F365583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 198 | 255 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10024236|Ga0075365_100242363 |
| Length | 129 |
| Sequence | MSSLIHTCYRVYDLDSSIAFYEKLGMEELRRLPIGDEAVNVFMGLEGDGPRLELTYNFDQDEPYEIGSGYGHIALTVDDMDAALERLAADGITPEKPPYTVSEGGSRLCFVRDPDGYRIELIERDPGTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 120 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 125 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 127 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 197 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 198 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.43 |
| Metatranscriptomes | 1.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.92 |
| Nodule | 0 |
| Rhizoplane | 9.41 |
| Rhizosphere | 85.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1018453 | 3300000549 | Unclassified | 812 |
| 2 | JGI24746J21847_1000018 | 3300001977 | Bacteria | 15938 |
| 3 | JGI24740J21852_10006411 | 3300001979 | Bacteria | 4875 |
| 4 | JGI25407J50210_10024929 | 3300003373 | Bacteria | 1551 |
| 5 | JGI25404J52841_10002317 | 3300003659 | Bacteria | 3583 |
| 6 | Ga0070683_100464934 | 3300005329 | Bacteria | 1207 |
| 7 | Ga0068869_100134553 | 3300005334 | Bacteria | 1903 |
| 8 | Ga0070680_100124717 | 3300005336 | Bacteria | 2151 |
| 9 | Ga0070682_100049031 | 3300005337 | Bacteria | 2631 |
| 10 | Ga0070691_10000105 | 3300005341 | Bacteria | 24902 |
| 11 | Ga0070691_10200980 | 3300005341 | Bacteria | 1047 |
| 12 | Ga0070661_100205628 | 3300005344 | Bacteria | 1506 |
| 13 | Ga0070673_100002074 | 3300005364 | Bacteria | 12077 |
| 14 | Ga0070659_100050228 | 3300005366 | Bacteria | 3279 |
| 15 | Ga0070659_100503117 | 3300005366 | Bacteria | 1033 |
| 16 | Ga0070714_100242893 | 3300005435 | Bacteria | 1662 |
| 17 | Ga0070713_101077914 | 3300005436 | Bacteria | 776 |
| 18 | Ga0070711_100001334 | 3300005439 | Bacteria | 13487 |
| 19 | Ga0070711_100001483 | 3300005439 | Bacteria | 12864 |
| 20 | Ga0070700_100020283 | 3300005441 | Bacteria | 3848 |
| 21 | Ga0070700_100289480 | 3300005441 | Bacteria | 1191 |
| 22 | Ga0070662_100272887 | 3300005457 | Bacteria | 1366 |
| 23 | Ga0070681_10771773 | 3300005458 | Bacteria | 878 |
| 24 | Ga0070679_100014900 | 3300005530 | Bacteria | 7466 |
| 25 | Ga0070679_100417417 | 3300005530 | Bacteria | 1287 |
| 26 | Ga0068853_100247032 | 3300005539 | Bacteria | 1637 |
| 27 | Ga0070672_100000004 | 3300005543 | Bacteria | 129970 |
| 28 | Ga0070686_100177209 | 3300005544 | Bacteria | 1512 |
| 29 | Ga0070665_100377461 | 3300005548 | Bacteria | 1425 |
| 30 | Ga0070704_101335172 | 3300005549 | Bacteria | 657 |
| 31 | Ga0068855_100689971 | 3300005563 | Bacteria | 1094 |
| 32 | Ga0070664_102323565 | 3300005564 | Bacteria | 509 |
| 33 | Ga0068857_100544761 | 3300005577 | Bacteria | 1093 |
| 34 | Ga0068856_100216525 | 3300005614 | Bacteria | 1930 |
| 35 | Ga0070702_100039418 | 3300005615 | Bacteria | 2636 |
| 36 | Ga0068852_100060008 | 3300005616 | Bacteria | 3300 |
| 37 | Ga0068859_101049016 | 3300005617 | Bacteria | 896 |
| 38 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 39 | Ga0068861_100049601 | 3300005719 | Bacteria | 3179 |
| 40 | Ga0068863_100000004 | 3300005841 | Bacteria | 272478 |
| 41 | Ga0068863_100020939 | 3300005841 | Bacteria | 6246 |
| 42 | Ga0068863_100152865 | 3300005841 | Bacteria | 2209 |
| 43 | Ga0068858_100000033 | 3300005842 | Bacteria | 142748 |
| 44 | Ga0068860_100156096 | 3300005843 | Bacteria | 2199 |
| 45 | Ga0068862_100713134 | 3300005844 | Bacteria | 973 |
| 46 | Ga0081538_10000176 | 3300005981 | Bacteria | 69195 |
| 47 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 48 | Ga0075365_10024236 | 3300006038 | Bacteria | 3824 |
| 49 | Ga0075365_10155812 | 3300006038 | Bacteria | 1590 |
| 50 | Ga0075364_10396157 | 3300006051 | Bacteria | 942 |
| 51 | Ga0075429_101144368 | 3300006880 | Bacteria | 680 |
| 52 | Ga0097620_101049053 | 3300006931 | Bacteria | 896 |
| 53 | Ga0105251_10161291 | 3300009011 | Bacteria | 1011 |
| 54 | Ga0105245_10004340 | 3300009098 | Bacteria | 12553 |
| 55 | Ga0114129_11948731 | 3300009147 | Bacteria | 711 |
| 56 | Ga0114129_12529393 | 3300009147 | Bacteria | 613 |
| 57 | Ga0105242_10000605 | 3300009176 | Bacteria | 28087 |
| 58 | Ga0105242_10733598 | 3300009176 | Bacteria | 970 |
| 59 | Ga0105242_11657166 | 3300009176 | Bacteria | 675 |
| 60 | Ga0105237_10081802 | 3300009545 | Bacteria | 3220 |
| 61 | Ga0105238_10180289 | 3300009551 | Bacteria | 2089 |
| 62 | Ga0105249_10021263 | 3300009553 | Bacteria | 5809 |
