F365516
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 162 | 252 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300005466|Ga0070685_10536276|Ga0070685_105362762 |
| Length | 112 |
| Sequence | MPDMKKTLVMGASDNPQRYSFLAINRLRSKGYPVVAIGKKQVKVGDVDVDTITLYLNSRLQEQYYDYILSLHPKRIIFNPGAENPALERLAKANGIQPMYACTLVLLSTGQY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 2 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 3 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 117 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 124 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 125 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 140 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 141 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 150 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 153 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 154 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 155 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 156 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 157 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 158 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 161 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 162 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.82 |
| Metatranscriptomes | 0 |
| Isolates | 1.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.71 |
| Nodule | 0 |
| Rhizoplane | 1.57 |
| Rhizosphere | 90.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10221438 | 3300003320 | Bacteria | 2164 |
| 2 | rootH1_10063975 | 3300003323 | Bacteria | 1792 |
| 3 | Ga0065712_10191048 | 3300005290 | Unclassified | 1132 |
| 4 | Ga0070676_10313483 | 3300005328 | Bacteria | 1067 |
| 5 | Ga0070683_100013283 | 3300005329 | Bacteria | 7178 |
| 6 | Ga0070690_100023200 | 3300005330 | Bacteria | 3805 |
| 7 | Ga0070670_100096303 | 3300005331 | Bacteria | 2546 |
| 8 | Ga0068869_100141239 | 3300005334 | Bacteria | 1859 |
| 9 | Ga0068869_100261012 | 3300005334 | Bacteria | 1387 |
| 10 | Ga0068869_100583008 | 3300005334 | Bacteria | 943 |
| 11 | Ga0070666_10000031 | 3300005335 | Bacteria | 132089 |
| 12 | Ga0070682_100098462 | 3300005337 | Bacteria | 1926 |
| 13 | Ga0068868_100083280 | 3300005338 | Unclassified | 2567 |
| 14 | Ga0068868_100290795 | 3300005338 | Bacteria | 1385 |
| 15 | Ga0068868_101508395 | 3300005338 | Unclassified | 629 |
| 16 | Ga0070660_101060939 | 3300005339 | Bacteria | 685 |
| 17 | Ga0070661_100069578 | 3300005344 | Bacteria | 2588 |
| 18 | Ga0070668_100619199 | 3300005347 | Bacteria | 948 |
| 19 | Ga0070675_100121173 | 3300005354 | Unclassified | 2222 |
| 20 | Ga0070673_100063551 | 3300005364 | Bacteria | 2937 |
| 21 | Ga0070688_100057329 | 3300005365 | Unclassified | 2448 |
| 22 | Ga0070659_100011285 | 3300005366 | Bacteria | 6602 |
| 23 | Ga0070667_102076876 | 3300005367 | Bacteria | 535 |
| 24 | Ga0070662_100011542 | 3300005457 | Bacteria | 5830 |
| 25 | Ga0070681_10331371 | 3300005458 | Bacteria | 1432 |
| 26 | Ga0068867_100513542 | 3300005459 | Bacteria | 1032 |
| 27 | Ga0070685_10536276 | 3300005466 | Bacteria | 833 |
| 28 | Ga0070679_100030630 | 3300005530 | Bacteria | 5313 |
| 29 | Ga0070684_100023061 | 3300005535 | Bacteria | 5198 |
| 30 | Ga0068853_100994461 | 3300005539 | Bacteria | 807 |
| 31 | Ga0070672_100114268 | 3300005543 | Unclassified | 2204 |
| 32 | Ga0070693_101595842 | 3300005547 | Bacteria | 512 |
| 33 | Ga0070665_100000018 | 3300005548 | Bacteria | 434118 |
| 34 | Ga0068855_100005149 | 3300005563 | Bacteria | 15946 |
| 35 | Ga0068855_100249775 | 3300005563 | Bacteria | 1979 |
| 36 | Ga0070664_100022348 | 3300005564 | Bacteria | 5215 |
| 37 | Ga0068857_100327686 | 3300005577 | Bacteria | 1415 |
| 38 | Ga0068854_100028088 | 3300005578 | Bacteria | 3884 |
| 39 | Ga0068856_100004936 | 3300005614 | Bacteria | 13203 |
| 40 | Ga0068856_100269858 | 3300005614 | Bacteria | 1717 |
| 41 | Ga0068852_100005012 | 3300005616 | Bacteria | 9417 |
| 42 | Ga0068852_100239033 | 3300005616 | Bacteria | 1735 |
| 43 | Ga0068852_100447896 | 3300005616 | Unclassified | 1278 |
| 44 | Ga0068852_100735284 | 3300005616 | Bacteria | 998 |
| 45 | Ga0068852_101218421 | 3300005616 | Bacteria | 774 |
| 46 | Ga0068859_100000045 | 3300005617 | Bacteria | 143607 |
| 47 | Ga0068864_100001485 | 3300005618 | Bacteria | 19316 |
| 48 | Ga0068864_100515499 | 3300005618 | Bacteria | 1152 |
| 49 | Ga0068864_100657100 | 3300005618 | Bacteria | 1021 |
| 50 | Ga0068866_10025998 | 3300005718 | Bacteria | 2759 |
