F365516

General Info

Members Datasets Scaffolds Average Seq Length
255 162 252 122

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10536276|Ga0070685_105362762
Length 112
Sequence MPDMKKTLVMGASDNPQRYSFLAINRLRSKGYPVVAIGKKQVKVGDVDVDTITLYLNSRLQEQYYDYILSLHPKRIIFNPGAENPALERLAKANGIQPMYACTLVLLSTGQY

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
3 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0
Rhizoplane 1.57
Rhizosphere 90.59
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10221438 3300003320 Bacteria 2164
2 rootH1_10063975 3300003323 Bacteria 1792
3 Ga0065712_10191048 3300005290 Unclassified 1132
4 Ga0070676_10313483 3300005328 Bacteria 1067
5 Ga0070683_100013283 3300005329 Bacteria 7178
6 Ga0070690_100023200 3300005330 Bacteria 3805
7 Ga0070670_100096303 3300005331 Bacteria 2546
8 Ga0068869_100141239 3300005334 Bacteria 1859
9 Ga0068869_100261012 3300005334 Bacteria 1387
10 Ga0068869_100583008 3300005334 Bacteria 943
11 Ga0070666_10000031 3300005335 Bacteria 132089
12 Ga0070682_100098462 3300005337 Bacteria 1926
13 Ga0068868_100083280 3300005338 Unclassified 2567
14 Ga0068868_100290795 3300005338 Bacteria 1385
15 Ga0068868_101508395 3300005338 Unclassified 629
16 Ga0070660_101060939 3300005339 Bacteria 685
17 Ga0070661_100069578 3300005344 Bacteria 2588
18 Ga0070668_100619199 3300005347 Bacteria 948
19 Ga0070675_100121173 3300005354 Unclassified 2222
20 Ga0070673_100063551 3300005364 Bacteria 2937
21 Ga0070688_100057329 3300005365 Unclassified 2448
22 Ga0070659_100011285 3300005366 Bacteria 6602
23 Ga0070667_102076876 3300005367 Bacteria 535
24 Ga0070662_100011542 3300005457 Bacteria 5830
25 Ga0070681_10331371 3300005458 Bacteria 1432
26 Ga0068867_100513542 3300005459 Bacteria 1032
27 Ga0070685_10536276 3300005466 Bacteria 833
28 Ga0070679_100030630 3300005530 Bacteria 5313
29 Ga0070684_100023061 3300005535 Bacteria 5198
30 Ga0068853_100994461 3300005539 Bacteria 807
31 Ga0070672_100114268 3300005543 Unclassified 2204
32 Ga0070693_101595842 3300005547 Bacteria 512
33 Ga0070665_100000018 3300005548 Bacteria 434118
34 Ga0068855_100005149 3300005563 Bacteria 15946
35 Ga0068855_100249775 3300005563 Bacteria 1979
36 Ga0070664_100022348 3300005564 Bacteria 5215
37 Ga0068857_100327686 3300005577 Bacteria 1415
38 Ga0068854_100028088 3300005578 Bacteria 3884
39 Ga0068856_100004936 3300005614 Bacteria 13203
40 Ga0068856_100269858 3300005614 Bacteria 1717
41 Ga0068852_100005012 3300005616 Bacteria 9417
42 Ga0068852_100239033 3300005616 Bacteria 1735
43 Ga0068852_100447896 3300005616 Unclassified 1278
44 Ga0068852_100735284 3300005616 Bacteria 998
45 Ga0068852_101218421 3300005616 Bacteria 774
46 Ga0068859_100000045 3300005617 Bacteria 143607
47 Ga0068864_100001485 3300005618 Bacteria 19316
48 Ga0068864_100515499 3300005618 Bacteria 1152
49 Ga0068864_100657100 3300005618 Bacteria 1021
50 Ga0068866_10025998 3300005718 Bacteria 2759
51 Ga0068861_100566994 3300005719 Bacteria 1037
52 Ga0068861_101156214 3300005719 Bacteria 746
53 Ga0068851_10094339 3300005834 Unclassified 1580
54 Ga0068863_100002352 3300005841 Bacteria 18798
55 Ga0068858_100003543 3300005842 Bacteria 15456
56 Ga0068858_100995378 3300005842 Unclassified 821
57 Ga0068860_100000040 3300005843 Bacteria 231652
58 Ga0068860_100003540 3300005843 Bacteria 16061
59 Ga0068860_100006047 3300005843 Bacteria 12183
60 Ga0081540_1007766 3300005983 Bacteria 7592
61 Ga0097621_100021319 3300006237 Bacteria 5010
62 Ga0097621_100096123 3300006237 Bacteria 2486
63 Ga0068871_100005878 3300006358 Bacteria 8627
64 Ga0068865_101284420 3300006881 Bacteria 650
65 Ga0097620_100000045 3300006931 Bacteria 143607