| 63 | Ga0105239_10063875 | 3300010375 | Bacteria | 4041 |
| 64 | Ga0105239_10231337 | 3300010375 | Bacteria | 2074 |
| 65 | Ga0105239_10292875 | 3300010375 | Bacteria | 1833 |
| 66 | Ga0105246_10173274 | 3300011119 | Bacteria | 1654 |
| 67 | Ga0157373_10939965 | 3300013100 | Bacteria | 643 |
| 68 | Ga0157371_10622427 | 3300013102 | Bacteria | 804 |
| 69 | Ga0157370_10002243 | 3300013104 | Bacteria | 23500 |
| 70 | Ga0157370_11010046 | 3300013104 | Bacteria | 753 |
| 71 | Ga0157369_10052843 | 3300013105 | Bacteria | 4394 |
| 72 | Ga0157378_10002534 | 3300013297 | Bacteria | 16255 |
| 73 | Ga0157372_10175868 | 3300013307 | Bacteria | 2477 |
| 74 | Ga0157372_10291143 | 3300013307 | Bacteria | 1899 |
| 75 | Ga0157372_11487296 | 3300013307 | Bacteria | 780 |
| 76 | Ga0157375_10000109 | 3300013308 | Bacteria | 80349 |
| 77 | Ga0157375_10003079 | 3300013308 | Bacteria | 14478 |
| 78 | Ga0163163_10322063 | 3300014325 | Bacteria | 1600 |
| 79 | Ga0163163_12444093 | 3300014325 | Bacteria | 581 |
| 80 | Ga0157380_10000028 | 3300014326 | Bacteria | 99836 |
| 81 | Ga0157376_10010369 | 3300014969 | Bacteria | 6811 |
| 82 | Ga0163161_10531501 | 3300017792 | Bacteria | 961 |
| 83 | Ga0163161_10804047 | 3300017792 | Bacteria | 790 |
| 84 | Ga0206356_10675504 | 3300020070 | Bacteria | 1118 |
| 85 | Ga0206349_1315344 | 3300020075 | Bacteria | 530 |
| 86 | Ga0206354_11531925 | 3300020081 | Bacteria | 1152 |
| 87 | Ga0206353_10026354 | 3300020082 | Bacteria | 2261 |
| 88 | Ga0207653_10071559 | 3300025885 | Bacteria | 1186 |
| 89 | Ga0207707_11101986 | 3300025912 | Bacteria | 647 |
| 90 | Ga0207671_10395355 | 3300025914 | Bacteria | 1099 |
| 91 | Ga0207663_10004129 | 3300025916 | Bacteria | 7190 |
| 92 | Ga0207660_10681904 | 3300025917 | Bacteria | 838 |
| 93 | Ga0207657_10030463 | 3300025919 | Bacteria | 4897 |
| 94 | Ga0207649_11506241 | 3300025920 | Bacteria | 532 |
| 95 | Ga0207652_10046458 | 3300025921 | Bacteria | 3704 |
| 96 | Ga0207652_10408334 | 3300025921 | Bacteria | 1225 |
| 97 | Ga0207694_10335804 | 3300025924 | Bacteria | 1249 |
| 98 | Ga0207687_10007674 | 3300025927 | Bacteria | 7087 |
| 99 | Ga0207700_10539022 | 3300025928 | Bacteria | 1035 |
| 100 | Ga0207664_10234031 | 3300025929 | Bacteria | 1597 |
| 101 | Ga0207644_11340994 | 3300025931 | Bacteria | 601 |
| 102 | Ga0207690_10012785 | 3300025932 | Bacteria | 5029 |
| 103 | Ga0207686_10000032 | 3300025934 | Bacteria | 150341 |
| 104 | Ga0207686_10004766 | 3300025934 | Bacteria | 7278 |
| 105 | Ga0207704_10668701 | 3300025938 | Bacteria | 857 |
| 106 | Ga0207691_10000020 | 3300025940 | Bacteria | 133465 |
| 107 | Ga0207689_10116021 | 3300025942 | Bacteria | 2201 |
| 108 | Ga0207661_10035850 | 3300025944 | Bacteria | 3868 |
| 109 | Ga0207679_11381680 | 3300025945 | Bacteria | 646 |
| 110 | Ga0207651_10006181 | 3300025960 | Bacteria | 6234 |
| 111 | Ga0207712_10009873 | 3300025961 | Bacteria | 6051 |
| 112 | Ga0207668_10039309 | 3300025972 | Bacteria | 3183 |
| 113 | Ga0207658_10089618 | 3300025986 | Bacteria | 2382 |
| 114 | Ga0207703_10000577 | 3300026035 | Bacteria | 37419 |
| 115 | Ga0207639_10121465 | 3300026041 | Bacteria | 2147 |
| 116 | Ga0207678_10364254 | 3300026067 | Bacteria | 1248 |
| 117 | Ga0207708_10052585 | 3300026075 | Bacteria | 3102 |
| 118 | Ga0207708_10627490 | 3300026075 | Bacteria | 913 |
| 119 | Ga0207702_10553829 | 3300026078 | Bacteria | 1125 |
| 120 | Ga0207641_10000170 | 3300026088 | Bacteria | 91128 |
| 121 | Ga0207641_10005462 | 3300026088 | Bacteria | 10840 |
| 122 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 123 | Ga0207675_100001319 | 3300026118 | Bacteria | 24876 |
| 124 | Ga0207698_10000041 | 3300026142 | Bacteria | 97882 |
| 125 | Ga0207698_12178989 | 3300026142 | Bacteria | 567 |
| 126 | Ga0268266_10167276 | 3300028379 | Bacteria | 1993 |
| 127 | Ga0268264_10610754 | 3300028381 | Bacteria | 1076 |
| 128 | Ga0265337_1000012 | 3300028556 | Bacteria | 85395 |
| 129 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 130 | Ga0265319_1000028 | 3300028563 | Bacteria | 135557 |
| 131 | Ga0265319_1066218 | 3300028563 | Bacteria | 1164 |
| 132 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 133 | Ga0265338_10000230 | 3300028800 | Bacteria | 103891 |
| 134 | Ga0265324_10001098 | 3300029957 | Bacteria | 16258 |
| 135 | Ga0265332_10009620 | 3300031238 | Bacteria | 4313 |
| 136 | Ga0265328_10004653 | 3300031239 | Bacteria | 5938 |
| 137 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 138 | Ga0265320_10205960 | 3300031240 | Bacteria | 878 |
| 139 | Ga0265325_10020561 | 3300031241 | Bacteria | 3638 |