| 51 | Ga0068861_100566994 | 3300005719 | Bacteria | 1037 |
| 52 | Ga0068861_101156214 | 3300005719 | Bacteria | 746 |
| 53 | Ga0068851_10094339 | 3300005834 | Unclassified | 1580 |
| 54 | Ga0068863_100002352 | 3300005841 | Bacteria | 18798 |
| 55 | Ga0068858_100003543 | 3300005842 | Bacteria | 15456 |
| 56 | Ga0068858_100995378 | 3300005842 | Unclassified | 821 |
| 57 | Ga0068860_100000040 | 3300005843 | Bacteria | 231652 |
| 58 | Ga0068860_100003540 | 3300005843 | Bacteria | 16061 |
| 59 | Ga0068860_100006047 | 3300005843 | Bacteria | 12183 |
| 60 | Ga0081540_1007766 | 3300005983 | Bacteria | 7592 |
| 61 | Ga0097621_100021319 | 3300006237 | Bacteria | 5010 |
| 62 | Ga0097621_100096123 | 3300006237 | Bacteria | 2486 |
| 63 | Ga0068871_100005878 | 3300006358 | Bacteria | 8627 |
| 64 | Ga0068865_101284420 | 3300006881 | Bacteria | 650 |
| 65 | Ga0097620_100000045 | 3300006931 | Bacteria | 143607 |
| 66 | Ga0105240_10000472 | 3300009093 | Bacteria | 74359 |
| 67 | Ga0105240_10013039 | 3300009093 | Bacteria | 11442 |
| 68 | Ga0105240_10092434 | 3300009093 | Bacteria | 3694 |
| 69 | Ga0105240_10506507 | 3300009093 | Bacteria | 1342 |
| 70 | Ga0105240_10885513 | 3300009093 | Bacteria | 961 |
| 71 | Ga0105240_11080116 | 3300009093 | Bacteria | 855 |
| 72 | Ga0105240_12653828 | 3300009093 | Unclassified | 517 |
| 73 | Ga0105245_11134427 | 3300009098 | Bacteria | 829 |
| 74 | Ga0105247_10003520 | 3300009101 | Bacteria | 10181 |
| 75 | Ga0105243_10251207 | 3300009148 | Bacteria | 1579 |
| 76 | Ga0105241_10001733 | 3300009174 | Bacteria | 16555 |
| 77 | Ga0105241_10263831 | 3300009174 | Bacteria | 1464 |
| 78 | Ga0105241_11143884 | 3300009174 | Bacteria | 735 |
| 79 | Ga0105242_11363842 | 3300009176 | Bacteria | 735 |
| 80 | Ga0105242_12067804 | 3300009176 | Unclassified | 613 |
| 81 | Ga0105237_10008585 | 3300009545 | Bacteria | 11048 |
| 82 | Ga0105237_10096515 | 3300009545 | Bacteria | 2946 |
| 83 | Ga0105238_10019830 | 3300009551 | Bacteria | 6844 |
| 84 | Ga0105238_10063303 | 3300009551 | Bacteria | 3699 |
| 85 | Ga0105238_10367640 | 3300009551 | Bacteria | 1428 |
| 86 | Ga0105238_13043920 | 3300009551 | Unclassified | 503 |
| 87 | Ga0105249_10010510 | 3300009553 | Bacteria | 8134 |
| 88 | Ga0105239_10131873 | 3300010375 | Bacteria | 2780 |
| 89 | Ga0105239_10761501 | 3300010375 | Bacteria | 1108 |
| 90 | Ga0105239_10909140 | 3300010375 | Bacteria | 1010 |
| 91 | Ga0105239_11505278 | 3300010375 | Bacteria | 778 |
| 92 | Ga0105246_10062556 | 3300011119 | Unclassified | 2593 |
| 93 | Ga0105246_10085037 | 3300011119 | Unclassified | 2264 |
| 94 | Ga0157373_10021884 | 3300013100 | Bacteria | 4639 |
| 95 | Ga0157371_10042633 | 3300013102 | Bacteria | 3235 |
| 96 | Ga0157370_10003783 | 3300013104 | Bacteria | 17662 |
| 97 | Ga0157370_10005237 | 3300013104 | Bacteria | 14590 |
| 98 | Ga0157370_10099470 | 3300013104 | Bacteria | 2726 |
| 99 | Ga0157370_10182903 | 3300013104 | Bacteria | 1947 |
| 100 | Ga0157369_10068481 | 3300013105 | Bacteria | 3813 |
| 101 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 102 | Ga0157374_10008153 | 3300013296 | Bacteria | 8953 |
| 103 | Ga0157374_10150194 | 3300013296 | Bacteria | 2265 |
| 104 | Ga0157374_10926866 | 3300013296 | Bacteria | 889 |
| 105 | Ga0157378_10014189 | 3300013297 | Bacteria | 6972 |
| 106 | Ga0157378_10895162 | 3300013297 | Bacteria | 918 |
| 107 | Ga0163162_10001336 | 3300013306 | Bacteria | 23007 |
| 108 | Ga0163162_10004258 | 3300013306 | Bacteria | 13763 |
| 109 | Ga0163162_10315359 | 3300013306 | Bacteria | 1696 |
| 110 | Ga0157372_10057236 | 3300013307 | Bacteria | 4357 |
| 111 | Ga0157375_10075662 | 3300013308 | Bacteria | 3392 |
| 112 | Ga0157375_10732100 | 3300013308 | Bacteria | 1141 |
| 113 | Ga0157375_12422182 | 3300013308 | Unclassified | 626 |
| 114 | Ga0163163_10000344 | 3300014325 | Bacteria | 44689 |
| 115 | Ga0157377_10161127 | 3300014745 | Bacteria | 1395 |
| 116 | Ga0157379_10019251 | 3300014968 | Bacteria | 6028 |
| 117 | Ga0157379_10063027 | 3300014968 | Bacteria | 3315 |
| 118 | Ga0157376_10004535 | 3300014969 | Bacteria | 9671 |
| 119 | Ga0157376_10009304 | 3300014969 | Bacteria | 7135 |
| 120 | Ga0157376_10114088 | 3300014969 | Bacteria | 2383 |
| 121 | Ga0157376_10126831 | 3300014969 | Unclassified | 2271 |
| 122 | Ga0163161_10751219 | 3300017792 | Unclassified | 816 |
| 123 | Ga0207656_10174912 | 3300025321 | Bacteria | 1028 |
| 124 | Ga0207710_10002713 | 3300025900 | Bacteria | 8106 |
| 125 | Ga0207688_10632267 | 3300025901 | Bacteria | 675 |
| 126 | Ga0207680_10000141 | 3300025903 | Bacteria | 34433 |