66 Ga0105240_10000472 3300009093 Bacteria 74359
67 Ga0105240_10013039 3300009093 Bacteria 11442
68 Ga0105240_10092434 3300009093 Bacteria 3694
69 Ga0105240_10506507 3300009093 Bacteria 1342
70 Ga0105240_10885513 3300009093 Bacteria 961
71 Ga0105240_11080116 3300009093 Bacteria 855
72 Ga0105240_12653828 3300009093 Unclassified 517
73 Ga0105245_11134427 3300009098 Bacteria 829
74 Ga0105247_10003520 3300009101 Bacteria 10181
75 Ga0105243_10251207 3300009148 Bacteria 1579
76 Ga0105241_10001733 3300009174 Bacteria 16555
77 Ga0105241_10263831 3300009174 Bacteria 1464
78 Ga0105241_11143884 3300009174 Bacteria 735
79 Ga0105242_11363842 3300009176 Bacteria 735
80 Ga0105242_12067804 3300009176 Unclassified 613
81 Ga0105237_10008585 3300009545 Bacteria 11048
82 Ga0105237_10096515 3300009545 Bacteria 2946
83 Ga0105238_10019830 3300009551 Bacteria 6844
84 Ga0105238_10063303 3300009551 Bacteria 3699
85 Ga0105238_10367640 3300009551 Bacteria 1428
86 Ga0105238_13043920 3300009551 Unclassified 503
87 Ga0105249_10010510 3300009553 Bacteria 8134
88 Ga0105239_10131873 3300010375 Bacteria 2780
89 Ga0105239_10761501 3300010375 Bacteria 1108
90 Ga0105239_10909140 3300010375 Bacteria 1010
91 Ga0105239_11505278 3300010375 Bacteria 778
92 Ga0105246_10062556 3300011119 Unclassified 2593
93 Ga0105246_10085037 3300011119 Unclassified 2264
94 Ga0157373_10021884 3300013100 Bacteria 4639
95 Ga0157371_10042633 3300013102 Bacteria 3235
96 Ga0157370_10003783 3300013104 Bacteria 17662
97 Ga0157370_10005237 3300013104 Bacteria 14590
98 Ga0157370_10099470 3300013104 Bacteria 2726
99 Ga0157370_10182903 3300013104 Bacteria 1947
100 Ga0157369_10068481 3300013105 Bacteria 3813
101 Ga0157374_10000025 3300013296 Bacteria 245131
102 Ga0157374_10008153 3300013296 Bacteria 8953
103 Ga0157374_10150194 3300013296 Bacteria 2265
104 Ga0157374_10926866 3300013296 Bacteria 889
105 Ga0157378_10014189 3300013297 Bacteria 6972
106 Ga0157378_10895162 3300013297 Bacteria 918
107 Ga0163162_10001336 3300013306 Bacteria 23007
108 Ga0163162_10004258 3300013306 Bacteria 13763
109 Ga0163162_10315359 3300013306 Bacteria 1696
110 Ga0157372_10057236 3300013307 Bacteria 4357
111 Ga0157375_10075662 3300013308 Bacteria 3392
112 Ga0157375_10732100 3300013308 Bacteria 1141
113 Ga0157375_12422182 3300013308 Unclassified 626
114 Ga0163163_10000344 3300014325 Bacteria 44689
115 Ga0157377_10161127 3300014745 Bacteria 1395
116 Ga0157379_10019251 3300014968 Bacteria 6028
117 Ga0157379_10063027 3300014968 Bacteria 3315
118 Ga0157376_10004535 3300014969 Bacteria 9671
119 Ga0157376_10009304 3300014969 Bacteria 7135
120 Ga0157376_10114088 3300014969 Bacteria 2383
121 Ga0157376_10126831 3300014969 Unclassified 2271
122 Ga0163161_10751219 3300017792 Unclassified 816
123 Ga0207656_10174912 3300025321 Bacteria 1028
124 Ga0207710_10002713 3300025900 Bacteria 8106
125 Ga0207688_10632267 3300025901 Bacteria 675
126 Ga0207680_10000141 3300025903 Bacteria 34433
127 Ga0207647_10127504 3300025904 Bacteria 1497
128 Ga0207705_10040118 3300025909 Bacteria 3357
129 Ga0207654_10003695 3300025911 Bacteria 7718
130 Ga0207654_10101604 3300025911 Bacteria 1773
131 Ga0207654_10256666 3300025911 Bacteria 1174
132 Ga0207654_10405903 3300025911 Bacteria 948
133 Ga0207707_10106740 3300025912 Bacteria 2448
134 Ga0207695_10001688 3300025913 Bacteria 35472
135 Ga0207695_10010041 3300025913 Bacteria 11625
136 Ga0207695_10097974 3300025913 Bacteria 2932
137 Ga0207671_10006437 3300025914 Bacteria 10455
138 Ga0207671_10010346 3300025914 Bacteria 7706
139 Ga0207671_10010377 3300025914 Bacteria 7690
140 Ga0207671_10035525 3300025914 Bacteria 3698
141 Ga0207657_10006852 3300025919 Bacteria 11753
142 Ga0207657_10285048 3300025919 Bacteria 1311
143 Ga0207649_10023098 3300025920 Bacteria 3598
144 Ga0207694_10042125 3300025924 Bacteria 3521
145 Ga0207650_10100267 3300025925 Bacteria 2228
146 Ga0207659_10926190 3300025926 Bacteria 749
147 Ga0207687_10351256 3300025927 Bacteria 1201
148 Ga0207706_10003968 3300025933 Bacteria 14018
149 Ga0207686_10242009 3300025934 Bacteria 1313
150 Ga0207686_10736710 3300025934 Bacteria 786
151 Ga0207704_11422527 3300025938 Bacteria 594
152 Ga0207665_10292450 3300025939 Bacteria 1215
153 Ga0207691_10247517 3300025940 Bacteria 1539
154 Ga0207689_10045780 3300025942 Unclassified 3617
155 Ga0207689_11198847 3300025942 Unclassified 639
156 Ga0207667_10000643 3300025949 Bacteria 45271
157 Ga0207667_10485726 3300025949 Bacteria 1253
158 Ga0207667_10652536 3300025949 Bacteria 1058
159 Ga0207651_10263887 3300025960 Bacteria 1415
160 Ga0207712_10017452 3300025961 Bacteria 4661
161 Ga0207668_10137801 3300025972 Bacteria 1872
162 Ga0207640_10049547 3300025981 Bacteria 2720
163 Ga0207640_10408056 3300025981 Bacteria 1108
164 Ga0207677_10200372 3300026023 Bacteria 1586
165 Ga0207677_10323139 3300026023 Bacteria 1283
166 Ga0207677_10506186 3300026023 Unclassified 1045
167 Ga0207703_10009315 3300026035 Bacteria 7717
168 Ga0207703_10862848 3300026035 Unclassified 866
169 Ga0207703_11572152 3300026035 Bacteria 633
170 Ga0207639_10358685 3300026041 Bacteria 1304
171 Ga0207639_11857328 3300026041 Bacteria 563
172 Ga0207641_10000146 3300026088 Bacteria 100666
173 Ga0207648_10256972 3300026089 Unclassified 1558
174 Ga0207676_10005018 3300026095 Bacteria 9372
175 Ga0207676_10625701 3300026095 Bacteria 1036
176 Ga0207676_11396566 3300026095 Bacteria 696
177 Ga0207674_10001630 3300026116 Bacteria 28871
178 Ga0207674_10554084 3300026116 Bacteria 1111
179 Ga0207698_10002117 3300026142 Bacteria 11709
180 Ga0207698_10003512 3300026142 Bacteria 9452
181 Ga0207698_10354251 3300026142 Bacteria 1387
182 Ga0207698_10444032 3300026142 Bacteria 1251
183 Ga0207698_11791874 3300026142 Bacteria 629
184 Ga0268266_10000026 3300028379 Bacteria 434485
185 Ga0268264_10000015 3300028381 Bacteria 508501
186 Ga0268264_10000019 3300028381 Bacteria 488112
187 Ga0268264_10000054 3300028381 Bacteria 317048
188 Ga0268264_10004101 3300028381 Bacteria 12463
189 Ga0268264_10006744 3300028381 Bacteria 9649
190 Ga0307511_10000228 3300030521 Bacteria 57237
191 Ga0307511_10366486 3300030521 Bacteria 610
192 Ga0265327_10000026 3300031251 Bacteria 379288
193 Ga0265327_10000285 3300031251 Bacteria 99746
194 Ga0307513_10280712 3300031456 Bacteria 1443
195 Ga0307508_10001024 3300031616 Bacteria 32462
196 Ga0307405_10038088 3300031731 Bacteria 2895
197 Ga0307412_10239631 3300031911 Unclassified 1402
198 Ga0373931_0522601 3300035691 Bacteria 768
199 Ga0395905_0261399 3300037471 Bacteria 1616
200 Ga0451791_1406598 3300041451 Bacteria 784
201 Ga0451849_1196652 3300041505 Bacteria 1145
202 Ga0451577_1049000 3300042876 Bacteria 731
203 Ga0466972_0003735 3300044658 Bacteria 7571
204 Ga0453684_0074410 3300044712 Bacteria 4277
205 Ga0453684_0461433 3300044712 Bacteria 1412
206 Ga0453684_1462000 3300044712 Unclassified 706
207 Ga0466971_0228500 3300044719 Bacteria 883
208 Ga0466957_0007963 3300044842 Bacteria 6012
209 Ga0466957_0168992 3300044842 Bacteria 1424
210 Ga0466967_0274282 3300045976 Bacteria 1617
211 Ga0495638_0040133 3300046460 Bacteria 2967
212 Ga0495607_0145738 3300046501 Bacteria 1217
213 Ga0495643_0173190 3300046522 Bacteria 1054
214 Ga0495648_0005665 3300046524 Bacteria 10334
215 Ga0495668_0000453 3300046616 Bacteria 52477
216 Ga0495649_0099468 3300046694 Bacteria 1547
217 Ga0495672_0261736 3300047320 Bacteria 834
218 Ga0495687_000031 3300047443 Bacteria 274659
219 Ga0495686_0000005 3300047472 Bacteria 827143
220 Ga0496114_0024177 3300048917 Bacteria 4958
221 Ga0496115_0010906 3300048918 Bacteria 6803
222 Ga0496115_0146948 3300048918 Unclassified 1946
223 Ga0501031_0005353 3300049568 Bacteria 8357
224 Ga0501032_0070726 3300049569 Bacteria 2327
225 Ga0501034_0014124 3300049571 Bacteria 8229
226 Ga0501034_0019703 3300049571 Bacteria 6896
227 Ga0501034_0080730 3300049571 Bacteria 3255
228 Ga0501037_0024253 3300049573 Bacteria 4486
229 Ga0501038_0987624 3300049574 Bacteria 618
230 Ga0501038_1297918 3300049574 Unclassified 526
231 Ga0501039_0058059 3300049575 Bacteria 2996
232 Ga0501043_0233935 3300049579 Bacteria 1418
233 Ga0501070_0688928 3300049586 Bacteria 809
234 Ga0501219_000159 3300049703 Bacteria 12350
235 Ga0501035_0011438 3300049822 Bacteria 8229
236 Ga0501035_0836975 3300049822 Unclassified 733
237 Ga0501044_0010826 3300049823 Bacteria 9896
238 Ga0501044_0016090 3300049823 Bacteria 8041
239 Ga0501044_0019756 3300049823 Bacteria 7198
240 Ga0501284_00018 3300050005 Bacteria 93729
241 Ga0500644_0174445 3300053088 Bacteria 876
242 Ga0500646_0187549 3300053090 Bacteria 704
243 Ga0500583_0005259 3300053092 Bacteria 4319
244 Ga0500562_000005 3300053108 Bacteria 266746
245 Ga0500621_271474 3300053126 Bacteria 558
246 Ga0500642_0355045 3300053130 Bacteria 649
247 Ga0500568_0018806 3300053139 Bacteria 3014
248 Ga0500616_0000698 3300053153 Bacteria 39124
249 Ga0500622_0000835 3300053156 Bacteria 26334
250 Ga0500622_0006293 3300053156 Bacteria 6930
251 Ga0500645_009246 3300053730 Bacteria 3318
252 Ga0500645_024492 3300053730 Bacteria 1845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005466 Ga0070685_10536276 Ga0070685_105362762 108
2 3300042876 Ga0451577_1049000 Ga0451577_1049000_89_433 113
3 3300044712 Ga0453684_0074410 Ga0453684_0074410_75_419 113
4 3300005578 Ga0068854_100028088 Ga0068854_1000280884 115
5 3300025919 Ga0207657_10006852 Ga0207657_100068522 115
6 3300025981 Ga0207640_10049547 Ga0207640_100495472 115
7 iso_pu_bacteria 2739367866 2740032834 117
8 iso_pu_bacteria 2881955468 2881955792 117
9 3300003320 rootH2_10221438 rootH2_102214383 118
10 3300003323 rootH1_10063975 rootH1_100639751 118
11 3300005290 Ga0065712_10191048 Ga0065712_101910481 118
12 3300005328 Ga0070676_10313483 Ga0070676_103134832 118
13 3300005329 Ga0070683_100013283 Ga0070683_1000132834 118
14 3300005330 Ga0070690_100023200 Ga0070690_1000232002 118
15 3300005331 Ga0070670_100096303 Ga0070670_1000963033 118
16 3300005334 Ga0068869_100141239 Ga0068869_1001412391 118
17 3300005334 Ga0068869_100261012 Ga0068869_1002610122 118
18 3300005334 Ga0068869_100583008 Ga0068869_1005830082 118
19 3300005335 Ga0070666_10000031 Ga0070666_1000003148 118
20 3300005337 Ga0070682_100098462 Ga0070682_1000984622 118
21 3300005338 Ga0068868_100083280 Ga0068868_1000832804 118
22 3300005338 Ga0068868_100290795 Ga0068868_1002907952 118
23 3300005338 Ga0068868_101508395 Ga0068868_1015083951 118
24 3300005339 Ga0070660_101060939 Ga0070660_1010609391 118
25 3300005344 Ga0070661_100069578 Ga0070661_1000695783 118
26 3300005347 Ga0070668_100619199 Ga0070668_1006191991 118
27 3300005354 Ga0070675_100121173 Ga0070675_1001211733 118
28 3300005364 Ga0070673_100063551 Ga0070673_1000635514 118
29 3300005365 Ga0070688_100057329 Ga0070688_1000573293 118
30 3300005366 Ga0070659_100011285 Ga0070659_1000112853 118
31 3300005367 Ga0070667_102076876 Ga0070667_1020768761 118
32 3300005457 Ga0070662_100011542 Ga0070662_1000115423 118
33 3300005458 Ga0070681_10331371 Ga0070681_103313711 118
34 3300005459 Ga0068867_100513542 Ga0068867_1005135422 118
35 3300005530 Ga0070679_100030630 Ga0070679_1000306302 118
36 3300005535 Ga0070684_100023061 Ga0070684_1000230614 118
37 3300005539 Ga0068853_100994461 Ga0068853_1009944612 118
38 3300005543 Ga0070672_100114268 Ga0070672_1001142681 118
39 3300005547 Ga0070693_101595842 Ga0070693_1015958421 118
40 3300005548 Ga0070665_100000018 Ga0070665_100000018156 118
41 3300005563 Ga0068855_100005149 Ga0068855_10000514914 118
42 3300005563 Ga0068855_100249775 Ga0068855_1002497752 118
43 3300005564 Ga0070664_100022348 Ga0070664_1000223482 118
44 3300005577 Ga0068857_100327686 Ga0068857_1003276863 118
45 3300005614 Ga0068856_100004936 Ga0068856_1000049366 118
46 3300005614 Ga0068856_100269858 Ga0068856_1002698582 118
47 3300005616 Ga0068852_100005012 Ga0068852_1000050129 118
48 3300005616 Ga0068852_100239033 Ga0068852_1002390333 118
49 3300005616 Ga0068852_100447896 Ga0068852_1004478962 118
50 3300005616 Ga0068852_100735284 Ga0068852_1007352841 118
51 3300005616 Ga0068852_101218421 Ga0068852_1012184211 118
52 3300005617 Ga0068859_100000045 Ga0068859_10000004592 118
53 3300005618 Ga0068864_100001485 Ga0068864_1000014858 118
54 3300005618 Ga0068864_100515499 Ga0068864_1005154992 118
55 3300005618 Ga0068864_100657100 Ga0068864_1006571002 118
56 3300005718 Ga0068866_10025998 Ga0068866_100259985 118
57 3300005719 Ga0068861_100566994 Ga0068861_1005669941 118
58 3300005719 Ga0068861_101156214 Ga0068861_1011562141 118
59 3300005834 Ga0068851_10094339 Ga0068851_100943392 118
60 3300005841 Ga0068863_100002352 Ga0068863_1000023527 118
61 3300005842 Ga0068858_100003543 Ga0068858_10000354313 118
62 3300005842 Ga0068858_100995378 Ga0068858_1009953781 118
63 3300005843 Ga0068860_100000040 Ga0068860_100000040180 118
64 3300005843 Ga0068860_100003540 Ga0068860_10000354011 118
65 3300005843 Ga0068860_100006047 Ga0068860_1000060475 118
66 3300005983 Ga0081540_1007766 Ga0081540_10077662 118
67 3300006237 Ga0097621_100021319 Ga0097621_1000213193 118
68 3300006237 Ga0097621_100096123 Ga0097621_1000961233 118
69 3300006358 Ga0068871_100005878 Ga0068871_1000058783 118
70 3300006881 Ga0068865_101284420 Ga0068865_1012844201 118
71 3300006931 Ga0097620_100000045 Ga0097620_10000004548 118
72 3300009093 Ga0105240_10000472 Ga0105240_1000047213 118
73 3300009093 Ga0105240_10013039 Ga0105240_1001303910 118
74 3300009093 Ga0105240_10092434 Ga0105240_100924343 118
75 3300009093 Ga0105240_10506507 Ga0105240_105065072 118
76 3300009093 Ga0105240_10885513 Ga0105240_108855131 118
77 3300009093 Ga0105240_11080116 Ga0105240_110801161 118
78 3300009093 Ga0105240_12653828 Ga0105240_126538281 118
79 3300009098 Ga0105245_11134427 Ga0105245_111344272 118
80 3300009101 Ga0105247_10003520 Ga0105247_100035203 118
81 3300009148 Ga0105243_10251207 Ga0105243_102512071 118
82 3300009174 Ga0105241_10001733 Ga0105241_1000173311 118
83 3300009174 Ga0105241_10263831 Ga0105241_102638312 118
84 3300009174 Ga0105241_11143884 Ga0105241_111438841 118
85 3300009176 Ga0105242_11363842 Ga0105242_113638422 118
86 3300009176 Ga0105242_12067804 Ga0105242_120678042 118
87 3300009545 Ga0105237_10008585 Ga0105237_100085858 118
88 3300009545 Ga0105237_10096515 Ga0105237_100965154 118
89 3300009551 Ga0105238_10019830 Ga0105238_100198305 118
90 3300009551 Ga0105238_10063303 Ga0105238_100633033 118
91 3300009551 Ga0105238_10367640 Ga0105238_103676402 118
92 3300009551 Ga0105238_13043920 Ga0105238_130439201 118
93 3300009553 Ga0105249_10010510 Ga0105249_100105105 118
94 3300010375 Ga0105239_10131873 Ga0105239_101318733 118
95 3300010375 Ga0105239_10761501 Ga0105239_107615012 118
96 3300010375 Ga0105239_10909140 Ga0105239_109091401 118
97 3300010375 Ga0105239_11505278 Ga0105239_115052782 118
98 3300011119 Ga0105246_10062556 Ga0105246_100625562 118
99 3300011119 Ga0105246_10085037 Ga0105246_100850373 118
100 3300013100 Ga0157373_10021884 Ga0157373_100218844 118
101 3300013102 Ga0157371_10042633 Ga0157371_100426331 118
102 3300013104 Ga0157370_10003783 Ga0157370_100037833 118
103 3300013104 Ga0157370_10005237 Ga0157370_100052379 118
104 3300013104 Ga0157370_10099470 Ga0157370_100994703 118
105 3300013104 Ga0157370_10182903 Ga0157370_101829033 118
106 3300013105 Ga0157369_10068481 Ga0157369_100684812 118
107 3300013296 Ga0157374_10000025 Ga0157374_1000002592 118
108 3300013296 Ga0157374_10008153 Ga0157374_100081534 118
109 3300013296 Ga0157374_10150194 Ga0157374_101501943 118
110 3300013296 Ga0157374_10926866 Ga0157374_109268662 118
111 3300013297 Ga0157378_10014189 Ga0157378_100141892 118
112 3300013297 Ga0157378_10895162 Ga0157378_108951622 118
113 3300013306 Ga0163162_10001336 Ga0163162_1000133613 118
114 3300013306 Ga0163162_10004258 Ga0163162_100042583 118
115 3300013306 Ga0163162_10315359 Ga0163162_103153592 118
116 3300013307 Ga0157372_10057236 Ga0157372_100572363 118
117 3300013308 Ga0157375_10075662 Ga0157375_100756622 118
118 3300013308 Ga0157375_10732100 Ga0157375_107321002 118
119 3300013308 Ga0157375_12422182 Ga0157375_124221821 118
120 3300014325 Ga0163163_10000344 Ga0163163_1000034440 118
121 3300014745 Ga0157377_10161127 Ga0157377_101611272 118
122 3300014968 Ga0157379_10019251 Ga0157379_100192515 118
123 3300014968 Ga0157379_10063027 Ga0157379_100630273 118
124 3300014969 Ga0157376_10004535 Ga0157376_100045356 118
125 3300014969 Ga0157376_10009304 Ga0157376_100093045 118
126 3300014969 Ga0157376_10114088 Ga0157376_101140883 118
127 3300014969 Ga0157376_10126831 Ga0157376_101268312 118
128 3300017792 Ga0163161_10751219 Ga0163161_107512191 118
129 3300025321 Ga0207656_10174912 Ga0207656_101749121 118
130 3300025900 Ga0207710_10002713 Ga0207710_100027139 118
131 3300025901 Ga0207688_10632267 Ga0207688_106322671 118
132 3300025903 Ga0207680_10000141 Ga0207680_1000014119 118
133 3300025904 Ga0207647_10127504 Ga0207647_101275042 118
134 3300025909 Ga0207705_10040118 Ga0207705_100401182 118
135 3300025911 Ga0207654_10003695 Ga0207654_100036959 118
136 3300025911 Ga0207654_10101604 Ga0207654_101016042 118
137 3300025911 Ga0207654_10256666 Ga0207654_102566662 118
138 3300025911 Ga0207654_10405903 Ga0207654_104059032 118
139 3300025912 Ga0207707_10106740 Ga0207707_101067401 118
140 3300025913 Ga0207695_10001688 Ga0207695_1000168820 118
141 3300025913 Ga0207695_10010041 Ga0207695_100100417 118
142 3300025913 Ga0207695_10097974 Ga0207695_100979743 118
143 3300025914 Ga0207671_10006437 Ga0207671_100064378 118
144 3300025914 Ga0207671_10010346 Ga0207671_100103464 118
145 3300025914 Ga0207671_10010377 Ga0207671_100103772 118
146 3300025914 Ga0207671_10035525 Ga0207671_100355254 118
147 3300025919 Ga0207657_10285048 Ga0207657_102850482 118
148 3300025920 Ga0207649_10023098 Ga0207649_100230981 118
149 3300025924 Ga0207694_10042125 Ga0207694_100421253 118
150 3300025925 Ga0207650_10100267 Ga0207650_101002673 118
151 3300025926 Ga0207659_10926190 Ga0207659_109261901 118
152 3300025927 Ga0207687_10351256 Ga0207687_103512562 118
153 3300025933 Ga0207706_10003968 Ga0207706_100039688 118
154 3300025934 Ga0207686_10242009 Ga0207686_102420092 118
155 3300025934 Ga0207686_10736710 Ga0207686_107367102 118
156 3300025938 Ga0207704_11422527 Ga0207704_114225271 118
157 3300025939 Ga0207665_10292450 Ga0207665_102924502 118
158 3300025940 Ga0207691_10247517 Ga0207691_102475173 118
159 3300025942 Ga0207689_10045780 Ga0207689_100457802 118
160 3300025942 Ga0207689_11198847 Ga0207689_111988471 118
161 3300025949 Ga0207667_10000643 Ga0207667_1000064321 118
162 3300025949 Ga0207667_10485726 Ga0207667_104857261 118
163 3300025949 Ga0207667_10652536 Ga0207667_106525362 118
164 3300025960 Ga0207651_10263887 Ga0207651_102638872 118
165 3300025961 Ga0207712_10017452 Ga0207712_100174522 118
166 3300025972 Ga0207668_10137801 Ga0207668_101378013 118
167 3300025981 Ga0207640_10408056 Ga0207640_104080562 118
168 3300026023 Ga0207677_10200372 Ga0207677_102003723 118
169 3300026023 Ga0207677_10323139 Ga0207677_103231392 118
170 3300026023 Ga0207677_10506186 Ga0207677_105061862 118
171 3300026035 Ga0207703_10009315 Ga0207703_100093157 118
172 3300026035 Ga0207703_10862848 Ga0207703_108628481 118
173 3300026035 Ga0207703_11572152 Ga0207703_115721522 118
174 3300026041 Ga0207639_10358685 Ga0207639_103586852 118
175 3300026041 Ga0207639_11857328 Ga0207639_118573281 118
176 3300026088 Ga0207641_10000146 Ga0207641_1000014685 118
177 3300026089 Ga0207648_10256972 Ga0207648_102569723 118
178 3300026095 Ga0207676_10005018 Ga0207676_100050183 118
179 3300026095 Ga0207676_10625701 Ga0207676_106257011 118
180 3300026095 Ga0207676_11396566 Ga0207676_113965661 118
181 3300026116 Ga0207674_10001630 Ga0207674_1000163020 118
182 3300026116 Ga0207674_10554084 Ga0207674_105540841 118
183 3300026142 Ga0207698_10002117 Ga0207698_100021171 118
184 3300026142 Ga0207698_10003512 Ga0207698_100035123 118
185 3300026142 Ga0207698_10354251 Ga0207698_103542512 118
186 3300026142 Ga0207698_10444032 Ga0207698_104440322 118
187 3300026142 Ga0207698_11791874 Ga0207698_117918741 118
188 3300028379 Ga0268266_10000026 Ga0268266_10000026205 118
189 3300028381 Ga0268264_10000015 Ga0268264_10000015103 118
190 3300028381 Ga0268264_10000019 Ga0268264_10000019200 118
191 3300028381 Ga0268264_10000054 Ga0268264_10000054170 118
192 3300028381 Ga0268264_10004101 Ga0268264_100041015 118
193 3300028381 Ga0268264_10006744 Ga0268264_100067446 118
194 3300030521 Ga0307511_10000228 Ga0307511_100002287 118
195 3300030521 Ga0307511_10366486 Ga0307511_103664862 118
196 3300031251 Ga0265327_10000026 Ga0265327_1000002689 118
197 3300031251 Ga0265327_10000285 Ga0265327_1000028550 118
198 3300031456 Ga0307513_10280712 Ga0307513_102807123 118
199 3300031616 Ga0307508_10001024 Ga0307508_1000102417 118
200 3300031731 Ga0307405_10038088 Ga0307405_100380882 118
201 3300031911 Ga0307412_10239631 Ga0307412_102396313 118
202 3300035691 Ga0373931_0522601 Ga0373931_0522601_306_677 118
203 3300037471 Ga0395905_0261399 Ga0395905_0261399_604_960 118
204 3300041451 Ga0451791_1406598 Ga0451791_1406598_310_681 118
205 3300041505 Ga0451849_1196652 Ga0451849_1196652_86_457 118
206 3300044658 Ga0466972_0003735 Ga0466972_0003735_3178_3549 118
207 3300044712 Ga0453684_0461433 Ga0453684_0461433_689_1057 118
208 3300044712 Ga0453684_1462000 Ga0453684_1462000_227_586 118
209 3300044719 Ga0466971_0228500 Ga0466971_0228500_98_466 118
210 3300044842 Ga0466957_0007963 Ga0466957_0007963_4246_4722 118
211 3300044842 Ga0466957_0168992 Ga0466957_0168992_110_478 118
212 3300045976 Ga0466967_0274282 Ga0466967_0274282_204_575 118
213 3300046460 Ga0495638_0040133 Ga0495638_0040133_2425_2784 118
214 3300046501 Ga0495607_0145738 Ga0495607_0145738_603_962 118
215 3300046522 Ga0495643_0173190 Ga0495643_0173190_557_928 118
216 3300046524 Ga0495648_0005665 Ga0495648_0005665_8889_9248 118
217 3300046616 Ga0495668_0000453 Ga0495668_0000453_34231_34596 118
218 3300046694 Ga0495649_0099468 Ga0495649_0099468_1012_1386 118
219 3300047320 Ga0495672_0261736 Ga0495672_0261736_414_785 118
220 3300047443 Ga0495687_000031 Ga0495687_000031_136184_136555 118
221 3300047472 Ga0495686_0000005 Ga0495686_0000005_12692_13063 118
222 3300048917 Ga0496114_0024177 Ga0496114_0024177_1135_1497 118
223 3300048918 Ga0496115_0010906 Ga0496115_0010906_4934_5293 118
224 3300048918 Ga0496115_0146948 Ga0496115_0146948_1528_1902 118
225 3300049568 Ga0501031_0005353 Ga0501031_0005353_6265_6633 118
226 3300049569 Ga0501032_0070726 Ga0501032_0070726_1517_1885 118
227 3300049571 Ga0501034_0014124 Ga0501034_0014124_2724_3083 118
228 3300049571 Ga0501034_0019703 Ga0501034_0019703_5984_6343 118
229 3300049571 Ga0501034_0080730 Ga0501034_0080730_1824_2192 118
230 3300049573 Ga0501037_0024253 Ga0501037_0024253_2528_2896 118
231 3300049574 Ga0501038_0987624 Ga0501038_0987624_45_413 118
232 3300049574 Ga0501038_1297918 Ga0501038_1297918_25_384 118
233 3300049575 Ga0501039_0058059 Ga0501039_0058059_1644_2012 118
234 3300049579 Ga0501043_0233935 Ga0501043_0233935_1024_1392 118
235 3300049586 Ga0501070_0688928 Ga0501070_0688928_150_509 118
236 3300049703 Ga0501219_000159 Ga0501219_000159_8574_8942 118
237 3300049822 Ga0501035_0011438 Ga0501035_0011438_521_889 118
238 3300049822 Ga0501035_0836975 Ga0501035_0836975_106_465 118
239 3300049823 Ga0501044_0010826 Ga0501044_0010826_7732_8091 118
240 3300049823 Ga0501044_0016090 Ga0501044_0016090_2912_3271 118
241 3300049823 Ga0501044_0019756 Ga0501044_0019756_2366_2734 118
242 3300050005 Ga0501284_00018 Ga0501284_00018_64514_64882 118
243 3300053088 Ga0500644_0174445 Ga0500644_0174445_486_845 118
244 3300053090 Ga0500646_0187549 Ga0500646_0187549_122_481 118
245 3300053092 Ga0500583_0005259 Ga0500583_0005259_2615_2974 118
246 3300053108 Ga0500562_000005 Ga0500562_000005_34984_35352 118
247 3300053126 Ga0500621_271474 Ga0500621_271474_136_495 118
248 3300053130 Ga0500642_0355045 Ga0500642_0355045_31_390 118
249 3300053139 Ga0500568_0018806 Ga0500568_0018806_1820_2191 118
250 3300053153 Ga0500616_0000698 Ga0500616_0000698_13614_13979 118
251 3300053156 Ga0500622_0000835 Ga0500622_0000835_21082_21447 118
252 3300053156 Ga0500622_0006293 Ga0500622_0006293_1617_1976 118
253 3300053730 Ga0500645_009246 Ga0500645_009246_243_611 118
254 3300053730 Ga0500645_024492 Ga0500645_024492_1386_1754 118
255 iso_pu_bacteria 2883068021 2883070686 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

5

108

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9813 2 118
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.965 2 118
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.8819 2 118
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.8805 3 115
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.8685 2 118
ID Description Score Start End Superfamily
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.981 2 118 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9567 2 118 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8819 2 118 3.40.50.720
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8808 2 36 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8685 2 118 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A354D9Z0-F1-model_v4 deleted 1.003 2 118
AF-A0A2D7VQK0-F1-model_v4 CoA-binding protein 1.003 2 118
AF-A0A4R1HVA8-F1-model_v4 deleted 1.002 2 118
AF-A0A6I3LY05-F1-model_v4 CoA-binding protein 1.002 2 118
AF-A0A4Y4AYS0-F1-model_v4 CoA-binding protein 1.002 2 118

Feature Viewer

pLDDT pTM Quality
97.81 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map