| 140 | Ga0265329_10009449 | 3300031242 | Bacteria | 3641 |
| 141 | Ga0265331_10003048 | 3300031250 | Bacteria | 10998 |
| 142 | Ga0265331_10030950 | 3300031250 | Bacteria | 2662 |
| 143 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 144 | Ga0265313_10083897 | 3300031595 | Bacteria | 1442 |
| 145 | Ga0265314_10000224 | 3300031711 | Bacteria | 84325 |
| 146 | Ga0316576_10014947 | 3300031727 | Bacteria | 5195 |
| 147 | Ga0316577_10204252 | 3300031733 | Bacteria | 1117 |
| 148 | Ga0307409_100244947 | 3300031995 | Bacteria | 1635 |
| 149 | Ga0316574_0190881 | 3300035398 | Bacteria | 1317 |
| 150 | Ga0316574_0639414 | 3300035398 | Bacteria | 655 |
| 151 | Ga0373937_0277184 | 3300036401 | Bacteria | 1583 |
| 152 | Ga0316584_0000992 | 3300036712 | Bacteria | 16328 |
| 153 | Ga0451789_0085906 | 3300041443 | Bacteria | 852 |
| 154 | Ga0451849_1552654 | 3300041505 | Bacteria | 1409 |
| 155 | Ga0451853_0165291 | 3300041512 | Unclassified | 2202 |
| 156 | Ga0466960_0105420 | 3300044901 | Bacteria | 1457 |
| 157 | Ga0495603_0001792 | 3300046455 | Bacteria | 12677 |
| 158 | Ga0495603_0160438 | 3300046455 | Bacteria | 1304 |
| 159 | Ga0495591_046165 | 3300046458 | Bacteria | 1211 |
| 160 | Ga0495629_0005342 | 3300046459 | Bacteria | 9594 |
| 161 | Ga0495641_0027087 | 3300046461 | Bacteria | 2791 |
| 162 | Ga0495641_0385493 | 3300046461 | Bacteria | 635 |
| 163 | Ga0495651_0052514 | 3300046462 | Bacteria | 3139 |
| 164 | Ga0495651_0203904 | 3300046462 | Bacteria | 1382 |
| 165 | Ga0495653_0061469 | 3300046463 | Bacteria | 2842 |
| 166 | Ga0495653_0214669 | 3300046463 | Bacteria | 1297 |
| 167 | Ga0495664_0347546 | 3300046477 | Bacteria | 893 |
| 168 | Ga0495585_0275671 | 3300046492 | Bacteria | 833 |
| 169 | Ga0495594_0000013 | 3300046499 | Bacteria | 103201 |
| 170 | Ga0495608_0383449 | 3300046511 | Bacteria | 861 |
| 171 | Ga0495608_0578400 | 3300046511 | Bacteria | 675 |
| 172 | Ga0495620_0336408 | 3300046515 | Bacteria | 573 |
| 173 | Ga0495628_0000093 | 3300046516 | Bacteria | 71181 |
| 174 | Ga0495630_0312202 | 3300046517 | Bacteria | 1202 |
| 175 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 176 | Ga0495587_0005387 | 3300046536 | Bacteria | 8361 |
| 177 | Ga0495587_0008634 | 3300046536 | Bacteria | 6547 |
| 178 | Ga0495621_0000623 | 3300046539 | Bacteria | 8912 |
| 179 | Ga0495645_0014564 | 3300046543 | Bacteria | 5582 |
| 180 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 181 | Ga0495667_0000022 | 3300046559 | Bacteria | 176919 |
| 182 | Ga0495667_0023628 | 3300046559 | Bacteria | 4140 |
| 183 | Ga0495656_0000132 | 3300046615 | Bacteria | 27907 |
| 184 | Ga0495634_0000212 | 3300046642 | Bacteria | 53864 |
| 185 | Ga0495634_0002325 | 3300046642 | Bacteria | 15909 |
| 186 | Ga0495635_0384715 | 3300046663 | Bacteria | 933 |
| 187 | Ga0495657_0021394 | 3300046675 | Bacteria | 4641 |
| 188 | Ga0495599_0119008 | 3300046678 | Bacteria | 1642 |
| 189 | Ga0495623_0178574 | 3300046679 | Bacteria | 1235 |
| 190 | Ga0495613_0260850 | 3300046689 | Bacteria | 1207 |
| 191 | Ga0495676_0002782 | 3300047321 | Bacteria | 15729 |
| 192 | Ga0495676_0173646 | 3300047321 | Bacteria | 1515 |
| 193 | Ga0495676_0300681 | 3300047321 | Bacteria | 1082 |
| 194 | Ga0495680_0009767 | 3300047322 | Bacteria | 8605 |
| 195 | Ga0495680_0038562 | 3300047322 | Bacteria | 3817 |
| 196 | Ga0495675_0522839 | 3300047444 | Bacteria | 679 |
| 197 | Ga0495686_0045321 | 3300047472 | Bacteria | 2783 |
| 198 | Ga0495602_0000474 | 3300048088 | Bacteria | 37136 |
| 199 | Ga0495602_0166948 | 3300048088 | Bacteria | 1712 |
| 200 | Ga0495614_0034674 | 3300048089 | Bacteria | 2169 |
| 201 | Ga0496100_0000049 | 3300048903 | Bacteria | 75590 |
| 202 | Ga0496101_0000010 | 3300048904 | Bacteria | 281990 |
| 203 | Ga0496102_0000632 | 3300048905 | Bacteria | 35806 |
| 204 | Ga0496102_0692327 | 3300048905 | Bacteria | 942 |
| 205 | Ga0496103_0000043 | 3300048906 | Bacteria | 167983 |
| 206 | Ga0496103_0249820 | 3300048906 | Bacteria | 1141 |
| 207 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 208 | Ga0496104_0009920 | 3300048907 | Bacteria | 8503 |
| 209 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 210 | Ga0496105_0000488 | 3300048908 | Bacteria | 26096 |
| 211 | Ga0496106_0000018 | 3300048909 | Bacteria | 175028 |
| 212 | Ga0496106_0000286 | 3300048909 | Bacteria | 35738 |
| 213 | Ga0496107_0000032 | 3300048910 | Bacteria | 99848 |
| 214 | Ga0496107_0398608 | 3300048910 | Bacteria | 1023 |
| 215 | Ga0496108_0000213 | 3300048911 | Bacteria | 52787 |