| 127 | Ga0207647_10127504 | 3300025904 | Bacteria | 1497 |
| 128 | Ga0207705_10040118 | 3300025909 | Bacteria | 3357 |
| 129 | Ga0207654_10003695 | 3300025911 | Bacteria | 7718 |
| 130 | Ga0207654_10101604 | 3300025911 | Bacteria | 1773 |
| 131 | Ga0207654_10256666 | 3300025911 | Bacteria | 1174 |
| 132 | Ga0207654_10405903 | 3300025911 | Bacteria | 948 |
| 133 | Ga0207707_10106740 | 3300025912 | Bacteria | 2448 |
| 134 | Ga0207695_10001688 | 3300025913 | Bacteria | 35472 |
| 135 | Ga0207695_10010041 | 3300025913 | Bacteria | 11625 |
| 136 | Ga0207695_10097974 | 3300025913 | Bacteria | 2932 |
| 137 | Ga0207671_10006437 | 3300025914 | Bacteria | 10455 |
| 138 | Ga0207671_10010346 | 3300025914 | Bacteria | 7706 |
| 139 | Ga0207671_10010377 | 3300025914 | Bacteria | 7690 |
| 140 | Ga0207671_10035525 | 3300025914 | Bacteria | 3698 |
| 141 | Ga0207657_10006852 | 3300025919 | Bacteria | 11753 |
| 142 | Ga0207657_10285048 | 3300025919 | Bacteria | 1311 |
| 143 | Ga0207649_10023098 | 3300025920 | Bacteria | 3598 |
| 144 | Ga0207694_10042125 | 3300025924 | Bacteria | 3521 |
| 145 | Ga0207650_10100267 | 3300025925 | Bacteria | 2228 |
| 146 | Ga0207659_10926190 | 3300025926 | Bacteria | 749 |
| 147 | Ga0207687_10351256 | 3300025927 | Bacteria | 1201 |
| 148 | Ga0207706_10003968 | 3300025933 | Bacteria | 14018 |
| 149 | Ga0207686_10242009 | 3300025934 | Bacteria | 1313 |
| 150 | Ga0207686_10736710 | 3300025934 | Bacteria | 786 |
| 151 | Ga0207704_11422527 | 3300025938 | Bacteria | 594 |
| 152 | Ga0207665_10292450 | 3300025939 | Bacteria | 1215 |
| 153 | Ga0207691_10247517 | 3300025940 | Bacteria | 1539 |
| 154 | Ga0207689_10045780 | 3300025942 | Unclassified | 3617 |
| 155 | Ga0207689_11198847 | 3300025942 | Unclassified | 639 |
| 156 | Ga0207667_10000643 | 3300025949 | Bacteria | 45271 |
| 157 | Ga0207667_10485726 | 3300025949 | Bacteria | 1253 |
| 158 | Ga0207667_10652536 | 3300025949 | Bacteria | 1058 |
| 159 | Ga0207651_10263887 | 3300025960 | Bacteria | 1415 |
| 160 | Ga0207712_10017452 | 3300025961 | Bacteria | 4661 |
| 161 | Ga0207668_10137801 | 3300025972 | Bacteria | 1872 |
| 162 | Ga0207640_10049547 | 3300025981 | Bacteria | 2720 |
| 163 | Ga0207640_10408056 | 3300025981 | Bacteria | 1108 |
| 164 | Ga0207677_10200372 | 3300026023 | Bacteria | 1586 |
| 165 | Ga0207677_10323139 | 3300026023 | Bacteria | 1283 |
| 166 | Ga0207677_10506186 | 3300026023 | Unclassified | 1045 |
| 167 | Ga0207703_10009315 | 3300026035 | Bacteria | 7717 |
| 168 | Ga0207703_10862848 | 3300026035 | Unclassified | 866 |
| 169 | Ga0207703_11572152 | 3300026035 | Bacteria | 633 |
| 170 | Ga0207639_10358685 | 3300026041 | Bacteria | 1304 |
| 171 | Ga0207639_11857328 | 3300026041 | Bacteria | 563 |
| 172 | Ga0207641_10000146 | 3300026088 | Bacteria | 100666 |
| 173 | Ga0207648_10256972 | 3300026089 | Unclassified | 1558 |
| 174 | Ga0207676_10005018 | 3300026095 | Bacteria | 9372 |
| 175 | Ga0207676_10625701 | 3300026095 | Bacteria | 1036 |
| 176 | Ga0207676_11396566 | 3300026095 | Bacteria | 696 |
| 177 | Ga0207674_10001630 | 3300026116 | Bacteria | 28871 |
| 178 | Ga0207674_10554084 | 3300026116 | Bacteria | 1111 |
| 179 | Ga0207698_10002117 | 3300026142 | Bacteria | 11709 |
| 180 | Ga0207698_10003512 | 3300026142 | Bacteria | 9452 |
| 181 | Ga0207698_10354251 | 3300026142 | Bacteria | 1387 |
| 182 | Ga0207698_10444032 | 3300026142 | Bacteria | 1251 |
| 183 | Ga0207698_11791874 | 3300026142 | Bacteria | 629 |
| 184 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 185 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 186 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 187 | Ga0268264_10000054 | 3300028381 | Bacteria | 317048 |
| 188 | Ga0268264_10004101 | 3300028381 | Bacteria | 12463 |
| 189 | Ga0268264_10006744 | 3300028381 | Bacteria | 9649 |
| 190 | Ga0307511_10000228 | 3300030521 | Bacteria | 57237 |
| 191 | Ga0307511_10366486 | 3300030521 | Bacteria | 610 |
| 192 | Ga0265327_10000026 | 3300031251 | Bacteria | 379288 |
| 193 | Ga0265327_10000285 | 3300031251 | Bacteria | 99746 |
| 194 | Ga0307513_10280712 | 3300031456 | Bacteria | 1443 |
| 195 | Ga0307508_10001024 | 3300031616 | Bacteria | 32462 |
| 196 | Ga0307405_10038088 | 3300031731 | Bacteria | 2895 |
| 197 | Ga0307412_10239631 | 3300031911 | Unclassified | 1402 |
| 198 | Ga0373931_0522601 | 3300035691 | Bacteria | 768 |
| 199 | Ga0395905_0261399 | 3300037471 | Bacteria | 1616 |
| 200 | Ga0451791_1406598 | 3300041451 | Bacteria | 784 |
| 201 | Ga0451849_1196652 | 3300041505 | Bacteria | 1145 |
