F365267

General Info

Members Datasets Scaffolds Average Seq Length
254 186 213 152

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0183417|Ga0500568_0183417_112_573
Length 153
Sequence MYTTVLALHSLVRWLVLASLLFAIFRAFNGWSSKRSFSRVDNSVRHWTATIAHIQLIFGLVLYFISPIVNYFLHNFNDAVHRREIRFFGMERLMMVIAIVVITIGSARAKRKLTDPEKFKTMALWFSAGLLIILSSVPWAFSPLISRPYFRPF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
9 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
15 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
16 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
17 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
18 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
19 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
20 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
21 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
22 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
23 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
24 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
25 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
26 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
27 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
28 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
29 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
30 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
31 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
32 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
33 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
34 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
35 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
36 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
37 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
38 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
39 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
40 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
41 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
45 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
174 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
175 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.86
Metatranscriptomes 0
Isolates 16.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.84
Nodule 0
Rhizoplane 1.57
Rhizosphere 70.87
Stem 0
Stem Tuber 0
Unclassified 17.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_163455 2162886007 Bacteria 1410
2 SwRhRL2b_contig_2848454 2162886007 Bacteria 16274
3 JGI24737J22298_10000048 3300001990 Bacteria 34497
4 JGI24737J22298_10000197 3300001990 Bacteria 19645
5 JGI24735J21928_10000017 3300002067 Bacteria 114440
6 JGI25164J39214_1004393 3300002772 Unclassified 1632
7 JGI25165J46597_1001294 3300003214 Bacteria 14464
8 rootH1_10122695 3300003316 Bacteria 2572
9 rootH2_10059252 3300003320 Bacteria 7559
10 rootH2_10258077 3300003320 Bacteria 3896
11 rootL2_10318731 3300003322 Bacteria 1881
12 rootH1_10015020 3300003323 Bacteria 15697
13 JGI25160J50197_1004323 3300003354 Bacteria 6156
14 Ga0055534_1019344 3300003784 Bacteria 1170
15 Ga0065165_1003584 3300005262 Bacteria 10702
16 Ga0065714_10002551 3300005288 Bacteria 47503
17 Ga0065714_10016259 3300005288 Bacteria 2570
18 Ga0065714_10092052 3300005288 Bacteria 1889
19 Ga0065704_10000219 3300005289 Bacteria 83241
20 Ga0065704_10070542 3300005289 Bacteria 21184
21 Ga0065704_10079594 3300005289 Bacteria 4121
22 Ga0065704_10100074 3300005289 Bacteria 2287
23 Ga0065715_10347034 3300005293 Bacteria 957
24 Ga0070658_10192756 3300005327 Bacteria 1718
25 Ga0068869_100659048 3300005334 Unclassified 889
26 Ga0070682_100000261 3300005337 Bacteria 37950
27 Ga0068868_100166513 3300005338 Bacteria 1823
28 Ga0070660_100026707 3300005339 Bacteria 4302
29 Ga0070673_100003195 3300005364 Bacteria 10150
30 Ga0070688_100165248 3300005365 Unclassified 1523
31 Ga0070659_101868445 3300005366 Unclassified 538
32 Ga0070678_100002250 3300005456 Bacteria 10500
33 Ga0070662_100090738 3300005457 Bacteria 2294
34 Ga0068853_100006701 3300005539 Bacteria 9177
35 Ga0068853_100012611 3300005539 Bacteria 6878
36 Ga0070672_101973914 3300005543 Unclassified 525
37 Ga0068855_100000154 3300005563 Bacteria 87746
38 Ga0068855_100009344 3300005563 Bacteria 11839
39 Ga0068855_100045223 3300005563 Bacteria 5207
40 Ga0068857_100226866 3300005577 Bacteria 1707
41 Ga0068856_100002484 3300005614 Bacteria 18974
42 Ga0068856_100573688 3300005614 Bacteria 1149
43 Ga0068870_10009709 3300005840 Bacteria 4387
44 Ga0075366_10001304 3300006195 Bacteria 12426
45 Ga0097621_100000041 3300006237 Bacteria 66329
46 Ga0075370_10793041 3300006353 Bacteria 577
47 Ga0068871_100000153 3300006358 Bacteria 45540
48 Ga0068865_100001648 3300006881 Bacteria 13085
49 Ga0105244_10000058 3300009036 Bacteria 128877
50 Ga0105240_10024929 3300009093 Bacteria 7873
51 Ga0105240_11586767 3300009093 Bacteria 685
52 Ga0105241_10289756 3300009174 Unclassified 1401
53 Ga0105238_10012665 3300009551 Bacteria 8513
54 Ga0105239_10013219 3300010375 Bacteria 9173
55 Ga0105239_10018146 3300010375 Bacteria 7778
56 Ga0105239_10026573 3300010375 Bacteria 6371
57 Ga0105239_10037195 3300010375 Bacteria 5338
58 Ga0105246_10060215 3300011119 Bacteria 2637
59 Ga0157373_10000097 3300013100 Bacteria 71713
60 Ga0157371_10000258 3300013102 Bacteria 73082
61 Ga0157371_10000708 3300013102 Bacteria 39139
62 Ga0157371_10085052 3300013102 Bacteria 2241
63 Ga0157370_10004919 3300013104 Bacteria 15132
64 Ga0157370_10015711 3300013104 Bacteria 7688
65 Ga0157370_10313217 3300013104 Bacteria 1448
66 Ga0157370_10413237 3300013104 Bacteria 1242
67 Ga0157370_10594185 3300013104 Bacteria 1014
68 Ga0157370_11444985 3300013104 Bacteria 619
69 Ga0157369_10177312 3300013105 Bacteria 2243
70 Ga0157374_10001455 3300013296 Bacteria 20010
71 Ga0157378_10004989 3300013297 Bacteria 11641
72 Ga0163162_10000068 3300013306 Bacteria 97068
73 Ga0163162_10286138 3300013306 Bacteria 1780
74 Ga0163162_10504614 3300013306 Unclassified 1340
75 Ga0157372_10034909 3300013307 Bacteria 5534
76 Ga0157372_10039700 3300013307 Bacteria 5196
77 Ga0157375_10004903 3300013308 Bacteria 11633
78 Ga0157375_10048682 3300013308 Unclassified 4148
79 Ga0182006_1015399 3300015261 Unclassified 3278
80 Ga0182006_1062579 3300015261 Bacteria 1400
81 Ga0207427_100146 3300025231 Bacteria 81506
82 Ga0209437_100096 3300025233 Bacteria 233558
83 Ga0209026_1007599 3300025250 Bacteria 2404
84 Ga0209026_1010184 3300025250 Bacteria 1775
85 Ga0209026_1040665 3300025250 Bacteria 674
86 Ga0209148_1012120 3300025254 Bacteria 1584
87 Ga0209233_1000029 3300025261 Bacteria 641642
88 Ga0209675_1000033 3300025291 Bacteria 271576
89 Ga0207426_1000023 3300025302 Bacteria 545465
90 Ga0207647_10141614 3300025904 Bacteria 1409
91 Ga0207647_10154849 3300025904 Bacteria 1338
92 Ga0207647_10367158 3300025904 Bacteria 814
93 Ga0207645_10000569 3300025907 Bacteria 30576
94 Ga0207643_10123582 3300025908 Bacteria 1535
95 Ga0207705_10155055 3300025909 Bacteria 1718
96 Ga0207705_10383278 3300025909 Bacteria 1086
97 Ga0207654_10004784 3300025911 Bacteria 6859
98 Ga0207654_10218753 3300025911 Unclassified 1262
99 Ga0207695_10032354 3300025913 Bacteria 5724
100 Ga0207695_10063145 3300025913 Bacteria 3819
101 Ga0207671_10052785 3300025914 Bacteria 3013
102 Ga0207671_10054538 3300025914 Unclassified 2962
103 Ga0207657_10164015 3300025919 Bacteria 1803
104 Ga0207694_10090173 3300025924 Bacteria 2418
105 Ga0207706_11169652 3300025933 Bacteria 640
106 Ga0207709_10000552 3300025935 Bacteria 32029
107 Ga0207704_10000037 3300025938 Bacteria 93990
108 Ga0207689_10453156 3300025942 Bacteria 1072
109 Ga0207667_10002915 3300025949 Bacteria 21237
110 Ga0207667_10040569 3300025949 Bacteria 4957
111 Ga0207667_10047843 3300025949 Bacteria 4525
112 Ga0207667_10121555 3300025949 Bacteria 2691
113 Ga0207651_10104636 3300025960 Bacteria 2109
114 Ga0207651_11125644 3300025960 Bacteria 704
115 Ga0207677_10122225 3300026023 Bacteria 1961
116 Ga0207639_10008649 3300026041 Bacteria 6986
117 Ga0207639_10010855 3300026041 Bacteria 6315
118 Ga0207702_10007106 3300026078 Bacteria 9578
119 Ga0207702_11650486 3300026078 Bacteria 634
120 Ga0207674_10250341 3300026116 Bacteria 1719
121 Ga0207683_10006466 3300026121 Bacteria 10030
122 Ga0268266_10417510 3300028379 Unclassified 1271
123 Ga0307515_10001132 3300028794 Bacteria 61076
124 Ga0307515_10002920 3300028794 Bacteria 36261
125 Ga0307515_10389176 3300028794 Bacteria 1024
126 Ga0265338_10050631 3300028800 Bacteria 3752
127 Ga0265324_10204789 3300029957 Bacteria 670
128 Ga0316176_1072368 3300030732 Bacteria 13938
129 Ga0265327_10013138 3300031251 Bacteria 5519
130 Ga0265327_10031218 3300031251 Bacteria 2997
131 Ga0307508_10497223 3300031616 Bacteria 814
132 Ga0307405_10000001 3300031731 Bacteria 1731270
133 Ga0307405_10339185 3300031731 Bacteria 1155
134 Ga0307413_10187675 3300031824 Bacteria 1481
135 Ga0307406_10000086 3300031901 Bacteria 52871
136 Ga0307406_10009879 3300031901 Bacteria 5370
137 Ga0307406_10528684 3300031901 Unclassified 961
138 Ga0307407_10030394 3300031903 Bacteria 2913
139 Ga0307412_10000031 3300031911 Bacteria 207128
140 Ga0307412_10826035 3300031911 Bacteria 806
141 Ga0307414_10000603 3300032004 Bacteria 18495
142 Ga0307414_10010910 3300032004 Bacteria 5303
143 Ga0307414_10020886 3300032004 Bacteria 4091
144 Ga0307414_10038485 3300032004 Bacteria 3213
145 Ga0307411_10000005 3300032005 Bacteria 391311
146 Ga0395899_0073400 3300037312 Bacteria 2502
147 Ga0451802_0215207 3300041460 Bacteria 643
148 Ga0439448_0014496 3300042005 Bacteria 2378
149 Ga0466972_0024075 3300044658 Bacteria 3023
150 Ga0466965_0137614 3300044683 Bacteria 1270
151 Ga0495638_0068399 3300046460 Bacteria 2178
152 Ga0495638_0296940 3300046460 Bacteria 872
153 Ga0495650_0000081 3300046471 Bacteria 240957
154 Ga0495650_0059482 3300046471 Bacteria 1539
155 Ga0495585_0006975 3300046492 Bacteria 6954
156 Ga0495583_0013604 3300046506 Bacteria 4527
157 Ga0495583_0164688 3300046506 Unclassified 913
158 Ga0495610_0297972 3300046512 Bacteria 622
159 Ga0495616_0000921 3300046513 Bacteria 21150
160 Ga0495616_0002508 3300046513 Bacteria 12141
161 Ga0495631_0169202 3300046518 Bacteria 937
162 Ga0495632_0013694 3300046519 Bacteria 4616
163 Ga0495637_0028985 3300046520 Bacteria 2468
164 Ga0495648_0093580 3300046524 Bacteria 1676
165 Ga0495663_0000113 3300046525 Bacteria 33458
166 Ga0495668_0198726 3300046616 Bacteria 1098
167 Ga0495625_0000049 3300046660 Bacteria 197646
168 Ga0495625_0001185 3300046660 Bacteria 33419
169 Ga0495625_0013009 3300046660 Bacteria 6712
170 Ga0495625_0035389 3300046660 Bacteria 3681
171 Ga0495625_0106233 3300046660 Bacteria 1923
172 Ga0495671_0197909 3300046692 Bacteria 975
173 Ga0495649_0000014 3300046694 Bacteria 287408
174 Ga0495589_0097789 3300046794 Bacteria 1422
175 Ga0495686_0000643 3300047472 Bacteria 48144
176 Ga0495686_0001287 3300047472 Bacteria 28292
177 Ga0495686_0023759 3300047472 Bacteria 4037
178 Ga0495686_0142228 3300047472 Bacteria 1415
179 Ga0496102_0010710 3300048905 Bacteria 7900
180 Ga0496103_0326743 3300048906 Bacteria 986
181 Ga0496116_0000053 3300048919 Bacteria 291837
182 Ga0496117_0000089 3300048920 Bacteria 210551
183 Ga0496118_0000221 3300048921 Bacteria 99682
184 Ga0496119_0000038 3300048922 Bacteria 209546
185 Ga0496120_0095939 3300048923 Unclassified 1576
186 Ga0496121_0091536 3300048924 Bacteria 2374
187 Ga0496122_0000767 3300048925 Bacteria 62024
188 Ga0496122_0003884 3300048925 Bacteria 19157
189 Ga0496123_0000696 3300048926 Bacteria 55317
190 Ga0496124_0280938 3300048927 Bacteria 1214
191 Ga0496125_0000678 3300048928 Bacteria 56747
192 Ga0496125_0012766 3300048928 Bacteria 8305
193 Ga0496126_0001131 3300048929 Bacteria 44552
194 Ga0495678_013431 3300049459 Bacteria 3847
195 Ga0501034_0040336 3300049571 Bacteria 4725
196 Ga0501036_0203915 3300049572 Bacteria 1663
197 Ga0501043_0054557 3300049579 Bacteria 3139
198 Ga0501224_002194 3300049664 Bacteria 2650
199 Ga0501261_003388 3300049690 Bacteria 1955
200 Ga0501241_000140 3300049758 Bacteria 15966
201 Ga0501044_0261765 3300049823 Bacteria 1668
202 nmdc:mga0k408_4438_c1 3300050493 Bacteria 7446
203 nmdc:mga0k408_496_c1 3300050493 Bacteria 14108
204 nmdc:mga07m45_652540_c1 3300050496 Bacteria 606
205 Ga0500578_0000324 3300053086 Bacteria 58297
206 Ga0500618_018787 3300053125 Bacteria 1707
207 Ga0500559_0005668 3300053136 Bacteria 5714
208 Ga0500568_0106195 3300053139 Bacteria 1052
209 Ga0500568_0183417 3300053139 Bacteria 769
210 Ga0500579_223033 3300053143 Bacteria 654
211 Ga0500616_0067071 3300053153 Bacteria 1841
212 Ga0500622_0273913 3300053156 Bacteria 730
213 Ga0500661_005313 3300055283 Bacteria 2410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10528684 Ga0307406_105286842 122
2 3300031251 Ga0265327_10031218 Ga0265327_100312182 125
3 3300046525 Ga0495663_0000113 Ga0495663_0000113_141_599 129
4 3300053136 Ga0500559_0005668 Ga0500559_0005668_199_657 131
5 3300025250 Ga0209026_1007599 Ga0209026_10075992 132
6 3300049571 Ga0501034_0040336 Ga0501034_0040336_2763_3197 137
7 3300049572 Ga0501036_0203915 Ga0501036_0203915_378_812 137
8 3300049579 Ga0501043_0054557 Ga0501043_0054557_37_471 137
9 3300049823 Ga0501044_0261765 Ga0501044_0261765_388_822 137
10 3300053139 Ga0500568_0183417 Ga0500568_0183417_112_573 137
11 2162886007 SwRhRL2b_contig_163455 SwRhRL2b_0321.00002810 138
12 2162886007 SwRhRL2b_contig_2848454 SwRhRL2b_0392.00004540 138
13 3300001990 JGI24737J22298_10000048 JGI24737J22298_100000488 138
14 3300001990 JGI24737J22298_10000197 JGI24737J22298_100001978 138
15 3300002067 JGI24735J21928_10000017 JGI24735J21928_1000001782 138
16 3300002772 JGI25164J39214_1004393 JGI25164J39214_10043932 138
17 3300003214 JGI25165J46597_1001294 JGI25165J46597_10012947 138
18 3300003316 rootH1_10122695 rootH1_101226955 138
19 3300003320 rootH2_10059252 rootH2_100592525 138
20 3300003320 rootH2_10258077 rootH2_102580771 138
21 3300003322 rootL2_10318731 rootL2_103187312 138
22 3300003323 rootH1_10015020 rootH1_1001502016 138
23 3300003354 JGI25160J50197_1004323 JGI25160J50197_10043235 138
24 3300003784 Ga0055534_1019344 Ga0055534_10193443 138
25 3300005262 Ga0065165_1003584 Ga0065165_10035847 138
26 3300005288 Ga0065714_10002551 Ga0065714_1000255124 138
27 3300005288 Ga0065714_10016259 Ga0065714_100162592 138
28 3300005288 Ga0065714_10092052 Ga0065714_100920524 138
29 3300005289 Ga0065704_10000219 Ga0065704_1000021938 138
30 3300005289 Ga0065704_10070542 Ga0065704_100705426 138
31 3300005289 Ga0065704_10079594 Ga0065704_100795945 138
32 3300005289 Ga0065704_10100074 Ga0065704_101000743 138
33 3300005293 Ga0065715_10347034 Ga0065715_103470341 138
34 3300005327 Ga0070658_10192756 Ga0070658_101927562 138
35 3300005334 Ga0068869_100659048 Ga0068869_1006590482 138
36 3300005337 Ga0070682_100000261 Ga0070682_10000026135 138
37 3300005338 Ga0068868_100166513 Ga0068868_1001665132 138
38 3300005339 Ga0070660_100026707 Ga0070660_1000267075 138
39 3300005364 Ga0070673_100003195 Ga0070673_1000031953 138
40 3300005365 Ga0070688_100165248 Ga0070688_1001652482 138
41 3300005366 Ga0070659_101868445 Ga0070659_1018684451 138
42 3300005456 Ga0070678_100002250 Ga0070678_1000022506 138
43 3300005457 Ga0070662_100090738 Ga0070662_1000907381 138
44 3300005539 Ga0068853_100006701 Ga0068853_1000067014 138
45 3300005539 Ga0068853_100012611 Ga0068853_1000126113 138
46 3300005543 Ga0070672_101973914 Ga0070672_1019739141 138
47 3300005563 Ga0068855_100000154 Ga0068855_10000015420 138
48 3300005563 Ga0068855_100009344 Ga0068855_1000093446 138
49 3300005563 Ga0068855_100045223 Ga0068855_1000452236 138
50 3300005577 Ga0068857_100226866 Ga0068857_1002268662 138
51 3300005614 Ga0068856_100002484 Ga0068856_10000248415 138
52 3300005614 Ga0068856_100573688 Ga0068856_1005736882 138
53 3300005840 Ga0068870_10009709 Ga0068870_100097095 138
54 3300006195 Ga0075366_10001304 Ga0075366_1000130414 138
55 3300006237 Ga0097621_100000041 Ga0097621_10000004112 138
56 3300006353 Ga0075370_10793041 Ga0075370_107930411 138
57 3300006358 Ga0068871_100000153 Ga0068871_10000015326 138
58 3300006881 Ga0068865_100001648 Ga0068865_1000016489 138
59 3300009036 Ga0105244_10000058 Ga0105244_1000005880 138
60 3300009093 Ga0105240_10024929 Ga0105240_100249291 138
61 3300009093 Ga0105240_11586767 Ga0105240_115867671 138
62 3300009174 Ga0105241_10289756 Ga0105241_102897562 138
63 3300009551 Ga0105238_10012665 Ga0105238_100126653 138
64 3300010375 Ga0105239_10013219 Ga0105239_100132194 138
65 3300010375 Ga0105239_10018146 Ga0105239_100181463 138
66 3300010375 Ga0105239_10026573 Ga0105239_100265735 138
67 3300010375 Ga0105239_10037195 Ga0105239_100371954 138
68 3300011119 Ga0105246_10060215 Ga0105246_100602152 138
69 3300013100 Ga0157373_10000097 Ga0157373_1000009719 138
70 3300013102 Ga0157371_10000258 Ga0157371_1000025812 138
71 3300013102 Ga0157371_10000708 Ga0157371_100007089 138
72 3300013102 Ga0157371_10085052 Ga0157371_100850522 138
73 3300013104 Ga0157370_10004919 Ga0157370_100049195 138
74 3300013104 Ga0157370_10015711 Ga0157370_100157116 138
75 3300013104 Ga0157370_10313217 Ga0157370_103132172 138
76 3300013104 Ga0157370_10413237 Ga0157370_104132372 138
77 3300013104 Ga0157370_10594185 Ga0157370_105941852 138
78 3300013104 Ga0157370_11444985 Ga0157370_114449851 138
79 3300013105 Ga0157369_10177312 Ga0157369_101773122 138
80 3300013296 Ga0157374_10001455 Ga0157374_100014555 138
81 3300013297 Ga0157378_10004989 Ga0157378_100049894 138
82 3300013306 Ga0163162_10000068 Ga0163162_1000006818 138
83 3300013306 Ga0163162_10286138 Ga0163162_102861383 138
84 3300013306 Ga0163162_10504614 Ga0163162_105046142 138
85 3300013307 Ga0157372_10034909 Ga0157372_100349094 138
86 3300013307 Ga0157372_10039700 Ga0157372_100397005 138
87 3300013308 Ga0157375_10004903 Ga0157375_100049037 138
88 3300013308 Ga0157375_10048682 Ga0157375_100486823 138
89 3300015261 Ga0182006_1015399 Ga0182006_10153993 138
90 3300015261 Ga0182006_1062579 Ga0182006_10625791 138
91 3300025231 Ga0207427_100146 Ga0207427_10014632 138
92 3300025233 Ga0209437_100096 Ga0209437_10009668 138
93 3300025250 Ga0209026_1010184 Ga0209026_10101842 138
94 3300025250 Ga0209026_1040665 Ga0209026_10406652 138
95 3300025254 Ga0209148_1012120 Ga0209148_10121203 138
96 3300025261 Ga0209233_1000029 Ga0209233_1000029444 138
97 3300025291 Ga0209675_1000033 Ga0209675_1000033100 138
98 3300025302 Ga0207426_1000023 Ga0207426_1000023428 138
99 3300025904 Ga0207647_10141614 Ga0207647_101416142 138
100 3300025904 Ga0207647_10154849 Ga0207647_101548492 138
101 3300025904 Ga0207647_10367158 Ga0207647_103671582 138
102 3300025907 Ga0207645_10000569 Ga0207645_1000056915 138
103 3300025908 Ga0207643_10123582 Ga0207643_101235822 138
104 3300025909 Ga0207705_10155055 Ga0207705_101550552 138
105 3300025909 Ga0207705_10383278 Ga0207705_103832782 138
106 3300025911 Ga0207654_10004784 Ga0207654_100047844 138
107 3300025911 Ga0207654_10218753 Ga0207654_102187532 138
108 3300025913 Ga0207695_10032354 Ga0207695_100323541 138
109 3300025913 Ga0207695_10063145 Ga0207695_100631453 138
110 3300025914 Ga0207671_10052785 Ga0207671_100527854 138
111 3300025914 Ga0207671_10054538 Ga0207671_100545382 138
112 3300025919 Ga0207657_10164015 Ga0207657_101640153 138
113 3300025924 Ga0207694_10090173 Ga0207694_100901732 138
114 3300025933 Ga0207706_11169652 Ga0207706_111696522 138
115 3300025935 Ga0207709_10000552 Ga0207709_1000055224 138
116 3300025938 Ga0207704_10000037 Ga0207704_100000379 138
117 3300025942 Ga0207689_10453156 Ga0207689_104531562 138
118 3300025949 Ga0207667_10002915 Ga0207667_1000291524 138
119 3300025949 Ga0207667_10040569 Ga0207667_100405695 138
120 3300025949 Ga0207667_10047843 Ga0207667_100478437 138
121 3300025949 Ga0207667_10121555 Ga0207667_101215553 138
122 3300025960 Ga0207651_10104636 Ga0207651_101046362 138
123 3300025960 Ga0207651_11125644 Ga0207651_111256442 138
124 3300026023 Ga0207677_10122225 Ga0207677_101222252 138
125 3300026041 Ga0207639_10008649 Ga0207639_100086493 138
126 3300026041 Ga0207639_10010855 Ga0207639_100108554 138
127 3300026078 Ga0207702_10007106 Ga0207702_100071064 138
128 3300026078 Ga0207702_11650486 Ga0207702_116504861 138
129 3300026116 Ga0207674_10250341 Ga0207674_102503412 138
130 3300026121 Ga0207683_10006466 Ga0207683_100064664 138
131 3300028379 Ga0268266_10417510 Ga0268266_104175102 138
132 3300028794 Ga0307515_10001132 Ga0307515_1000113252 138
133 3300028794 Ga0307515_10002920 Ga0307515_1000292016 138
134 3300028794 Ga0307515_10389176 Ga0307515_103891761 138
135 3300028800 Ga0265338_10050631 Ga0265338_100506314 138
136 3300029957 Ga0265324_10204789 Ga0265324_102047891 138
137 3300030732 Ga0316176_1072368 Ga0316176_10723687 138
138 3300031251 Ga0265327_10013138 Ga0265327_100131384 138
139 3300031616 Ga0307508_10497223 Ga0307508_104972231 138
140 3300031731 Ga0307405_10000001 Ga0307405_100000011161 138
141 3300031731 Ga0307405_10339185 Ga0307405_103391852 138
142 3300031824 Ga0307413_10187675 Ga0307413_101876752 138
143 3300031901 Ga0307406_10000086 Ga0307406_1000008611 138
144 3300031901 Ga0307406_10009879 Ga0307406_100098796 138
145 3300031903 Ga0307407_10030394 Ga0307407_100303943 138
146 3300031911 Ga0307412_10000031 Ga0307412_1000003180 138
147 3300031911 Ga0307412_10826035 Ga0307412_108260352 138
148 3300032004 Ga0307414_10000603 Ga0307414_100006032 138
149 3300032004 Ga0307414_10010910 Ga0307414_100109103 138
150 3300032004 Ga0307414_10020886 Ga0307414_100208862 138
151 3300032004 Ga0307414_10038485 Ga0307414_100384853 138
152 3300032005 Ga0307411_10000005 Ga0307411_10000005142 138
153 3300037312 Ga0395899_0073400 Ga0395899_0073400_136_600 138
154 3300041460 Ga0451802_0215207 Ga0451802_0215207_28_492 138
155 3300042005 Ga0439448_0014496 Ga0439448_0014496_226_690 138
156 3300044658 Ga0466972_0024075 Ga0466972_0024075_1033_1491 138
157 3300044683 Ga0466965_0137614 Ga0466965_0137614_460_906 138
158 3300046460 Ga0495638_0068399 Ga0495638_0068399_1495_1959 138
159 3300046460 Ga0495638_0296940 Ga0495638_0296940_13_477 138
160 3300046471 Ga0495650_0000081 Ga0495650_0000081_234191_234655 138
161 3300046471 Ga0495650_0059482 Ga0495650_0059482_658_1122 138
162 3300046492 Ga0495585_0006975 Ga0495585_0006975_2405_2869 138
163 3300046506 Ga0495583_0013604 Ga0495583_0013604_2994_3458 138
164 3300046506 Ga0495583_0164688 Ga0495583_0164688_373_837 138
165 3300046512 Ga0495610_0297972 Ga0495610_0297972_126_590 138
166 3300046513 Ga0495616_0000921 Ga0495616_0000921_18202_18666 138
167 3300046513 Ga0495616_0002508 Ga0495616_0002508_1872_2336 138
168 3300046518 Ga0495631_0169202 Ga0495631_0169202_38_502 138
169 3300046519 Ga0495632_0013694 Ga0495632_0013694_2605_3021 138
170 3300046520 Ga0495637_0028985 Ga0495637_0028985_87_551 138
171 3300046524 Ga0495648_0093580 Ga0495648_0093580_1111_1575 138
172 3300046616 Ga0495668_0198726 Ga0495668_0198726_184_648 138
173 3300046660 Ga0495625_0000049 Ga0495625_0000049_178722_179186 138
174 3300046660 Ga0495625_0001185 Ga0495625_0001185_16363_16827 138
175 3300046660 Ga0495625_0013009 Ga0495625_0013009_2572_3039 138
176 3300046660 Ga0495625_0035389 Ga0495625_0035389_1062_1526 138
177 3300046660 Ga0495625_0106233 Ga0495625_0106233_912_1376 138
178 3300046692 Ga0495671_0197909 Ga0495671_0197909_467_931 138
179 3300046694 Ga0495649_0000014 Ga0495649_0000014_18461_18925 138
180 3300046794 Ga0495589_0097789 Ga0495589_0097789_331_795 138
181 3300047472 Ga0495686_0000643 Ga0495686_0000643_8262_8726 138
182 3300047472 Ga0495686_0001287 Ga0495686_0001287_18706_19170 138
183 3300047472 Ga0495686_0023759 Ga0495686_0023759_1920_2384 138
184 3300047472 Ga0495686_0142228 Ga0495686_0142228_802_1266 138
185 3300048905 Ga0496102_0010710 Ga0496102_0010710_1401_1859 138
186 3300048906 Ga0496103_0326743 Ga0496103_0326743_504_962 138
187 3300048919 Ga0496116_0000053 Ga0496116_0000053_84218_84676 138
188 3300048920 Ga0496117_0000089 Ga0496117_0000089_71974_72432 138
189 3300048921 Ga0496118_0000221 Ga0496118_0000221_817_1275 138
190 3300048922 Ga0496119_0000038 Ga0496119_0000038_71967_72425 138
191 3300048923 Ga0496120_0095939 Ga0496120_0095939_918_1382 138
192 3300048924 Ga0496121_0091536 Ga0496121_0091536_906_1364 138
193 3300048925 Ga0496122_0000767 Ga0496122_0000767_28303_28761 138
194 3300048925 Ga0496122_0003884 Ga0496122_0003884_16756_17214 138
195 3300048926 Ga0496123_0000696 Ga0496123_0000696_29661_30119 138
196 3300048927 Ga0496124_0280938 Ga0496124_0280938_161_619 138
197 3300048928 Ga0496125_0000678 Ga0496125_0000678_6573_7031 138
198 3300048928 Ga0496125_0012766 Ga0496125_0012766_884_1342 138
199 3300048929 Ga0496126_0001131 Ga0496126_0001131_3878_4336 138
200 3300049459 Ga0495678_013431 Ga0495678_013431_2479_2943 138
201 3300049664 Ga0501224_002194 Ga0501224_002194_2137_2595 138
202 3300049690 Ga0501261_003388 Ga0501261_003388_1177_1635 138
203 3300049758 Ga0501241_000140 Ga0501241_000140_10930_11394 138
204 3300050493 nmdc:mga0k408_4438_c1 nmdc:mga0k408_4438_c1_4682_5146 138
205 3300050493 nmdc:mga0k408_496_c1 nmdc:mga0k408_496_c1_13335_13799 138
206 3300050496 nmdc:mga07m45_652540_c1 nmdc:mga07m45_652540_c1_75_539 138
207 3300053086 Ga0500578_0000324 Ga0500578_0000324_9163_9621 138
208 3300053125 Ga0500618_018787 Ga0500618_018787_589_1053 138
209 3300053139 Ga0500568_0106195 Ga0500568_0106195_455_919 138
210 3300053143 Ga0500579_223033 Ga0500579_223033_19_483 138
211 3300053153 Ga0500616_0067071 Ga0500616_0067071_945_1409 138
212 3300053156 Ga0500622_0273913 Ga0500622_0273913_142_606 138
213 3300055283 Ga0500661_005313 Ga0500661_005313_1452_1883 138
214 iso_pu_bacteria 2511231000 2511231303 138
215 iso_pu_bacteria 2582581278 2585141554 138
216 iso_pu_bacteria 2582581281 2585156765 138
217 iso_pu_bacteria 2582581282 2585160932 138
218 iso_pu_bacteria 2585428045 2587680602 138
219 iso_pu_bacteria 2585428060 2587749515 138
220 iso_pu_bacteria 2585428182 2588208158 138
221 iso_pu_bacteria 2585428183 2588213266 138
222 iso_pu_bacteria 2585428185 2588223849 138
223 iso_pu_bacteria 2588253712 2588446519 138
224 iso_pu_bacteria 2588254255 2590600768 138
225 iso_pu_bacteria 2588254257 2590611975 138
226 iso_pu_bacteria 2599185184 2599480725 138
227 iso_pu_bacteria 2643221667 2644370057 138
228 iso_pu_bacteria 2728369107 2729198662 138
229 iso_pu_bacteria 2738541279 2738736461 138
230 iso_pu_bacteria 2738541285 2738768904 138
231 iso_pu_bacteria 2738543007 2739218043 138
232 iso_pu_bacteria 2739367857 2740003544 138
233 iso_pu_bacteria 2739367858 2740008361 138
234 iso_pu_bacteria 2739367874 2740057682 138
235 iso_pu_bacteria 2765235839 2765572651 138
236 iso_pu_bacteria 2775506739 2775672870 138
237 iso_pu_bacteria 2816332188 2816873010 138
238 iso_pu_bacteria 2818991460 2819677462 138
239 iso_pu_bacteria 2857613821 2857617254 138
240 iso_pu_bacteria 2857618242 2857619276 138
241 iso_pu_bacteria 2889290771 2889291616 138
242 iso_pu_bacteria 2904419702 2904420836 138
243 iso_pu_bacteria 2904555929 2904559406 138
244 iso_pu_bacteria 2910245624 2910249919 138
245 iso_pu_bacteria 2919097161 2919099288 138
246 iso_pu_bacteria 2919186247 2919186815 138
247 iso_pu_bacteria 2919399522 2919400307 138
248 iso_pu_bacteria 2919399522 2919402961 138
249 iso_pu_bacteria 2928078545 2928081616 138
250 iso_pu_bacteria 2928147474 2928150354 138
251 iso_pu_bacteria 2929154850 2929157230 138
252 iso_pu_bacteria 2929239360 2929241806 138
253 iso_pu_bacteria 2932082852 2932085177 138
254 iso_pu_bacteria 2939664404 2939665916 138

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.7223 1 125
7dys-assembly1.cif.gz_D cryoem structure of full length mouse trpml2 0.7098 30 124
3t6g-assembly2.cif.gz_D structure of the complex between nsp3 (shep1) and p130cas 0.6969 2 123
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.6595 1 125
8sik-assembly1.cif.gz_A kcnq1 with voltage sensor in the up conformation 0.6555 2 120
ID Description Score Start End Superfamily
af_G5EGK1_821_936_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6911 5 123 1.20.120.230
af_Q61140_738_874_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6907 2 123 1.20.120.230
af_Q14511_698_834_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6848 2 123 1.20.120.230
af_P56945_734_870_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6773 2 123 1.20.120.230
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6758 2 123 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A1P8KLF6-F1-model_v4 Cytochrome B 0.9846 2 126 GO:0016020
AF-A0A142HEJ8-F1-model_v4 deleted 0.9835 3 126
AF-A0A3D4CJ96-F1-model_v4 Cytochrome B 0.9811 2 126 GO:0016020
AF-A0A3B8W4F8-F1-model_v4 Cytochrome B 0.981 2 123 GO:0016020
AF-A0A419W730-F1-model_v4 Cytochrome b561-like protein 0.9805 2 126 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.09 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map