| 216 | Ga0496109_0000021 | 3300048912 | Bacteria | 189945 |
| 217 | Ga0496112_1130113 | 3300048915 | Bacteria | 701 |
| 218 | Ga0496113_0204673 | 3300048916 | Bacteria | 1569 |
| 219 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 220 | Ga0496114_0130308 | 3300048917 | Bacteria | 2171 |
| 221 | Ga0496115_0000020 | 3300048918 | Bacteria | 171995 |
| 222 | Ga0496115_0001011 | 3300048918 | Bacteria | 20397 |
| 223 | Ga0496115_1225241 | 3300048918 | Bacteria | 563 |
| 224 | Ga0501034_0011242 | 3300049571 | Bacteria | 9293 |
| 225 | Ga0501034_0102701 | 3300049571 | Bacteria | 2852 |
| 226 | Ga0501034_0411627 | 3300049571 | Bacteria | 1274 |
| 227 | Ga0501038_0127947 | 3300049574 | Bacteria | 2089 |
| 228 | Ga0501047_0080839 | 3300049581 | Bacteria | 3124 |
| 229 | Ga0501048_0392295 | 3300049582 | Bacteria | 992 |
| 230 | Ga0501067_0727675 | 3300049583 | Bacteria | 558 |
| 231 | Ga0501068_0398407 | 3300049584 | Bacteria | 887 |
| 232 | Ga0501070_0030764 | 3300049586 | Bacteria | 4496 |
| 233 | Ga0501074_0913336 | 3300049590 | Bacteria | 618 |
| 234 | Ga0501075_0334666 | 3300049591 | Bacteria | 1154 |
| 235 | Ga0501076_0418538 | 3300049592 | Bacteria | 1102 |
| 236 | Ga0501080_1029749 | 3300049742 | Bacteria | 713 |
| 237 | Ga0501081_0803403 | 3300049743 | Bacteria | 708 |
| 238 | Ga0501044_0410606 | 3300049823 | Bacteria | 1265 |
| 239 | nmdc:mga00v17_73485_c1 | 3300050491 | Bacteria | 2123 |
| 240 | nmdc:mga00v17_95419_c1 | 3300050491 | Bacteria | 1872 |
| 241 | nmdc:mga0yw44_1131478_c1 | 3300050492 | Unclassified | 529 |
| 242 | nmdc:mga0yw44_75252_c1 | 3300050492 | Bacteria | 2105 |
| 243 | nmdc:mga0yw44_826085_c1 | 3300050492 | Bacteria | 629 |
| 244 | nmdc:mga09592_1127513_c1 | 3300050508 | Bacteria | 651 |
| 245 | Ga0495601_0003669 | 3300053077 | Bacteria | 8826 |
| 246 | Ga0495601_0050811 | 3300053077 | Bacteria | 2616 |
| 247 | Ga0495601_0171897 | 3300053077 | Bacteria | 1416 |
| 248 | Ga0495612_0140970 | 3300053078 | Bacteria | 1045 |
| 249 | Ga0495655_0000011 | 3300053083 | Bacteria | 118490 |
| 250 | Ga0495595_0350282 | 3300053084 | Bacteria | 745 |
| 251 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 252 | Ga0495619_0012035 | 3300053085 | Bacteria | 5451 |
| 253 | Ga0500641_0005719 | 3300053096 | Bacteria | 4404 |
| 254 | Ga0500628_000032 | 3300053129 | Bacteria | 52752 |
| 255 | Ga0530510_0576544 | 3300061734 | Bacteria | 855 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0803403 | Ga0501081_0803403_11_367 | 114 |
| 2 | 3300009176 | Ga0105242_11657166 | Ga0105242_116571662 | 122 |
| 3 | 3300020082 | Ga0206353_10026354 | Ga0206353_100263543 | 122 |
| 4 | 3300005435 | Ga0070714_100242893 | Ga0070714_1002428932 | 123 |
| 5 | 3300005436 | Ga0070713_101077914 | Ga0070713_1010779142 | 123 |
| 6 | 3300005439 | Ga0070711_100001334 | Ga0070711_1000013349 | 123 |
| 7 | 3300005457 | Ga0070662_100272887 | Ga0070662_1002728872 | 123 |
| 8 | 3300005458 | Ga0070681_10771773 | Ga0070681_107717732 | 123 |
| 9 | 3300005530 | Ga0070679_100014900 | Ga0070679_1000149008 | 123 |
| 10 | 3300025921 | Ga0207652_10046458 | Ga0207652_100464585 | 123 |
| 11 | 3300025928 | Ga0207700_10539022 | Ga0207700_105390222 | 123 |
| 12 | 3300046539 | Ga0495621_0000623 | Ga0495621_0000623_5737_6123 | 123 |
| 13 | 3300047321 | Ga0495676_0173646 | Ga0495676_0173646_756_1130 | 123 |
| 14 | 3300048916 | Ga0496113_0204673 | Ga0496113_0204673_648_1034 | 123 |
| 15 | 3300048918 | Ga0496115_1225241 | Ga0496115_1225241_157_537 | 123 |
| 16 | 3300049591 | Ga0501075_0334666 | Ga0501075_0334666_498_875 | 123 |
| 17 | 3300001977 | JGI24746J21847_1000018 | JGI24746J21847_10000189 | 124 |
| 18 | 3300001979 | JGI24740J21852_10006411 | JGI24740J21852_100064114 | 124 |
| 19 | 3300003373 | JGI25407J50210_10024929 | JGI25407J50210_100249291 | 124 |
| 20 | 3300005329 | Ga0070683_100464934 | Ga0070683_1004649342 | 124 |
| 21 | 3300005334 | Ga0068869_100134553 | Ga0068869_1001345533 | 124 |
| 22 | 3300005336 | Ga0070680_100124717 | Ga0070680_1001247172 | 124 |
| 23 | 3300005337 | Ga0070682_100049031 | Ga0070682_1000490314 | 124 |
| 24 | 3300005341 | Ga0070691_10000105 | Ga0070691_100001056 | 124 |
| 25 | 3300005341 | Ga0070691_10200980 | Ga0070691_102009801 | 124 |
| 26 | 3300005344 | Ga0070661_100205628 | Ga0070661_1002056282 | 124 |
| 27 | 3300005364 | Ga0070673_100002074 | Ga0070673_10000207411 | 124 |
| 28 | 3300005366 | Ga0070659_100050228 | Ga0070659_1000502282 | 124 |
| 29 | 3300005366 | Ga0070659_100503117 | Ga0070659_1005031172 | 124 |
| 30 | 3300005439 | Ga0070711_100001483 | Ga0070711_1000014838 | 124 |