| 202 | Ga0451577_1049000 | 3300042876 | Bacteria | 731 |
| 203 | Ga0466972_0003735 | 3300044658 | Bacteria | 7571 |
| 204 | Ga0453684_0074410 | 3300044712 | Bacteria | 4277 |
| 205 | Ga0453684_0461433 | 3300044712 | Bacteria | 1412 |
| 206 | Ga0453684_1462000 | 3300044712 | Unclassified | 706 |
| 207 | Ga0466971_0228500 | 3300044719 | Bacteria | 883 |
| 208 | Ga0466957_0007963 | 3300044842 | Bacteria | 6012 |
| 209 | Ga0466957_0168992 | 3300044842 | Bacteria | 1424 |
| 210 | Ga0466967_0274282 | 3300045976 | Bacteria | 1617 |
| 211 | Ga0495638_0040133 | 3300046460 | Bacteria | 2967 |
| 212 | Ga0495607_0145738 | 3300046501 | Bacteria | 1217 |
| 213 | Ga0495643_0173190 | 3300046522 | Bacteria | 1054 |
| 214 | Ga0495648_0005665 | 3300046524 | Bacteria | 10334 |
| 215 | Ga0495668_0000453 | 3300046616 | Bacteria | 52477 |
| 216 | Ga0495649_0099468 | 3300046694 | Bacteria | 1547 |
| 217 | Ga0495672_0261736 | 3300047320 | Bacteria | 834 |
| 218 | Ga0495687_000031 | 3300047443 | Bacteria | 274659 |
| 219 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 220 | Ga0496114_0024177 | 3300048917 | Bacteria | 4958 |
| 221 | Ga0496115_0010906 | 3300048918 | Bacteria | 6803 |
| 222 | Ga0496115_0146948 | 3300048918 | Unclassified | 1946 |
| 223 | Ga0501031_0005353 | 3300049568 | Bacteria | 8357 |
| 224 | Ga0501032_0070726 | 3300049569 | Bacteria | 2327 |
| 225 | Ga0501034_0014124 | 3300049571 | Bacteria | 8229 |
| 226 | Ga0501034_0019703 | 3300049571 | Bacteria | 6896 |
| 227 | Ga0501034_0080730 | 3300049571 | Bacteria | 3255 |
| 228 | Ga0501037_0024253 | 3300049573 | Bacteria | 4486 |
| 229 | Ga0501038_0987624 | 3300049574 | Bacteria | 618 |
| 230 | Ga0501038_1297918 | 3300049574 | Unclassified | 526 |
| 231 | Ga0501039_0058059 | 3300049575 | Bacteria | 2996 |
| 232 | Ga0501043_0233935 | 3300049579 | Bacteria | 1418 |
| 233 | Ga0501070_0688928 | 3300049586 | Bacteria | 809 |
| 234 | Ga0501219_000159 | 3300049703 | Bacteria | 12350 |
| 235 | Ga0501035_0011438 | 3300049822 | Bacteria | 8229 |
| 236 | Ga0501035_0836975 | 3300049822 | Unclassified | 733 |
| 237 | Ga0501044_0010826 | 3300049823 | Bacteria | 9896 |
| 238 | Ga0501044_0016090 | 3300049823 | Bacteria | 8041 |
| 239 | Ga0501044_0019756 | 3300049823 | Bacteria | 7198 |
| 240 | Ga0501284_00018 | 3300050005 | Bacteria | 93729 |
| 241 | Ga0500644_0174445 | 3300053088 | Bacteria | 876 |
| 242 | Ga0500646_0187549 | 3300053090 | Bacteria | 704 |
| 243 | Ga0500583_0005259 | 3300053092 | Bacteria | 4319 |
| 244 | Ga0500562_000005 | 3300053108 | Bacteria | 266746 |
| 245 | Ga0500621_271474 | 3300053126 | Bacteria | 558 |
| 246 | Ga0500642_0355045 | 3300053130 | Bacteria | 649 |
| 247 | Ga0500568_0018806 | 3300053139 | Bacteria | 3014 |
| 248 | Ga0500616_0000698 | 3300053153 | Bacteria | 39124 |
| 249 | Ga0500622_0000835 | 3300053156 | Bacteria | 26334 |
| 250 | Ga0500622_0006293 | 3300053156 | Bacteria | 6930 |
| 251 | Ga0500645_009246 | 3300053730 | Bacteria | 3318 |
| 252 | Ga0500645_024492 | 3300053730 | Bacteria | 1845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005466 | Ga0070685_10536276 | Ga0070685_105362762 | 108 |
| 2 | 3300042876 | Ga0451577_1049000 | Ga0451577_1049000_89_433 | 113 |
| 3 | 3300044712 | Ga0453684_0074410 | Ga0453684_0074410_75_419 | 113 |
| 4 | 3300005578 | Ga0068854_100028088 | Ga0068854_1000280884 | 115 |
| 5 | 3300025919 | Ga0207657_10006852 | Ga0207657_100068522 | 115 |
| 6 | 3300025981 | Ga0207640_10049547 | Ga0207640_100495472 | 115 |
| 7 | iso_pu_bacteria | 2739367866 | 2740032834 | 117 |
| 8 | iso_pu_bacteria | 2881955468 | 2881955792 | 117 |
| 9 | 3300003320 | rootH2_10221438 | rootH2_102214383 | 118 |
| 10 | 3300003323 | rootH1_10063975 | rootH1_100639751 | 118 |
| 11 | 3300005290 | Ga0065712_10191048 | Ga0065712_101910481 | 118 |
| 12 | 3300005328 | Ga0070676_10313483 | Ga0070676_103134832 | 118 |
| 13 | 3300005329 | Ga0070683_100013283 | Ga0070683_1000132834 | 118 |
| 14 | 3300005330 | Ga0070690_100023200 | Ga0070690_1000232002 | 118 |
| 15 | 3300005331 | Ga0070670_100096303 | Ga0070670_1000963033 | 118 |
| 16 | 3300005334 | Ga0068869_100141239 | Ga0068869_1001412391 | 118 |
| 17 | 3300005334 | Ga0068869_100261012 | Ga0068869_1002610122 | 118 |
| 18 | 3300005334 | Ga0068869_100583008 | Ga0068869_1005830082 | 118 |
| 19 | 3300005335 | Ga0070666_10000031 | Ga0070666_1000003148 | 118 |
| 20 | 3300005337 | Ga0070682_100098462 | Ga0070682_1000984622 | 118 |
| 21 | 3300005338 | Ga0068868_100083280 | Ga0068868_1000832804 | 118 |
| 22 | 3300005338 | Ga0068868_100290795 | Ga0068868_1002907952 | 118 |
| 23 | 3300005338 | Ga0068868_101508395 | Ga0068868_1015083951 | 118 |
| 24 | 3300005339 | Ga0070660_101060939 | Ga0070660_1010609391 | 118 |
| 25 | 3300005344 | Ga0070661_100069578 | Ga0070661_1000695783 | 118 |
| 26 | 3300005347 | Ga0070668_100619199 | Ga0070668_1006191991 | 118 |
| 27 | 3300005354 | Ga0070675_100121173 | Ga0070675_1001211733 | 118 |
| 28 | 3300005364 | Ga0070673_100063551 | Ga0070673_1000635514 | 118 |
| 29 | 3300005365 | Ga0070688_100057329 | Ga0070688_1000573293 | 118 |
| 30 | 3300005366 | Ga0070659_100011285 | Ga0070659_1000112853 | 118 |
| 31 | 3300005367 | Ga0070667_102076876 | Ga0070667_1020768761 | 118 |
| 32 | 3300005457 | Ga0070662_100011542 | Ga0070662_1000115423 | 118 |
| 33 | 3300005458 | Ga0070681_10331371 | Ga0070681_103313711 | 118 |
| 34 | 3300005459 | Ga0068867_100513542 | Ga0068867_1005135422 | 118 |
| 35 | 3300005530 | Ga0070679_100030630 | Ga0070679_1000306302 | 118 |
| 36 | 3300005535 | Ga0070684_100023061 | Ga0070684_1000230614 | 118 |
| 37 | 3300005539 | Ga0068853_100994461 | Ga0068853_1009944612 | 118 |
| 38 | 3300005543 | Ga0070672_100114268 | Ga0070672_1001142681 | 118 |
| 39 | 3300005547 | Ga0070693_101595842 | Ga0070693_1015958421 | 118 |
| 40 | 3300005548 | Ga0070665_100000018 | Ga0070665_100000018156 | 118 |
| 41 | 3300005563 | Ga0068855_100005149 | Ga0068855_10000514914 | 118 |
| 42 | 3300005563 | Ga0068855_100249775 | Ga0068855_1002497752 | 118 |
| 43 | 3300005564 | Ga0070664_100022348 | Ga0070664_1000223482 | 118 |
| 44 | 3300005577 | Ga0068857_100327686 | Ga0068857_1003276863 | 118 |
| 45 | 3300005614 | Ga0068856_100004936 | Ga0068856_1000049366 | 118 |
| 46 | 3300005614 | Ga0068856_100269858 | Ga0068856_1002698582 | 118 |
| 47 | 3300005616 | Ga0068852_100005012 | Ga0068852_1000050129 | 118 |
| 48 | 3300005616 | Ga0068852_100239033 | Ga0068852_1002390333 | 118 |
| 49 | 3300005616 | Ga0068852_100447896 | Ga0068852_1004478962 | 118 |
| 50 | 3300005616 | Ga0068852_100735284 | Ga0068852_1007352841 | 118 |
| 51 | 3300005616 | Ga0068852_101218421 | Ga0068852_1012184211 | 118 |
| 52 | 3300005617 | Ga0068859_100000045 | Ga0068859_10000004592 | 118 |
| 53 | 3300005618 | Ga0068864_100001485 | Ga0068864_1000014858 | 118 |
| 54 | 3300005618 | Ga0068864_100515499 | Ga0068864_1005154992 | 118 |
| 55 | 3300005618 | Ga0068864_100657100 | Ga0068864_1006571002 | 118 |
| 56 | 3300005718 | Ga0068866_10025998 | Ga0068866_100259985 | 118 |
| 57 | 3300005719 | Ga0068861_100566994 | Ga0068861_1005669941 | 118 |
| 58 | 3300005719 | Ga0068861_101156214 | Ga0068861_1011562141 | 118 |
| 59 | 3300005834 | Ga0068851_10094339 | Ga0068851_100943392 | 118 |
| 60 | 3300005841 | Ga0068863_100002352 | Ga0068863_1000023527 | 118 |
| 61 | 3300005842 | Ga0068858_100003543 | Ga0068858_10000354313 | 118 |
| 62 | 3300005842 | Ga0068858_100995378 | Ga0068858_1009953781 | 118 |
| 63 | 3300005843 | Ga0068860_100000040 | Ga0068860_100000040180 | 118 |
| 64 | 3300005843 | Ga0068860_100003540 | Ga0068860_10000354011 | 118 |
| 65 | 3300005843 | Ga0068860_100006047 | Ga0068860_1000060475 | 118 |
| 66 | 3300005983 | Ga0081540_1007766 | Ga0081540_10077662 | 118 |
| 67 | 3300006237 | Ga0097621_100021319 | Ga0097621_1000213193 | 118 |
| 68 | 3300006237 | Ga0097621_100096123 | Ga0097621_1000961233 | 118 |
| 69 | 3300006358 | Ga0068871_100005878 | Ga0068871_1000058783 | 118 |
| 70 | 3300006881 | Ga0068865_101284420 | Ga0068865_1012844201 | 118 |
| 71 | 3300006931 | Ga0097620_100000045 | Ga0097620_10000004548 | 118 |
| 72 | 3300009093 | Ga0105240_10000472 | Ga0105240_1000047213 | 118 |
| 73 | 3300009093 | Ga0105240_10013039 | Ga0105240_1001303910 | 118 |
| 74 | 3300009093 | Ga0105240_10092434 | Ga0105240_100924343 | 118 |
| 75 | 3300009093 | Ga0105240_10506507 | Ga0105240_105065072 | 118 |
| 76 | 3300009093 | Ga0105240_10885513 | Ga0105240_108855131 | 118 |
| 77 | 3300009093 | Ga0105240_11080116 | Ga0105240_110801161 | 118 |
| 78 | 3300009093 | Ga0105240_12653828 | Ga0105240_126538281 | 118 |
| 79 | 3300009098 | Ga0105245_11134427 | Ga0105245_111344272 | 118 |
| 80 | 3300009101 | Ga0105247_10003520 | Ga0105247_100035203 | 118 |
| 81 | 3300009148 | Ga0105243_10251207 | Ga0105243_102512071 | 118 |
| 82 | 3300009174 | Ga0105241_10001733 | Ga0105241_1000173311 | 118 |
| 83 | 3300009174 | Ga0105241_10263831 | Ga0105241_102638312 | 118 |
| 84 | 3300009174 | Ga0105241_11143884 | Ga0105241_111438841 | 118 |
| 85 | 3300009176 | Ga0105242_11363842 | Ga0105242_113638422 | 118 |
| 86 | 3300009176 | Ga0105242_12067804 | Ga0105242_120678042 | 118 |
| 87 | 3300009545 | Ga0105237_10008585 | Ga0105237_100085858 | 118 |
| 88 | 3300009545 | Ga0105237_10096515 | Ga0105237_100965154 | 118 |
| 89 | 3300009551 | Ga0105238_10019830 | Ga0105238_100198305 | 118 |
| 90 | 3300009551 | Ga0105238_10063303 | Ga0105238_100633033 | 118 |
| 91 | 3300009551 | Ga0105238_10367640 | Ga0105238_103676402 | 118 |
| 92 | 3300009551 | Ga0105238_13043920 | Ga0105238_130439201 | 118 |
| 93 | 3300009553 | Ga0105249_10010510 | Ga0105249_100105105 | 118 |
| 94 | 3300010375 | Ga0105239_10131873 | Ga0105239_101318733 | 118 |
| 95 | 3300010375 | Ga0105239_10761501 | Ga0105239_107615012 | 118 |
| 96 | 3300010375 | Ga0105239_10909140 | Ga0105239_109091401 | 118 |
| 97 | 3300010375 | Ga0105239_11505278 | Ga0105239_115052782 | 118 |
| 98 | 3300011119 | Ga0105246_10062556 | Ga0105246_100625562 | 118 |
| 99 | 3300011119 | Ga0105246_10085037 | Ga0105246_100850373 | 118 |
| 100 | 3300013100 | Ga0157373_10021884 | Ga0157373_100218844 | 118 |
| 101 | 3300013102 | Ga0157371_10042633 | Ga0157371_100426331 | 118 |
| 102 | 3300013104 | Ga0157370_10003783 | Ga0157370_100037833 | 118 |
| 103 | 3300013104 | Ga0157370_10005237 | Ga0157370_100052379 | 118 |
| 104 | 3300013104 | Ga0157370_10099470 | Ga0157370_100994703 | 118 |
| 105 | 3300013104 | Ga0157370_10182903 | Ga0157370_101829033 | 118 |
| 106 | 3300013105 | Ga0157369_10068481 | Ga0157369_100684812 | 118 |
| 107 | 3300013296 | Ga0157374_10000025 | Ga0157374_1000002592 | 118 |
| 108 | 3300013296 | Ga0157374_10008153 | Ga0157374_100081534 | 118 |
| 109 | 3300013296 | Ga0157374_10150194 | Ga0157374_101501943 | 118 |
| 110 | 3300013296 | Ga0157374_10926866 | Ga0157374_109268662 | 118 |
| 111 | 3300013297 | Ga0157378_10014189 | Ga0157378_100141892 | 118 |
| 112 | 3300013297 | Ga0157378_10895162 | Ga0157378_108951622 | 118 |
| 113 | 3300013306 | Ga0163162_10001336 | Ga0163162_1000133613 | 118 |
| 114 | 3300013306 | Ga0163162_10004258 | Ga0163162_100042583 | 118 |
| 115 | 3300013306 | Ga0163162_10315359 | Ga0163162_103153592 | 118 |
| 116 | 3300013307 | Ga0157372_10057236 | Ga0157372_100572363 | 118 |
| 117 | 3300013308 | Ga0157375_10075662 | Ga0157375_100756622 | 118 |
| 118 | 3300013308 | Ga0157375_10732100 | Ga0157375_107321002 | 118 |
| 119 | 3300013308 | Ga0157375_12422182 | Ga0157375_124221821 | 118 |
| 120 | 3300014325 | Ga0163163_10000344 | Ga0163163_1000034440 | 118 |
| 121 | 3300014745 | Ga0157377_10161127 | Ga0157377_101611272 | 118 |
| 122 | 3300014968 | Ga0157379_10019251 | Ga0157379_100192515 | 118 |
| 123 | 3300014968 | Ga0157379_10063027 | Ga0157379_100630273 | 118 |
| 124 | 3300014969 | Ga0157376_10004535 | Ga0157376_100045356 | 118 |
| 125 | 3300014969 | Ga0157376_10009304 | Ga0157376_100093045 | 118 |
| 126 | 3300014969 | Ga0157376_10114088 | Ga0157376_101140883 | 118 |
| 127 | 3300014969 | Ga0157376_10126831 | Ga0157376_101268312 | 118 |
| 128 | 3300017792 | Ga0163161_10751219 | Ga0163161_107512191 | 118 |
| 129 | 3300025321 | Ga0207656_10174912 | Ga0207656_101749121 | 118 |
| 130 | 3300025900 | Ga0207710_10002713 | Ga0207710_100027139 | 118 |
| 131 | 3300025901 | Ga0207688_10632267 | Ga0207688_106322671 | 118 |
| 132 | 3300025903 | Ga0207680_10000141 | Ga0207680_1000014119 | 118 |
| 133 | 3300025904 | Ga0207647_10127504 | Ga0207647_101275042 | 118 |
| 134 | 3300025909 | Ga0207705_10040118 | Ga0207705_100401182 | 118 |
| 135 | 3300025911 | Ga0207654_10003695 | Ga0207654_100036959 | 118 |
| 136 | 3300025911 | Ga0207654_10101604 | Ga0207654_101016042 | 118 |
| 137 | 3300025911 | Ga0207654_10256666 | Ga0207654_102566662 | 118 |
| 138 | 3300025911 | Ga0207654_10405903 | Ga0207654_104059032 | 118 |
| 139 | 3300025912 | Ga0207707_10106740 | Ga0207707_101067401 | 118 |
| 140 | 3300025913 | Ga0207695_10001688 | Ga0207695_1000168820 | 118 |
| 141 | 3300025913 | Ga0207695_10010041 | Ga0207695_100100417 | 118 |
| 142 | 3300025913 | Ga0207695_10097974 | Ga0207695_100979743 | 118 |
| 143 | 3300025914 | Ga0207671_10006437 | Ga0207671_100064378 | 118 |
| 144 | 3300025914 | Ga0207671_10010346 | Ga0207671_100103464 | 118 |
| 145 | 3300025914 | Ga0207671_10010377 | Ga0207671_100103772 | 118 |
| 146 | 3300025914 | Ga0207671_10035525 | Ga0207671_100355254 | 118 |
| 147 | 3300025919 | Ga0207657_10285048 | Ga0207657_102850482 | 118 |
| 148 | 3300025920 | Ga0207649_10023098 | Ga0207649_100230981 | 118 |
| 149 | 3300025924 | Ga0207694_10042125 | Ga0207694_100421253 | 118 |
| 150 | 3300025925 | Ga0207650_10100267 | Ga0207650_101002673 | 118 |
| 151 | 3300025926 | Ga0207659_10926190 | Ga0207659_109261901 | 118 |
| 152 | 3300025927 | Ga0207687_10351256 | Ga0207687_103512562 | 118 |
| 153 | 3300025933 | Ga0207706_10003968 | Ga0207706_100039688 | 118 |
| 154 | 3300025934 | Ga0207686_10242009 | Ga0207686_102420092 | 118 |
| 155 | 3300025934 | Ga0207686_10736710 | Ga0207686_107367102 | 118 |
| 156 | 3300025938 | Ga0207704_11422527 | Ga0207704_114225271 | 118 |
| 157 | 3300025939 | Ga0207665_10292450 | Ga0207665_102924502 | 118 |
| 158 | 3300025940 | Ga0207691_10247517 | Ga0207691_102475173 | 118 |
| 159 | 3300025942 | Ga0207689_10045780 | Ga0207689_100457802 | 118 |
| 160 | 3300025942 | Ga0207689_11198847 | Ga0207689_111988471 | 118 |
| 161 | 3300025949 | Ga0207667_10000643 | Ga0207667_1000064321 | 118 |
| 162 | 3300025949 | Ga0207667_10485726 | Ga0207667_104857261 | 118 |
| 163 | 3300025949 | Ga0207667_10652536 | Ga0207667_106525362 | 118 |
| 164 | 3300025960 | Ga0207651_10263887 | Ga0207651_102638872 | 118 |
| 165 | 3300025961 | Ga0207712_10017452 | Ga0207712_100174522 | 118 |
| 166 | 3300025972 | Ga0207668_10137801 | Ga0207668_101378013 | 118 |
| 167 | 3300025981 | Ga0207640_10408056 | Ga0207640_104080562 | 118 |
| 168 | 3300026023 | Ga0207677_10200372 | Ga0207677_102003723 | 118 |
| 169 | 3300026023 | Ga0207677_10323139 | Ga0207677_103231392 | 118 |
| 170 | 3300026023 | Ga0207677_10506186 | Ga0207677_105061862 | 118 |
| 171 | 3300026035 | Ga0207703_10009315 | Ga0207703_100093157 | 118 |
| 172 | 3300026035 | Ga0207703_10862848 | Ga0207703_108628481 | 118 |
| 173 | 3300026035 | Ga0207703_11572152 | Ga0207703_115721522 | 118 |
| 174 | 3300026041 | Ga0207639_10358685 | Ga0207639_103586852 | 118 |
| 175 | 3300026041 | Ga0207639_11857328 | Ga0207639_118573281 | 118 |
| 176 | 3300026088 | Ga0207641_10000146 | Ga0207641_1000014685 | 118 |
| 177 | 3300026089 | Ga0207648_10256972 | Ga0207648_102569723 | 118 |
| 178 | 3300026095 | Ga0207676_10005018 | Ga0207676_100050183 | 118 |
| 179 | 3300026095 | Ga0207676_10625701 | Ga0207676_106257011 | 118 |
| 180 | 3300026095 | Ga0207676_11396566 | Ga0207676_113965661 | 118 |
| 181 | 3300026116 | Ga0207674_10001630 | Ga0207674_1000163020 | 118 |
| 182 | 3300026116 | Ga0207674_10554084 | Ga0207674_105540841 | 118 |
| 183 | 3300026142 | Ga0207698_10002117 | Ga0207698_100021171 | 118 |
| 184 | 3300026142 | Ga0207698_10003512 | Ga0207698_100035123 | 118 |
| 185 | 3300026142 | Ga0207698_10354251 | Ga0207698_103542512 | 118 |
| 186 | 3300026142 | Ga0207698_10444032 | Ga0207698_104440322 | 118 |
| 187 | 3300026142 | Ga0207698_11791874 | Ga0207698_117918741 | 118 |
| 188 | 3300028379 | Ga0268266_10000026 | Ga0268266_10000026205 | 118 |
| 189 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015103 | 118 |
| 190 | 3300028381 | Ga0268264_10000019 | Ga0268264_10000019200 | 118 |
| 191 | 3300028381 | Ga0268264_10000054 | Ga0268264_10000054170 | 118 |
| 192 | 3300028381 | Ga0268264_10004101 | Ga0268264_100041015 | 118 |
| 193 | 3300028381 | Ga0268264_10006744 | Ga0268264_100067446 | 118 |
| 194 | 3300030521 | Ga0307511_10000228 | Ga0307511_100002287 | 118 |
| 195 | 3300030521 | Ga0307511_10366486 | Ga0307511_103664862 | 118 |
| 196 | 3300031251 | Ga0265327_10000026 | Ga0265327_1000002689 | 118 |
| 197 | 3300031251 | Ga0265327_10000285 | Ga0265327_1000028550 | 118 |
| 198 | 3300031456 | Ga0307513_10280712 | Ga0307513_102807123 | 118 |
| 199 | 3300031616 | Ga0307508_10001024 | Ga0307508_1000102417 | 118 |
| 200 | 3300031731 | Ga0307405_10038088 | Ga0307405_100380882 | 118 |
| 201 | 3300031911 | Ga0307412_10239631 | Ga0307412_102396313 | 118 |
| 202 | 3300035691 | Ga0373931_0522601 | Ga0373931_0522601_306_677 | 118 |
| 203 | 3300037471 | Ga0395905_0261399 | Ga0395905_0261399_604_960 | 118 |
| 204 | 3300041451 | Ga0451791_1406598 | Ga0451791_1406598_310_681 | 118 |
| 205 | 3300041505 | Ga0451849_1196652 | Ga0451849_1196652_86_457 | 118 |
| 206 | 3300044658 | Ga0466972_0003735 | Ga0466972_0003735_3178_3549 | 118 |
| 207 | 3300044712 | Ga0453684_0461433 | Ga0453684_0461433_689_1057 | 118 |
| 208 | 3300044712 | Ga0453684_1462000 | Ga0453684_1462000_227_586 | 118 |
| 209 | 3300044719 | Ga0466971_0228500 | Ga0466971_0228500_98_466 | 118 |
| 210 | 3300044842 | Ga0466957_0007963 | Ga0466957_0007963_4246_4722 | 118 |
| 211 | 3300044842 | Ga0466957_0168992 | Ga0466957_0168992_110_478 | 118 |
| 212 | 3300045976 | Ga0466967_0274282 | Ga0466967_0274282_204_575 | 118 |
| 213 | 3300046460 | Ga0495638_0040133 | Ga0495638_0040133_2425_2784 | 118 |
| 214 | 3300046501 | Ga0495607_0145738 | Ga0495607_0145738_603_962 | 118 |
| 215 | 3300046522 | Ga0495643_0173190 | Ga0495643_0173190_557_928 | 118 |
| 216 | 3300046524 | Ga0495648_0005665 | Ga0495648_0005665_8889_9248 | 118 |
| 217 | 3300046616 | Ga0495668_0000453 | Ga0495668_0000453_34231_34596 | 118 |
| 218 | 3300046694 | Ga0495649_0099468 | Ga0495649_0099468_1012_1386 | 118 |
| 219 | 3300047320 | Ga0495672_0261736 | Ga0495672_0261736_414_785 | 118 |
| 220 | 3300047443 | Ga0495687_000031 | Ga0495687_000031_136184_136555 | 118 |
| 221 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_12692_13063 | 118 |
| 222 | 3300048917 | Ga0496114_0024177 | Ga0496114_0024177_1135_1497 | 118 |
| 223 | 3300048918 | Ga0496115_0010906 | Ga0496115_0010906_4934_5293 | 118 |
| 224 | 3300048918 | Ga0496115_0146948 | Ga0496115_0146948_1528_1902 | 118 |
| 225 | 3300049568 | Ga0501031_0005353 | Ga0501031_0005353_6265_6633 | 118 |
| 226 | 3300049569 | Ga0501032_0070726 | Ga0501032_0070726_1517_1885 | 118 |
| 227 | 3300049571 | Ga0501034_0014124 | Ga0501034_0014124_2724_3083 | 118 |
| 228 | 3300049571 | Ga0501034_0019703 | Ga0501034_0019703_5984_6343 | 118 |
| 229 | 3300049571 | Ga0501034_0080730 | Ga0501034_0080730_1824_2192 | 118 |
| 230 | 3300049573 | Ga0501037_0024253 | Ga0501037_0024253_2528_2896 | 118 |
| 231 | 3300049574 | Ga0501038_0987624 | Ga0501038_0987624_45_413 | 118 |
| 232 | 3300049574 | Ga0501038_1297918 | Ga0501038_1297918_25_384 | 118 |
| 233 | 3300049575 | Ga0501039_0058059 | Ga0501039_0058059_1644_2012 | 118 |
| 234 | 3300049579 | Ga0501043_0233935 | Ga0501043_0233935_1024_1392 | 118 |
| 235 | 3300049586 | Ga0501070_0688928 | Ga0501070_0688928_150_509 | 118 |
| 236 | 3300049703 | Ga0501219_000159 | Ga0501219_000159_8574_8942 | 118 |
| 237 | 3300049822 | Ga0501035_0011438 | Ga0501035_0011438_521_889 | 118 |
| 238 | 3300049822 | Ga0501035_0836975 | Ga0501035_0836975_106_465 | 118 |
| 239 | 3300049823 | Ga0501044_0010826 | Ga0501044_0010826_7732_8091 | 118 |
| 240 | 3300049823 | Ga0501044_0016090 | Ga0501044_0016090_2912_3271 | 118 |
| 241 | 3300049823 | Ga0501044_0019756 | Ga0501044_0019756_2366_2734 | 118 |
| 242 | 3300050005 | Ga0501284_00018 | Ga0501284_00018_64514_64882 | 118 |
| 243 | 3300053088 | Ga0500644_0174445 | Ga0500644_0174445_486_845 | 118 |
| 244 | 3300053090 | Ga0500646_0187549 | Ga0500646_0187549_122_481 | 118 |
| 245 | 3300053092 | Ga0500583_0005259 | Ga0500583_0005259_2615_2974 | 118 |
| 246 | 3300053108 | Ga0500562_000005 | Ga0500562_000005_34984_35352 | 118 |
| 247 | 3300053126 | Ga0500621_271474 | Ga0500621_271474_136_495 | 118 |
| 248 | 3300053130 | Ga0500642_0355045 | Ga0500642_0355045_31_390 | 118 |
| 249 | 3300053139 | Ga0500568_0018806 | Ga0500568_0018806_1820_2191 | 118 |
| 250 | 3300053153 | Ga0500616_0000698 | Ga0500616_0000698_13614_13979 | 118 |
| 251 | 3300053156 | Ga0500622_0000835 | Ga0500622_0000835_21082_21447 | 118 |
| 252 | 3300053156 | Ga0500622_0006293 | Ga0500622_0006293_1617_1976 | 118 |
| 253 | 3300053730 | Ga0500645_009246 | Ga0500645_009246_243_611 | 118 |
| 254 | 3300053730 | Ga0500645_024492 | Ga0500645_024492_1386_1754 | 118 |
| 255 | iso_pu_bacteria | 2883068021 | 2883070686 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ff4-assembly1.cif.gz_A | crystal structure of uncharacterized protein chu_1412 | 0.9813 | 2 | 118 |
| 3ff4-assembly1.cif.gz_A | crystal structure of uncharacterized protein chu_1412 | 0.965 | 2 | 118 |
| 1iul-assembly1.cif.gz_A | the structure of cell-free id.343 from thermus thermophilus | 0.8819 | 2 | 118 |
| 2d5a-assembly1.cif.gz_A | hypothetical protein from pyrococcus horikoshii ot3 | 0.8805 | 3 | 115 |
| 1iul-assembly1.cif.gz_A | the structure of cell-free id.343 from thermus thermophilus | 0.8685 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ff4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.981 | 2 | 118 | 3.40.50.720 |
| 3ff4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9567 | 2 | 118 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8819 | 2 | 118 | 3.40.50.720 |
| af_Q0ISZ5_12_118_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8808 | 2 | 36 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8685 | 2 | 118 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354D9Z0-F1-model_v4 | deleted | 1.003 | 2 | 118 |
|
| AF-A0A2D7VQK0-F1-model_v4 | CoA-binding protein | 1.003 | 2 | 118 |
|
| AF-A0A4R1HVA8-F1-model_v4 | deleted | 1.002 | 2 | 118 |
|
| AF-A0A6I3LY05-F1-model_v4 | CoA-binding protein | 1.002 | 2 | 118 |
|
| AF-A0A4Y4AYS0-F1-model_v4 | CoA-binding protein | 1.002 | 2 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar