 3300009545 Ga0105237_10081802 Ga0105237_100818024 124
63 3300009551 Ga0105238_10180289 Ga0105238_101802892 124
64 3300009553 Ga0105249_10021263 Ga0105249_100212637 124
65 3300010375 Ga0105239_10063875 Ga0105239_100638752 124
66 3300010375 Ga0105239_10231337 Ga0105239_102313372 124
67 3300010375 Ga0105239_10292875 Ga0105239_102928752 124
68 3300011119 Ga0105246_10173274 Ga0105246_101732744 124
69 3300013100 Ga0157373_10939965 Ga0157373_109399652 124
70 3300013102 Ga0157371_10622427 Ga0157371_106224272 124
71 3300013104 Ga0157370_10002243 Ga0157370_1000224310 124
72 3300013104 Ga0157370_11010046 Ga0157370_110100462 124
73 3300013105 Ga0157369_10052843 Ga0157369_100528434 124
74 3300013297 Ga0157378_10002534 Ga0157378_1000253413 124
75 3300013307 Ga0157372_10175868 Ga0157372_101758682 124
76 3300013307 Ga0157372_10291143 Ga0157372_102911431 124
77 3300013307 Ga0157372_11487296 Ga0157372_114872962 124
78 3300013308 Ga0157375_10000109 Ga0157375_1000010950 124
79 3300013308 Ga0157375_10003079 Ga0157375_1000307911 124
80 3300014325 Ga0163163_12444093 Ga0163163_124440932 124
81 3300014326 Ga0157380_10000028 Ga0157380_1000002895 124
82 3300014969 Ga0157376_10010369 Ga0157376_100103694 124
83 3300017792 Ga0163161_10531501 Ga0163161_105315012 124
84 3300017792 Ga0163161_10804047 Ga0163161_108040472 124
85 3300020070 Ga0206356_10675504 Ga0206356_106755042 124
86 3300020075 Ga0206349_1315344 Ga0206349_13153441 124
87 3300020081 Ga0206354_11531925 Ga0206354_115319252 124
88 3300025885 Ga0207653_10071559 Ga0207653_100715592 124
89 3300025912 Ga0207707_11101986 Ga0207707_111019861 124
90 3300025914 Ga0207671_10395355 Ga0207671_103953552 124
91 3300025916 Ga0207663_10004129 Ga0207663_100041294 124
92 3300025917 Ga0207660_10681904 Ga0207660_106819042 124
93 3300025919 Ga0207657_10030463 Ga0207657_100304634 124
94 3300025920 Ga0207649_11506241 Ga0207649_115062412 124
95 3300025921 Ga0207652_10408334 Ga0207652_104083342 124
96 3300025924 Ga0207694_10335804 Ga0207694_103358042 124
97 3300025927 Ga0207687_10007674 Ga0207687_100076743 124
98 3300025929 Ga0207664_10234031 Ga0207664_102340313 124
99 3300025932 Ga0207690_10012785 Ga0207690_100127854 124
100 3300025934 Ga0207686_10000032 Ga0207686_1000003237 124
101 3300025934 Ga0207686_10004766 Ga0207686_100047663 124
102 3300025938 Ga0207704_10668701 Ga0207704_106687012 124
103 3300025940 Ga0207691_10000020 Ga0207691_1000002068 124
104 3300025942 Ga0207689_10116021 Ga0207689_101160213 124
105 3300025944 Ga0207661_10035850 Ga0207661_100358502 124
106 3300025945 Ga0207679_11381680 Ga0207679_113816802 124
107 3300025960 Ga0207651_10006181 Ga0207651_100061815 124
108 3300025961 Ga0207712_10009873 Ga0207712_100098735 124
109 3300025972 Ga0207668_10039309 Ga0207668_100393091 124
110 3300025986 Ga0207658_10089618 Ga0207658_100896181 124
111 3300026035 Ga0207703_10000577 Ga0207703_1000057720 124
112 3300026041 Ga0207639_10121465 Ga0207639_101214652 124
113 3300026067 Ga0207678_10364254 Ga0207678_103642542 124
114 3300026075 Ga0207708_10052585 Ga0207708_100525853 124
115 3300026075 Ga0207708_10627490 Ga0207708_106274902 124
116 3300026078 Ga0207702_10553829 Ga0207702_105538292 124
117 3300026088 Ga0207641_10000170 Ga0207641_100001705 124
118 3300026088 Ga0207641_10005462 Ga0207641_100054626 124
119 3300026095 Ga0207676_10000025 Ga0207676_10000025252 124
120 3300026118 Ga0207675_100001319 Ga0207675_1000013195 124
121 3300026142 Ga0207698_10000041 Ga0207698_1000004115 124
122 3300026142 Ga0207698_12178989 Ga0207698_121789891 124
123 3300028379 Ga0268266_10167276 Ga0268266_101672763 124
124 3300028556 Ga0265337_1000012 Ga0265337_100001278 124
125 3300028558 Ga0265326_10000007 Ga0265326_10000007216 124
126 3300028563 Ga0265319_1000028 Ga0265319_100002867 124
127 3300028563 Ga0265319_1066218 Ga0265319_10662183 124
128 3300028654 Ga0265322_10000001 Ga0265322_1000000187 124
129 3300028800 Ga0265338_10000230 Ga0265338_1000023085 124
130 3300029957 Ga0265324_10001098 Ga0265324_100010989 124
131 3300031238 Ga0265332_10009620 Ga0265332_100096206 124
132 3300031239 Ga0265328_10004653 Ga0265328_100046533 124
133 3300031240 Ga0265320_10000002 Ga0265320_1000000287 124
134 3300031240 Ga0265320_10205960 Ga0265320_102059602 124
135 3300031241 Ga0265325_10020561 Ga0265325_100205616 124
136 3300031242 Ga0265329_10009449 Ga0265329_100094495 124
137 3300031250 Ga0265331_10003048 Ga0265331_1000304811 124
138 3300031250 Ga0265331_10030950 Ga0265331_100309504 124
139 3300031251 Ga0265327_10000011 Ga0265327_1000001187 124
140 3300031595 Ga0265313_10083897 Ga0265313_100838973 124
141 3300031711 Ga0265314_10000224 Ga0265314_100002247 124
142 3300031727 Ga0316576_10014947 Ga0316576_100149475 124
143 3300031733 Ga0316577_10204252 Ga0316577_102042522 124
144 3300031995 Ga0307409_100244947 Ga0307409_1002449472 124
145 3300035398 Ga0316574_0190881 Ga0316574_0190881_411_788 124
146 3300035398 Ga0316574_0639414 Ga0316574_0639414_71_460 124
147 3300036401 Ga0373937_0277184 Ga0373937_0277184_670_1044 124
148 3300036712 Ga0316584_0000992 Ga0316584_0000992_1814_2191 124
149 3300041443 Ga0451789_0085906 Ga0451789_0085906_157_534 124
150 3300041505 Ga0451849_1552654 Ga0451849_1552654_116_493 124
151 3300041512 Ga0451853_0165291 Ga0451853_0165291_126_503 124
152 3300044901 Ga0466960_0105420 Ga0466960_0105420_790_1167 124
153 3300046455 Ga0495603_0160438 Ga0495603_0160438_734_1111 124
154 3300046458 Ga0495591_046165 Ga0495591_046165_33_410 124
155 3300046459 Ga0495629_0005342 Ga0495629_0005342_5867_6244 124
156 3300046461 Ga0495641_0027087 Ga0495641_0027087_2109_2486 124
157 3300046461 Ga0495641_0385493 Ga0495641_0385493_136_513 124
158 3300046462 Ga0495651_0052514 Ga0495651_0052514_527_904 124
159 3300046462 Ga0495651_0203904 Ga0495651_0203904_217_594 124
160 3300046463 Ga0495653_0061469 Ga0495653_0061469_1152_1529 124
161 3300046463 Ga0495653_0214669 Ga0495653_0214669_635_1012 124
162 3300046477 Ga0495664_0347546 Ga0495664_0347546_342_719 124
163 3300046492 Ga0495585_0275671 Ga0495585_0275671_349_729 124
164 3300046511 Ga0495608_0383449 Ga0495608_0383449_360_737 124
165 3300046511 Ga0495608_0578400 Ga0495608_0578400_221_598 124
166 3300046515 Ga0495620_0336408 Ga0495620_0336408_51_428 124
167 3300046517 Ga0495630_0312202 Ga0495630_0312202_633_1010 124
168 3300046529 Ga0495652_0000003 Ga0495652_0000003_61348_61725 124
169 3300046536 Ga0495587_0005387 Ga0495587_0005387_6306_6683 124
170 3300046536 Ga0495587_0008634 Ga0495587_0008634_3146_3523 124
171 3300046543 Ga0495645_0014564 Ga0495645_0014564_1040_1417 124
172 3300046559 Ga0495667_0000022 Ga0495667_0000022_171514_171891 124
173 3300046559 Ga0495667_0023628 Ga0495667_0023628_781_1158 124
174 3300046615 Ga0495656_0000132 Ga0495656_0000132_16278_16655 124
175 3300046642 Ga0495634_0000212 Ga0495634_0000212_23660_24037 124
176 3300046642 Ga0495634_0002325 Ga0495634_0002325_12437_12814 124
177 3300046663 Ga0495635_0384715 Ga0495635_0384715_167_544 124
178 3300046675 Ga0495657_0021394 Ga0495657_0021394_793_1167 124
179 3300046678 Ga0495599_0119008 Ga0495599_0119008_776_1156 124
180 3300046679 Ga0495623_0178574 Ga0495623_0178574_502_879 124
181 3300046689 Ga0495613_0260850 Ga0495613_0260850_726_1103 124
182 3300047321 Ga0495676_0002782 Ga0495676_0002782_10370_10747 124
183 3300047322 Ga0495680_0009767 Ga0495680_0009767_5029_5406 124
184 3300047322 Ga0495680_0038562 Ga0495680_0038562_109_486 124
185 3300047444 Ga0495675_0522839 Ga0495675_0522839_55_435 124
186 3300047472 Ga0495686_0045321 Ga0495686_0045321_1304_1684 124
187 3300048088 Ga0495602_0166948 Ga0495602_0166948_983_1360 124
188 3300048089 Ga0495614_0034674 Ga0495614_0034674_1006_1383 124
189 3300048903 Ga0496100_0000049 Ga0496100_0000049_60896_61273 124
190 3300048904 Ga0496101_0000010 Ga0496101_0000010_39287_39664 124
191 3300048905 Ga0496102_0000632 Ga0496102_0000632_16225_16671 124
192 3300048906 Ga0496103_0000043 Ga0496103_0000043_128056_128502 124
193 3300048907 Ga0496104_0000002 Ga0496104_0000002_615269_615646 124
194 3300048907 Ga0496104_0009920 Ga0496104_0009920_6603_6980 124
195 3300048908 Ga0496105_0000001 Ga0496105_0000001_712533_712910 124
196 3300048908 Ga0496105_0000488 Ga0496105_0000488_10510_10887 124
197 3300048909 Ga0496106_0000018 Ga0496106_0000018_33615_33992 124
198 3300048909 Ga0496106_0000286 Ga0496106_0000286_21279_21656 124
199 3300048910 Ga0496107_0000032 Ga0496107_0000032_60233_60610 124
200 3300048910 Ga0496107_0398608 Ga0496107_0398608_116_493 124
201 3300048911 Ga0496108_0000213 Ga0496108_0000213_46629_47006 124
202 3300048912 Ga0496109_0000021 Ga0496109_0000021_62164_62541 124
203 3300048915 Ga0496112_1130113 Ga0496112_1130113_178_555 124
204 3300048917 Ga0496114_0000014 Ga0496114_0000014_8414_8791 124
205 3300048917 Ga0496114_0130308 Ga0496114_0130308_563_940 124
206 3300048918 Ga0496115_0000020 Ga0496115_0000020_81537_81914 124
207 3300048918 Ga0496115_0001011 Ga0496115_0001011_7682_8059 124
208 3300049571 Ga0501034_0011242 Ga0501034_0011242_5219_5611 124
209 3300049571 Ga0501034_0102701 Ga0501034_0102701_1790_2182 124
210 3300049571 Ga0501034_0411627 Ga0501034_0411627_405_797 124
211 3300049574 Ga0501038_0127947 Ga0501038_0127947_1595_1987 124
212 3300049581 Ga0501047_0080839 Ga0501047_0080839_1265_1657 124
213 3300049582 Ga0501048_0392295 Ga0501048_0392295_534_917 124
214 3300049584 Ga0501068_0398407 Ga0501068_0398407_61_438 124
215 3300049590 Ga0501074_0913336 Ga0501074_0913336_87_464 124
216 3300049592 Ga0501076_0418538 Ga0501076_0418538_668_1045 124
217 3300049742 Ga0501080_1029749 Ga0501080_1029749_77_460 124
218 3300049823 Ga0501044_0410606 Ga0501044_0410606_538_930 124
219 3300050491 nmdc:mga00v17_73485_c1 nmdc:mga00v17_73485_c1_255_644 124
220 3300050491 nmdc:mga00v17_95419_c1 nmdc:mga00v17_95419_c1_883_1272 124
221 3300050492 nmdc:mga0yw44_1131478_c1 nmdc:mga0yw44_1131478_c1_128_517 124
222 3300050492 nmdc:mga0yw44_75252_c1 nmdc:mga0yw44_75252_c1_44_433 124
223 3300050492 nmdc:mga0yw44_826085_c1 nmdc:mga0yw44_826085_c1_84_473 124
224 3300053077 Ga0495601_0003669 Ga0495601_0003669_280_657 124
225 3300053077 Ga0495601_0050811 Ga0495601_0050811_591_968 124
226 3300053077 Ga0495601_0171897 Ga0495601_0171897_601_978 124
227 3300053078 Ga0495612_0140970 Ga0495612_0140970_155_532 124
228 3300053083 Ga0495655_0000011 Ga0495655_0000011_29137_29514 124
229 3300053084 Ga0495595_0350282 Ga0495595_0350282_64_438 124
230 3300053085 Ga0495619_0000001 Ga0495619_0000001_136633_137010 124
231 3300053085 Ga0495619_0012035 Ga0495619_0012035_4311_4688 124
232 3300053096 Ga0500641_0005719 Ga0500641_0005719_542_919 124
233 3300053129 Ga0500628_000032 Ga0500628_000032_29942_30319 124
234 3300061734 Ga0530510_0576544 Ga0530510_0576544_23_400 124
235 3300046516 Ga0495628_0000093 Ga0495628_0000093_11469_11849 125
236 3300049586 Ga0501070_0030764 Ga0501070_0030764_1865_2347 125
237 3300000549 LJQas_1018453 LJQas_10184532 126
238 3300003659 JGI25404J52841_10002317 JGI25404J52841_100023175 126
239 3300005841 Ga0068863_100152865 Ga0068863_1001528653 126
240 3300005843 Ga0068860_100156096 Ga0068860_1001560963 126
241 3300005983 Ga0081540_1000006 Ga0081540_100000633 126
242 3300006880 Ga0075429_101144368 Ga0075429_1011443682 126
243 3300009011 Ga0105251_10161291 Ga0105251_101612912 126
244 3300014325 Ga0163163_10322063 Ga0163163_103220632 126
245 3300025931 Ga0207644_11340994 Ga0207644_113409941 126
246 3300028381 Ga0268264_10610754 Ga0268264_106107543 126
247 3300046455 Ga0495603_0001792 Ga0495603_0001792_8307_8699 126
248 3300046499 Ga0495594_0000013 Ga0495594_0000013_94892_95278 126
249 3300046557 Ga0495622_0000014 Ga0495622_0000014_160237_160623 126
250 3300047321 Ga0495676_0300681 Ga0495676_0300681_561_944 126
251 3300048088 Ga0495602_0000474 Ga0495602_0000474_17642_18028 126
252 3300048905 Ga0496102_0692327 Ga0496102_0692327_373_768 126
253 3300048906 Ga0496103_0249820 Ga0496103_0249820_46_441 126
254 3300049583 Ga0501067_0727675 Ga0501067_0727675_104_490 126
255 3300050508 nmdc:mga09592_1127513_c1 nmdc:mga09592_1127513_c1_209_592 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

110

0.93

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.8723 4 126
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.8696 4 126
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.8664 4 126
4mts-assembly1.cif.gz_B ni- and zn-bound gloa2 at high resolution 0.8636 2 126
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8605 2 126
ID Description Score Start End Superfamily
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8602 2 125 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8553 1 126 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.849 1 126 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8485 2 126 3.10.180.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8418 2 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W0X9N2-F1-model_v4 VOC family protein 0.9549 1 66 GO:0004462
GO:0046872
AF-A0A7W1ARM9-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9546 25 126 GO:0004462
GO:0005737
GO:0019243
AF-A0A7V9Q1B7-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9508 1 126 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A7V9G079-F1-model_v4 Lactoylglutathione lyase 0.9466 1 57 GO:0004462
GO:0046872
AF-A0A7W1ARM9-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9454 25 126 GO:0004462
GO:0005737
GO:0019243

Feature Viewer

pLDDT pTM Quality
94.12 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map