| 31 | 3300005441 | Ga0070700_100020283 | Ga0070700_1000202833 | 124 |
| 32 | 3300005441 | Ga0070700_100289480 | Ga0070700_1002894802 | 124 |
| 33 | 3300005530 | Ga0070679_100417417 | Ga0070679_1004174172 | 124 |
| 34 | 3300005539 | Ga0068853_100247032 | Ga0068853_1002470322 | 124 |
| 35 | 3300005543 | Ga0070672_100000004 | Ga0070672_10000000457 | 124 |
| 36 | 3300005544 | Ga0070686_100177209 | Ga0070686_1001772092 | 124 |
| 37 | 3300005548 | Ga0070665_100377461 | Ga0070665_1003774612 | 124 |
| 38 | 3300005549 | Ga0070704_101335172 | Ga0070704_1013351721 | 124 |
| 39 | 3300005563 | Ga0068855_100689971 | Ga0068855_1006899712 | 124 |
| 40 | 3300005564 | Ga0070664_102323565 | Ga0070664_1023235651 | 124 |
| 41 | 3300005577 | Ga0068857_100544761 | Ga0068857_1005447612 | 124 |
| 42 | 3300005614 | Ga0068856_100216525 | Ga0068856_1002165252 | 124 |
| 43 | 3300005615 | Ga0070702_100039418 | Ga0070702_1000394183 | 124 |
| 44 | 3300005616 | Ga0068852_100060008 | Ga0068852_1000600083 | 124 |
| 45 | 3300005617 | Ga0068859_101049016 | Ga0068859_1010490162 | 124 |
| 46 | 3300005618 | Ga0068864_100000023 | Ga0068864_10000002322 | 124 |
| 47 | 3300005719 | Ga0068861_100049601 | Ga0068861_1000496012 | 124 |
| 48 | 3300005841 | Ga0068863_100000004 | Ga0068863_100000004154 | 124 |
| 49 | 3300005841 | Ga0068863_100020939 | Ga0068863_1000209396 | 124 |
| 50 | 3300005842 | Ga0068858_100000033 | Ga0068858_10000003346 | 124 |
| 51 | 3300005844 | Ga0068862_100713134 | Ga0068862_1007131343 | 124 |
| 52 | 3300005981 | Ga0081538_10000176 | Ga0081538_1000017648 | 124 |
| 53 | 3300006038 | Ga0075365_10024236 | Ga0075365_100242363 | 124 |
| 54 | 3300006038 | Ga0075365_10155812 | Ga0075365_101558122 | 124 |
| 55 | 3300006051 | Ga0075364_10396157 | Ga0075364_103961573 | 124 |
| 56 | 3300006931 | Ga0097620_101049053 | Ga0097620_1010490532 | 124 |
| 57 | 3300009098 | Ga0105245_10004340 | Ga0105245_100043408 | 124 |
| 58 | 3300009147 | Ga0114129_11948731 | Ga0114129_119487312 | 124 |
| 59 | 3300009147 | Ga0114129_12529393 | Ga0114129_125293932 | 124 |
| 60 | 3300009176 | Ga0105242_10000605 | Ga0105242_1000060510 | 124 |
| 61 | 3300009176 | Ga0105242_10733598 | Ga0105242_107335982 | 124 |
| 62 | 3300009545 | Ga0105237_10081802 | Ga0105237_100818024 | 124 |
| 63 | 3300009551 | Ga0105238_10180289 | Ga0105238_101802892 | 124 |
| 64 | 3300009553 | Ga0105249_10021263 | Ga0105249_100212637 | 124 |
| 65 | 3300010375 | Ga0105239_10063875 | Ga0105239_100638752 | 124 |
| 66 | 3300010375 | Ga0105239_10231337 | Ga0105239_102313372 | 124 |
| 67 | 3300010375 | Ga0105239_10292875 | Ga0105239_102928752 | 124 |
| 68 | 3300011119 | Ga0105246_10173274 | Ga0105246_101732744 | 124 |
| 69 | 3300013100 | Ga0157373_10939965 | Ga0157373_109399652 | 124 |
| 70 | 3300013102 | Ga0157371_10622427 | Ga0157371_106224272 | 124 |
| 71 | 3300013104 | Ga0157370_10002243 | Ga0157370_1000224310 | 124 |
| 72 | 3300013104 | Ga0157370_11010046 | Ga0157370_110100462 | 124 |
| 73 | 3300013105 | Ga0157369_10052843 | Ga0157369_100528434 | 124 |
| 74 | 3300013297 | Ga0157378_10002534 | Ga0157378_1000253413 | 124 |
| 75 | 3300013307 | Ga0157372_10175868 | Ga0157372_101758682 | 124 |
| 76 | 3300013307 | Ga0157372_10291143 | Ga0157372_102911431 | 124 |
| 77 | 3300013307 | Ga0157372_11487296 | Ga0157372_114872962 | 124 |
| 78 | 3300013308 | Ga0157375_10000109 | Ga0157375_1000010950 | 124 |
| 79 | 3300013308 | Ga0157375_10003079 | Ga0157375_1000307911 | 124 |
| 80 | 3300014325 | Ga0163163_12444093 | Ga0163163_124440932 | 124 |
| 81 | 3300014326 | Ga0157380_10000028 | Ga0157380_1000002895 | 124 |
| 82 | 3300014969 | Ga0157376_10010369 | Ga0157376_100103694 | 124 |
| 83 | 3300017792 | Ga0163161_10531501 | Ga0163161_105315012 | 124 |
| 84 | 3300017792 | Ga0163161_10804047 | Ga0163161_108040472 | 124 |
| 85 | 3300020070 | Ga0206356_10675504 | Ga0206356_106755042 | 124 |
| 86 | 3300020075 | Ga0206349_1315344 | Ga0206349_13153441 | 124 |
| 87 | 3300020081 | Ga0206354_11531925 | Ga0206354_115319252 | 124 |
| 88 | 3300025885 | Ga0207653_10071559 | Ga0207653_100715592 | 124 |
| 89 | 3300025912 | Ga0207707_11101986 | Ga0207707_111019861 | 124 |
| 90 | 3300025914 | Ga0207671_10395355 | Ga0207671_103953552 | 124 |
| 91 | 3300025916 | Ga0207663_10004129 | Ga0207663_100041294 | 124 |
| 92 | 3300025917 | Ga0207660_10681904 | Ga0207660_106819042 | 124 |
| 93 | 3300025919 | Ga0207657_10030463 | Ga0207657_100304634 | 124 |
| 94 | 3300025920 | Ga0207649_11506241 | Ga0207649_115062412 | 124 |
| 95 | 3300025921 | Ga0207652_10408334 | Ga0207652_104083342 | 124 |
| 96 | 3300025924 | Ga0207694_10335804 | Ga0207694_103358042 | 124 |
| 97 | 3300025927 | Ga0207687_10007674 | Ga0207687_100076743 | 124 |
| 98 | 3300025929 | Ga0207664_10234031 | Ga0207664_102340313 | 124 |
| 99 | 3300025932 | Ga0207690_10012785 | Ga0207690_100127854 | 124 |
| 100 | 3300025934 | Ga0207686_10000032 | Ga0207686_1000003237 | 124 |
| 101 | 3300025934 | Ga0207686_10004766 | Ga0207686_100047663 | 124 |
| 102 | 3300025938 | Ga0207704_10668701 | Ga0207704_106687012 | 124 |
| 103 | 3300025940 | Ga0207691_10000020 | Ga0207691_1000002068 | 124 |
| 104 | 3300025942 | Ga0207689_10116021 | Ga0207689_101160213 | 124 |
| 105 | 3300025944 | Ga0207661_10035850 | Ga0207661_100358502 | 124 |
| 106 | 3300025945 | Ga0207679_11381680 | Ga0207679_113816802 | 124 |
| 107 | 3300025960 | Ga0207651_10006181 | Ga0207651_100061815 | 124 |
| 108 | 3300025961 | Ga0207712_10009873 | Ga0207712_100098735 | 124 |
| 109 | 3300025972 | Ga0207668_10039309 | Ga0207668_100393091 | 124 |
| 110 | 3300025986 | Ga0207658_10089618 | Ga0207658_100896181 | 124 |
| 111 | 3300026035 | Ga0207703_10000577 | Ga0207703_1000057720 | 124 |
| 112 | 3300026041 | Ga0207639_10121465 | Ga0207639_101214652 | 124 |
| 113 | 3300026067 | Ga0207678_10364254 | Ga0207678_103642542 | 124 |
| 114 | 3300026075 | Ga0207708_10052585 | Ga0207708_100525853 | 124 |
| 115 | 3300026075 | Ga0207708_10627490 | Ga0207708_106274902 | 124 |
| 116 | 3300026078 | Ga0207702_10553829 | Ga0207702_105538292 | 124 |
| 117 | 3300026088 | Ga0207641_10000170 | Ga0207641_100001705 | 124 |
| 118 | 3300026088 | Ga0207641_10005462 | Ga0207641_100054626 | 124 |
| 119 | 3300026095 | Ga0207676_10000025 | Ga0207676_10000025252 | 124 |
| 120 | 3300026118 | Ga0207675_100001319 | Ga0207675_1000013195 | 124 |
| 121 | 3300026142 | Ga0207698_10000041 | Ga0207698_1000004115 | 124 |
| 122 | 3300026142 | Ga0207698_12178989 | Ga0207698_121789891 | 124 |
| 123 | 3300028379 | Ga0268266_10167276 | Ga0268266_101672763 | 124 |
| 124 | 3300028556 | Ga0265337_1000012 | Ga0265337_100001278 | 124 |
| 125 | 3300028558 | Ga0265326_10000007 | Ga0265326_10000007216 | 124 |
| 126 | 3300028563 | Ga0265319_1000028 | Ga0265319_100002867 | 124 |
| 127 | 3300028563 | Ga0265319_1066218 | Ga0265319_10662183 | 124 |
| 128 | 3300028654 | Ga0265322_10000001 | Ga0265322_1000000187 | 124 |
| 129 | 3300028800 | Ga0265338_10000230 | Ga0265338_1000023085 | 124 |
| 130 | 3300029957 | Ga0265324_10001098 | Ga0265324_100010989 | 124 |
| 131 | 3300031238 | Ga0265332_10009620 | Ga0265332_100096206 | 124 |
| 132 | 3300031239 | Ga0265328_10004653 | Ga0265328_100046533 | 124 |
| 133 | 3300031240 | Ga0265320_10000002 | Ga0265320_1000000287 | 124 |
| 134 | 3300031240 | Ga0265320_10205960 | Ga0265320_102059602 | 124 |
| 135 | 3300031241 | Ga0265325_10020561 | Ga0265325_100205616 | 124 |
| 136 | 3300031242 | Ga0265329_10009449 | Ga0265329_100094495 | 124 |
| 137 | 3300031250 | Ga0265331_10003048 | Ga0265331_1000304811 | 124 |
| 138 | 3300031250 | Ga0265331_10030950 | Ga0265331_100309504 | 124 |
| 139 | 3300031251 | Ga0265327_10000011 | Ga0265327_1000001187 | 124 |
| 140 | 3300031595 | Ga0265313_10083897 | Ga0265313_100838973 | 124 |
| 141 | 3300031711 | Ga0265314_10000224 | Ga0265314_100002247 | 124 |
| 142 | 3300031727 | Ga0316576_10014947 | Ga0316576_100149475 | 124 |
| 143 | 3300031733 | Ga0316577_10204252 | Ga0316577_102042522 | 124 |
| 144 | 3300031995 | Ga0307409_100244947 | Ga0307409_1002449472 | 124 |
| 145 | 3300035398 | Ga0316574_0190881 | Ga0316574_0190881_411_788 | 124 |
| 146 | 3300035398 | Ga0316574_0639414 | Ga0316574_0639414_71_460 | 124 |
| 147 | 3300036401 | Ga0373937_0277184 | Ga0373937_0277184_670_1044 | 124 |
| 148 | 3300036712 | Ga0316584_0000992 | Ga0316584_0000992_1814_2191 | 124 |
| 149 | 3300041443 | Ga0451789_0085906 | Ga0451789_0085906_157_534 | 124 |
| 150 | 3300041505 | Ga0451849_1552654 | Ga0451849_1552654_116_493 | 124 |
| 151 | 3300041512 | Ga0451853_0165291 | Ga0451853_0165291_126_503 | 124 |
| 152 | 3300044901 | Ga0466960_0105420 | Ga0466960_0105420_790_1167 | 124 |
| 153 | 3300046455 | Ga0495603_0160438 | Ga0495603_0160438_734_1111 | 124 |
| 154 | 3300046458 | Ga0495591_046165 | Ga0495591_046165_33_410 | 124 |
| 155 | 3300046459 | Ga0495629_0005342 | Ga0495629_0005342_5867_6244 | 124 |
| 156 | 3300046461 | Ga0495641_0027087 | Ga0495641_0027087_2109_2486 | 124 |
| 157 | 3300046461 | Ga0495641_0385493 | Ga0495641_0385493_136_513 | 124 |
| 158 | 3300046462 | Ga0495651_0052514 | Ga0495651_0052514_527_904 | 124 |
| 159 | 3300046462 | Ga0495651_0203904 | Ga0495651_0203904_217_594 | 124 |
| 160 | 3300046463 | Ga0495653_0061469 | Ga0495653_0061469_1152_1529 | 124 |
| 161 | 3300046463 | Ga0495653_0214669 | Ga0495653_0214669_635_1012 | 124 |
| 162 | 3300046477 | Ga0495664_0347546 | Ga0495664_0347546_342_719 | 124 |
| 163 | 3300046492 | Ga0495585_0275671 | Ga0495585_0275671_349_729 | 124 |
| 164 | 3300046511 | Ga0495608_0383449 | Ga0495608_0383449_360_737 | 124 |
| 165 | 3300046511 | Ga0495608_0578400 | Ga0495608_0578400_221_598 | 124 |
| 166 | 3300046515 | Ga0495620_0336408 | Ga0495620_0336408_51_428 | 124 |
| 167 | 3300046517 | Ga0495630_0312202 | Ga0495630_0312202_633_1010 | 124 |
| 168 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_61348_61725 | 124 |
| 169 | 3300046536 | Ga0495587_0005387 | Ga0495587_0005387_6306_6683 | 124 |
| 170 | 3300046536 | Ga0495587_0008634 | Ga0495587_0008634_3146_3523 | 124 |
| 171 | 3300046543 | Ga0495645_0014564 | Ga0495645_0014564_1040_1417 | 124 |
| 172 | 3300046559 | Ga0495667_0000022 | Ga0495667_0000022_171514_171891 | 124 |
| 173 | 3300046559 | Ga0495667_0023628 | Ga0495667_0023628_781_1158 | 124 |
| 174 | 3300046615 | Ga0495656_0000132 | Ga0495656_0000132_16278_16655 | 124 |
| 175 | 3300046642 | Ga0495634_0000212 | Ga0495634_0000212_23660_24037 | 124 |
| 176 | 3300046642 | Ga0495634_0002325 | Ga0495634_0002325_12437_12814 | 124 |
| 177 | 3300046663 | Ga0495635_0384715 | Ga0495635_0384715_167_544 | 124 |
| 178 | 3300046675 | Ga0495657_0021394 | Ga0495657_0021394_793_1167 | 124 |
| 179 | 3300046678 | Ga0495599_0119008 | Ga0495599_0119008_776_1156 | 124 |
| 180 | 3300046679 | Ga0495623_0178574 | Ga0495623_0178574_502_879 | 124 |
| 181 | 3300046689 | Ga0495613_0260850 | Ga0495613_0260850_726_1103 | 124 |
| 182 | 3300047321 | Ga0495676_0002782 | Ga0495676_0002782_10370_10747 | 124 |
| 183 | 3300047322 | Ga0495680_0009767 | Ga0495680_0009767_5029_5406 | 124 |
| 184 | 3300047322 | Ga0495680_0038562 | Ga0495680_0038562_109_486 | 124 |
| 185 | 3300047444 | Ga0495675_0522839 | Ga0495675_0522839_55_435 | 124 |
| 186 | 3300047472 | Ga0495686_0045321 | Ga0495686_0045321_1304_1684 | 124 |
| 187 | 3300048088 | Ga0495602_0166948 | Ga0495602_0166948_983_1360 | 124 |
| 188 | 3300048089 | Ga0495614_0034674 | Ga0495614_0034674_1006_1383 | 124 |
| 189 | 3300048903 | Ga0496100_0000049 | Ga0496100_0000049_60896_61273 | 124 |
| 190 | 3300048904 | Ga0496101_0000010 | Ga0496101_0000010_39287_39664 | 124 |
| 191 | 3300048905 | Ga0496102_0000632 | Ga0496102_0000632_16225_16671 | 124 |
| 192 | 3300048906 | Ga0496103_0000043 | Ga0496103_0000043_128056_128502 | 124 |
| 193 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_615269_615646 | 124 |
| 194 | 3300048907 | Ga0496104_0009920 | Ga0496104_0009920_6603_6980 | 124 |
| 195 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_712533_712910 | 124 |
| 196 | 3300048908 | Ga0496105_0000488 | Ga0496105_0000488_10510_10887 | 124 |
| 197 | 3300048909 | Ga0496106_0000018 | Ga0496106_0000018_33615_33992 | 124 |
| 198 | 3300048909 | Ga0496106_0000286 | Ga0496106_0000286_21279_21656 | 124 |
| 199 | 3300048910 | Ga0496107_0000032 | Ga0496107_0000032_60233_60610 | 124 |
| 200 | 3300048910 | Ga0496107_0398608 | Ga0496107_0398608_116_493 | 124 |
| 201 | 3300048911 | Ga0496108_0000213 | Ga0496108_0000213_46629_47006 | 124 |
| 202 | 3300048912 | Ga0496109_0000021 | Ga0496109_0000021_62164_62541 | 124 |
| 203 | 3300048915 | Ga0496112_1130113 | Ga0496112_1130113_178_555 | 124 |
| 204 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_8414_8791 | 124 |
| 205 | 3300048917 | Ga0496114_0130308 | Ga0496114_0130308_563_940 | 124 |
| 206 | 3300048918 | Ga0496115_0000020 | Ga0496115_0000020_81537_81914 | 124 |
| 207 | 3300048918 | Ga0496115_0001011 | Ga0496115_0001011_7682_8059 | 124 |
| 208 | 3300049571 | Ga0501034_0011242 | Ga0501034_0011242_5219_5611 | 124 |
| 209 | 3300049571 | Ga0501034_0102701 | Ga0501034_0102701_1790_2182 | 124 |
| 210 | 3300049571 | Ga0501034_0411627 | Ga0501034_0411627_405_797 | 124 |
| 211 | 3300049574 | Ga0501038_0127947 | Ga0501038_0127947_1595_1987 | 124 |
| 212 | 3300049581 | Ga0501047_0080839 | Ga0501047_0080839_1265_1657 | 124 |
| 213 | 3300049582 | Ga0501048_0392295 | Ga0501048_0392295_534_917 | 124 |
| 214 | 3300049584 | Ga0501068_0398407 | Ga0501068_0398407_61_438 | 124 |
| 215 | 3300049590 | Ga0501074_0913336 | Ga0501074_0913336_87_464 | 124 |
| 216 | 3300049592 | Ga0501076_0418538 | Ga0501076_0418538_668_1045 | 124 |
| 217 | 3300049742 | Ga0501080_1029749 | Ga0501080_1029749_77_460 | 124 |
| 218 | 3300049823 | Ga0501044_0410606 | Ga0501044_0410606_538_930 | 124 |
| 219 | 3300050491 | nmdc:mga00v17_73485_c1 | nmdc:mga00v17_73485_c1_255_644 | 124 |
| 220 | 3300050491 | nmdc:mga00v17_95419_c1 | nmdc:mga00v17_95419_c1_883_1272 | 124 |
| 221 | 3300050492 | nmdc:mga0yw44_1131478_c1 | nmdc:mga0yw44_1131478_c1_128_517 | 124 |
| 222 | 3300050492 | nmdc:mga0yw44_75252_c1 | nmdc:mga0yw44_75252_c1_44_433 | 124 |
| 223 | 3300050492 | nmdc:mga0yw44_826085_c1 | nmdc:mga0yw44_826085_c1_84_473 | 124 |
| 224 | 3300053077 | Ga0495601_0003669 | Ga0495601_0003669_280_657 | 124 |
| 225 | 3300053077 | Ga0495601_0050811 | Ga0495601_0050811_591_968 | 124 |
| 226 | 3300053077 | Ga0495601_0171897 | Ga0495601_0171897_601_978 | 124 |
| 227 | 3300053078 | Ga0495612_0140970 | Ga0495612_0140970_155_532 | 124 |
| 228 | 3300053083 | Ga0495655_0000011 | Ga0495655_0000011_29137_29514 | 124 |
| 229 | 3300053084 | Ga0495595_0350282 | Ga0495595_0350282_64_438 | 124 |
| 230 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_136633_137010 | 124 |
| 231 | 3300053085 | Ga0495619_0012035 | Ga0495619_0012035_4311_4688 | 124 |
| 232 | 3300053096 | Ga0500641_0005719 | Ga0500641_0005719_542_919 | 124 |
| 233 | 3300053129 | Ga0500628_000032 | Ga0500628_000032_29942_30319 | 124 |
| 234 | 3300061734 | Ga0530510_0576544 | Ga0530510_0576544_23_400 | 124 |
| 235 | 3300046516 | Ga0495628_0000093 | Ga0495628_0000093_11469_11849 | 125 |
| 236 | 3300049586 | Ga0501070_0030764 | Ga0501070_0030764_1865_2347 | 125 |
| 237 | 3300000549 | LJQas_1018453 | LJQas_10184532 | 126 |
| 238 | 3300003659 | JGI25404J52841_10002317 | JGI25404J52841_100023175 | 126 |
| 239 | 3300005841 | Ga0068863_100152865 | Ga0068863_1001528653 | 126 |
| 240 | 3300005843 | Ga0068860_100156096 | Ga0068860_1001560963 | 126 |
| 241 | 3300005983 | Ga0081540_1000006 | Ga0081540_100000633 | 126 |
| 242 | 3300006880 | Ga0075429_101144368 | Ga0075429_1011443682 | 126 |
| 243 | 3300009011 | Ga0105251_10161291 | Ga0105251_101612912 | 126 |
| 244 | 3300014325 | Ga0163163_10322063 | Ga0163163_103220632 | 126 |
| 245 | 3300025931 | Ga0207644_11340994 | Ga0207644_113409941 | 126 |
| 246 | 3300028381 | Ga0268264_10610754 | Ga0268264_106107543 | 126 |
| 247 | 3300046455 | Ga0495603_0001792 | Ga0495603_0001792_8307_8699 | 126 |
| 248 | 3300046499 | Ga0495594_0000013 | Ga0495594_0000013_94892_95278 | 126 |
| 249 | 3300046557 | Ga0495622_0000014 | Ga0495622_0000014_160237_160623 | 126 |
| 250 | 3300047321 | Ga0495676_0300681 | Ga0495676_0300681_561_944 | 126 |
| 251 | 3300048088 | Ga0495602_0000474 | Ga0495602_0000474_17642_18028 | 126 |
| 252 | 3300048905 | Ga0496102_0692327 | Ga0496102_0692327_373_768 | 126 |
| 253 | 3300048906 | Ga0496103_0249820 | Ga0496103_0249820_46_441 | 126 |
| 254 | 3300049583 | Ga0501067_0727675 | Ga0501067_0727675_104_490 | 126 |
| 255 | 3300050508 | nmdc:mga09592_1127513_c1 | nmdc:mga09592_1127513_c1_209_592 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bnz-assembly1.cif.gz_A | crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 | 0.8723 | 4 | 126 |
| 5d7z-assembly1.cif.gz_A | crystal structure of glyoxalase i from zea mays | 0.8696 | 4 | 126 |
| 6bnx-assembly1.cif.gz_A | crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) | 0.8664 | 4 | 126 |
| 4mts-assembly1.cif.gz_B | ni- and zn-bound gloa2 at high resolution | 0.8636 | 2 | 126 |
| 1fa5-assembly1.cif.gz_B | crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli | 0.8605 | 2 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0LFH0_212_347_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8602 | 2 | 125 | 3.10.180.10 |
| af_Q948T6_1_150_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8553 | 1 | 126 | 3.10.180.10 |
| af_Q948T6_1_150_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.849 | 1 | 126 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8485 | 2 | 126 | 3.10.180.10 |
| af_A0A0R0LFH0_212_347_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8418 | 2 | 125 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0X9N2-F1-model_v4 | VOC family protein | 0.9549 | 1 | 66 |
GO:0004462
GO:0046872 |
| AF-A0A7W1ARM9-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 0.9546 | 25 | 126 |
GO:0004462
GO:0005737 GO:0019243 |
| AF-A0A7V9Q1B7-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 0.9508 | 1 | 126 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-A0A7V9G079-F1-model_v4 | Lactoylglutathione lyase | 0.9466 | 1 | 57 |
GO:0004462
GO:0046872 |
| AF-A0A7W1ARM9-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 0.9454 | 25 | 126 |
GO:0004462
GO:0005737 GO:0019243 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar