F365157

General Info

Members Datasets Scaffolds Average Seq Length
254 175 508 145

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0004849|Ga0495640_0004849_2660_3082
Length 140
Sequence LILVDANLLIYASAPETPQHGAARDWLDERLNGSARVALPWPSLLAFIRIVSNPKLFEGASLVNAQAQVKAWLDLPITWIPNPTEEHPRLLADLLAKEAHHRLVPDAHLAALALEHGLVLCSSDGDFARFPELRWENPLT

Samples

Sample ID Description Type Environment
1 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.36
Rhizosphere 96.85
Stem 0
Stem Tuber 0
Unclassified 35.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495640_0004849 3300046533 Bacteria 10709
2 JGI24746J21847_1002605 3300001977 Bacteria 2860
3 Ga0065704_10435157 3300005289 Unclassified 719
4 Ga0065715_10022578 3300005293 Bacteria 1368
5 Ga0070683_100000035 3300005329 Bacteria 122362
6 Ga0070690_100081028 3300005330 Unclassified 2123
7 Ga0068869_100062478 3300005334 Bacteria 2734
8 Ga0070687_100061419 3300005343 Unclassified 1986
9 Ga0070661_100523190 3300005344 Unclassified 952
10 Ga0070668_100027972 3300005347 Bacteria 4279
11 Ga0070669_100014936 3300005353 Bacteria 5534
12 Ga0070671_100294915 3300005355 Bacteria 1380
13 Ga0070671_100544815 3300005355 Unclassified 1000
14 Ga0070673_100254313 3300005364 Unclassified 1532
15 Ga0070659_100249662 3300005366 Unclassified 1470
16 Ga0070667_100152374 3300005367 Bacteria 2031
17 Ga0070703_10112959 3300005406 Unclassified 974
18 Ga0070714_102054768 3300005435 Unclassified 557
19 Ga0070711_101579699 3300005439 Unclassified 573
20 Ga0070700_100251749 3300005441 Bacteria 1267
21 Ga0070694_100202119 3300005444 Unclassified 1482
22 Ga0070708_100398464 3300005445 Bacteria 1298
23 Ga0070678_100025600 3300005456 Bacteria 3973
24 Ga0070662_100008423 3300005457 Bacteria 6721
25 Ga0068867_100318231 3300005459 Unclassified 1288
26 Ga0070699_100215469 3300005518 Bacteria 1710
27 Ga0070684_100000037 3300005535 Bacteria 95058
28 Ga0068853_102294835 3300005539 Unclassified 523
29 Ga0070672_100422246 3300005543 Unclassified 1145
30 Ga0070686_100194003 3300005544 Unclassified 1451
31 Ga0070704_100309653 3300005549 Unclassified 1319
32 Ga0070704_100496462 3300005549 Unclassified 1058
33 Ga0070664_100000654 3300005564 Bacteria 26479
34 Ga0068859_100269358 3300005617 Bacteria 1795
35 Ga0068859_100475963 3300005617 Bacteria 1344
36 Ga0068864_100106822 3300005618 Bacteria 2490
37 Ga0068861_100144349 3300005719 Unclassified 1946
38 Ga0068861_102015595 3300005719 Unclassified 576
39 Ga0068861_102226658 3300005719 Bacteria 549
40 Ga0068870_10154017 3300005840 Unclassified 1356
41 Ga0068870_10951030 3300005840 Bacteria 610
42 Ga0068863_102710941 3300005841 Unclassified 504
43 Ga0068858_100420977 3300005842 Unclassified 1284
44 Ga0068860_100034817 3300005843 Unclassified 4832
45 Ga0068862_100019987 3300005844 Bacteria 5590
46 Ga0068862_101051094 3300005844 Unclassified 807
47 Ga0070712_100000152 3300006175 Bacteria 36965
48 Ga0097621_100211990 3300006237 Bacteria 1685
49 Ga0068871_100849716 3300006358 Bacteria 844
50 Ga0075428_100142006 3300006844 Unclassified 2610
51 Ga0075428_100489218 3300006844 Unclassified 1316
52 Ga0075428_100648291 3300006844 Unclassified 1126
53 Ga0075428_100750999 3300006844 Unclassified 1038
54 Ga0075430_100006478 3300006846 Bacteria 9867
55 Ga0075430_100036645 3300006846 Bacteria 4159
56 Ga0075430_100358303 3300006846 Unclassified 1204
57 Ga0075430_100453630 3300006846 Unclassified 1058
58 Ga0075431_100123979 3300006847 Bacteria 2665
59 Ga0075431_100695821 3300006847 Unclassified 994
60 Ga0075433_10000920 3300006852 Bacteria 20720
61 Ga0075433_10015154 3300006852 Bacteria 6316
62 Ga0075433_10159472 3300006852 Bacteria 2007
63 Ga0075433_11660731 3300006852 Unclassified 550
64 Ga0075434_100014863 3300006871 Bacteria 7447
65 Ga0075434_100081248 3300006871 Unclassified 3238
66 Ga0075434_100500576 3300006871 Unclassified 1236
67 Ga0075429_100021143 3300006880 Bacteria 5641
68 Ga0097620_100269362 3300006931 Bacteria 1795
69 Ga0097620_100475939 3300006931 Bacteria 1344
70 Ga0075435_100031963 3300007076 Bacteria 4153
71 Ga0105240_10102105 3300009093 Unclassified 3486
72 Ga0111539_10002878 3300009094 Bacteria 22847
73 Ga0111539_10651775 3300009094 Unclassified 1226
74 Ga0111539_12404032 3300009094 Unclassified 611
75 Ga0114129_10351490 3300009147 Bacteria 1952
76 Ga0114129_10485707 3300009147 Bacteria 1615
77 Ga0114129_10696922 3300009147 Bacteria 1306
78 Ga0105242_11533374 3300009176 Unclassified 698
79 Ga0105249_10182665 3300009553 Unclassified 2042
80 Ga0105246_10059389 3300011119 Bacteria 2653
81 Ga0157315_1008397 3300012508 Unclassified 862
82 Ga0157370_10685761 3300013104 Bacteria 935
83 Ga0157374_10925503 3300013296 Unclassified 890
84 Ga0163162_10042183 3300013306 Bacteria 4566
85 Ga0157375_10279585 3300013308 Unclassified 1832
86 Ga0157380_10111329 3300014326 Bacteria 2301
87 Ga0157377_10070126 3300014745 Bacteria 2024
88 Ga0157379_10007406 3300014968 Bacteria 9497
89 Ga0157376_10344111 3300014969 Unclassified 1425
90 Ga0163161_10151647 3300017792 Unclassified 1762
91 Ga0207697_10024251 3300025315 Bacteria 2484
92 Ga0207682_10032661 3300025893 Bacteria 2093
93 Ga0207688_10000448 3300025901 Bacteria 19549
94 Ga0207647_10395024 3300025904 Unclassified 780
95 Ga0207645_10067774 3300025907 Bacteria 2281
96 Ga0207643_10001060 3300025908 Bacteria 16259
97 Ga0207695_10116031 3300025913 Unclassified 2652
98 Ga0207693_10038508 3300025915 Bacteria 3765
99 Ga0207663_11340472 3300025916 Unclassified 576
100 Ga0207662_10007717 3300025918 Bacteria 5861
101 Ga0207681_10011859 3300025923 Bacteria 5364
102 Ga0207659_10734635 3300025926 Unclassified 846
103 Ga0207659_11120341 3300025926 Bacteria 677
104 Ga0207690_10133156 3300025932 Bacteria 1822
105 Ga0207706_10013090 3300025933 Bacteria 7549
106 Ga0207691_10279916 3300025940 Unclassified 1435
107 Ga0207689_10125652 3300025942 Unclassified 2110
108 Ga0207689_10150754 3300025942 Bacteria 1916
109 Ga0207661_10000008 3300025944 Bacteria 451211
110 Ga0207679_10039441 3300025945 Bacteria 3372
111 Ga0207712_10074605 3300025961 Unclassified 2450
112 Ga0207668_10617158 3300025972 Unclassified 946
113 Ga0207658_11272730 3300025986 Unclassified 672
114 Ga0207677_10098994 3300026023 Unclassified 2140
115 Ga0207703_10713407 3300026035 Unclassified 954
116 Ga0207708_10009589 3300026075 Bacteria 7178
117 Ga0207648_10012763 3300026089 Bacteria 7851
118 Ga0207676_10036993 3300026095 Bacteria 3717
119 Ga0207675_100001882 3300026118 Bacteria 20970
120 Ga0207683_10029327 3300026121 Bacteria 4763
121 Ga0209983_1059472 3300027665 Unclassified 843
122 Ga0209971_1057770 3300027682 Unclassified 938
123 Ga0209966_1170933 3300027695 Unclassified 509
124 Ga0207428_10016685 3300027907 Bacteria 6316
125 Ga0207428_10046167 3300027907 Unclassified 3504
126 Ga0268266_10219987 3300028379 Bacteria 1745
127 Ga0268265_10152417 3300028380 Unclassified 1951
128 Ga0268265_11162803 3300028380 Bacteria 768
129 Ga0265323_10002723 3300028653 Bacteria 7965
130 Ga0265325_10348101 3300031241 Unclassified 655
131 Ga0265316_10001397 3300031344 Bacteria 25964
132 Ga0265316_10026290 3300031344 Bacteria 4844
133 Ga0265316_10116101 3300031344 Bacteria 2023
134 Ga0265316_10194891 3300031344 Bacteria 1504
135 Ga0265316_10342423 3300031344 Unclassified 1083
136 Ga0265316_10996847 3300031344 Unclassified 583
137 Ga0307405_10345353 3300031731 Unclassified 1146
138 Ga0307413_10611599 3300031824 Bacteria 893
139 Ga0307412_11591948 3300031911 Bacteria 596
140 Ga0307415_101052460 3300032126 Bacteria 759
141 Ga0373958_0040340 3300034819 Unclassified 952
142 Ga0373941_0043978 3300035115 Unclassified 1392
143 Ga0373946_0290949 3300035171 Unclassified 806
144 Ga0373931_0130646 3300035691 Unclassified 1445
145 Ga0373947_0822122 3300035725 Bacteria 634
146 Ga0373937_1158597 3300036401 Unclassified 722
147 Ga0373925_0021017 3300037068 Bacteria 4755
148 Ga0436365_0123954 3300039437 Bacteria 4748
149 Ga0436362_0011928 3300039453 Bacteria 3133
150 Ga0439453_0149586 3300041408 Bacteria 553
151 Ga0451800_1453073 3300041459 Bacteria 940
152 Ga0451853_1734547 3300041512 Bacteria 1427
153 Ga0439435_0001328 3300042436 Bacteria 4513
154 Ga0439435_0038416 3300042436 Bacteria 1331
155 Ga0439460_0299026 3300042461 Unclassified 562
156 Ga0451577_0149283 3300042876 Bacteria 2102
157 Ga0451576_0510644 3300045051 Bacteria 1263
158 Ga0466967_1937719 3300045976 Bacteria 586
159 Ga0495638_0047924 3300046460 Bacteria 2677
160 Ga0495669_0457901 3300046684 Unclassified 619
161 Ga0495674_0000024 3300047319 Bacteria 141746
162 Ga0495593_0033033 3300047673 Bacteria 2819
163 Ga0496101_0207760 3300048904 Unclassified 1516
164 Ga0496102_0964342 3300048905 Bacteria 774
165 Ga0496109_0428232 3300048912 Bacteria 1250
166 Ga0496110_0541489 3300048913 Unclassified 1058
167 Ga0496112_0338033 3300048915 Unclassified 1449
168 Ga0501031_0015630 3300049568 Bacteria 4927
169 Ga0501032_0099603 3300049569 Bacteria 1925
170 Ga0501032_0711271 3300049569 Unclassified 636
171 Ga0501033_0048185 3300049570 Bacteria 3165
172 Ga0501033_0519261 3300049570 Unclassified 823
173 Ga0501036_0029538 3300049572 Bacteria 4630
174 Ga0501036_0330839 3300049572 Bacteria 1273
175 Ga0501036_0498102 3300049572 Bacteria 1014
176 Ga0501037_0025296 3300049573 Bacteria 4385
177 Ga0501038_0002057 3300049574 Bacteria 18626
178 Ga0501039_0016341 3300049575 Bacteria 5687
179 Ga0501039_0483071 3300049575 Bacteria 973
180 Ga0501040_0026574 3300049576 Bacteria 3893
181 Ga0501041_0010597 3300049577 Bacteria 5434
182 Ga0501041_0185665 3300049577 Bacteria 1302
183 Ga0501042_0009155 3300049578 Bacteria 6585
184 Ga0501042_0135010 3300049578 Bacteria 1779
185 Ga0501043_0010538 3300049579 Bacteria 7237
186 Ga0501046_0104254 3300049580 Bacteria 2173
187 Ga0501046_1138209 3300049580 Bacteria 538
188 Ga0501048_0012115 3300049582 Bacteria 6426
189 Ga0501048_0040517 3300049582 Bacteria 3338
190 Ga0501048_0077745 3300049582 Bacteria 2342
191 Ga0501048_0361930 3300049582 Unclassified 1035
192 Ga0501048_0943120 3300049582 Unclassified 621
193 Ga0501068_0009535 3300049584 Bacteria 5435
194 Ga0501069_0018992 3300049585 Bacteria 3712
195 Ga0501070_0014080 3300049586 Bacteria 6733
196 Ga0501071_0001915 3300049587 Bacteria 12387
197 Ga0501071_0009102 3300049587 Bacteria 6593
198 Ga0501071_0364392 3300049587 Unclassified 1101
199 Ga0501072_0043971 3300049588 Bacteria 3512
200 Ga0501073_0056873 3300049589 Bacteria 2735
201 Ga0501074_0043103 3300049590 Bacteria 3265
202 Ga0501075_0070059 3300049591 Bacteria 2650
203 Ga0501075_0320423 3300049591 Bacteria 1181
204 Ga0501075_0907326 3300049591 Unclassified 670
205 Ga0501076_0024577 3300049592 Bacteria 4658
206 Ga0501076_0041475 3300049592 Bacteria 3621
207 Ga0501076_0085594 3300049592 Bacteria 2533
208 Ga0501076_0142603 3300049592 Bacteria 1947
209 Ga0501076_0324956 3300049592 Unclassified 1262
210 Ga0501076_0497771 3300049592 Bacteria 1004
211 Ga0501076_0556420 3300049592 Unclassified 946
212 Ga0501076_1015681 3300049592 Bacteria 683
213 Ga0501079_0014596 3300049741 Bacteria 5990
214 Ga0501079_0294380 3300049741 Bacteria 1269
215 Ga0501079_0683348 3300049741 Unclassified 808
216 Ga0501080_0029553 3300049742 Bacteria 5102
217 Ga0501081_0007368 3300049743 Bacteria 7141
218 Ga0501081_0009315 3300049743 Bacteria 6399
219 Ga0501083_0006865 3300049744 Bacteria 8081
220 Ga0501083_0027163 3300049744 Bacteria 3951
221 Ga0501035_0001451 3300049822 Bacteria 24293
222 Ga0501044_0207323 3300049823 Bacteria 1916
223 Ga0501045_0023232 3300049824 Bacteria 4443
224 nmdc:mga05p37_314425_c1 3300050507 Bacteria 1856
225 nmdc:mga05p37_379718_c1 3300050507 Bacteria 1656
226 nmdc:mga05p37_446148_c1 3300050507 Unclassified 1499
227 nmdc:mga05p37_532248_c1 3300050507 Bacteria 1342
228 nmdc:mga09592_1619_c1 3300050508 Bacteria 18116
229 nmdc:mga09592_3258_c1 3300050508 Bacteria 13136
230 nmdc:mga0qj67_200673_c1 3300050509 Unclassified 1621
231 nmdc:mga0qj67_70_c1 3300050509 Bacteria 73245
232 nmdc:mga0qj67_87547_c1 3300050509 Bacteria 2500
233 nmdc:mga06r32_181941_c1 3300050510 Unclassified 2088
234 nmdc:mga06r32_27230_c1 3300050510 Bacteria 5338
235 nmdc:mga06r32_281660_c1 3300050510 Bacteria 1649
236 nmdc:mga06r32_4305_c1 3300050510 Bacteria 12744
237 nmdc:mga08y16_130745_c1 3300050511 Bacteria 2611
238 nmdc:mga08y16_14454_c1 3300050511 Bacteria 8304
239 nmdc:mga0n895_29538_c1 3300050512 Bacteria 5230
240 nmdc:mga0n895_5992_c1 3300050512 Bacteria 10237
241 nmdc:mga0rr50_1019057_c1 3300050513 Unclassified 705
242 nmdc:mga0rr50_229635_c1 3300050513 Unclassified 1535
243 nmdc:mga0rr50_28342_c1 3300050513 Bacteria 3935
244 nmdc:mga08x19_10786_c1 3300050514 Bacteria 5493
245 nmdc:mga0a205_2040_c1 3300050515 Bacteria 17638
246 nmdc:mga0a205_3340_c1 3300050515 Bacteria 14294
247 nmdc:mga0a205_8740_c1 3300050515 Bacteria 9225
248 Ga0501084_0028648 3300054114 Bacteria 4656
249 Ga0501084_0658936 3300054114 Unclassified 884
250 Ga0587067_086592 3300059640 Unclassified 703
251 Ga0501082_0026148 3300060353 Bacteria 5030
252 Ga0501082_0814422 3300060353 Unclassified 817
253 Ga0501082_0821082 3300060353 Bacteria 813
254 Ga0530510_0070530 3300061734 Bacteria 2536
255 Ga0495640_0004849
256 JGI24746J21847_1002605
257 Ga0065704_10435157
258 Ga0065715_10022578
259 Ga0070683_100000035
260 Ga0070690_100081028
261 Ga0068869_100062478
262 Ga0070687_100061419
263 Ga0070661_100523190
264 Ga0070668_100027972
265 Ga0070669_100014936
266 Ga0070671_100294915
267 Ga0070671_100544815
268 Ga0070673_100254313
269 Ga0070659_100249662
270 Ga0070667_100152374
271 Ga0070703_10112959
272 Ga0070714_102054768
273 Ga0070711_101579699
274 Ga0070700_100251749
275 Ga0070694_100202119
276 Ga0070708_100398464
277 Ga0070678_100025600
278 Ga0070662_100008423
279 Ga0068867_100318231
280 Ga0070699_100215469
281 Ga0070684_100000037
282 Ga0068853_102294835
283 Ga0070672_100422246
284 Ga0070686_100194003
285 Ga0070704_100309653
286 Ga0070704_100496462
287 Ga0070664_100000654
288 Ga0068859_100269358
289 Ga0068859_100475963
290 Ga0068864_100106822
291 Ga0068861_100144349
292 Ga0068861_102015595
293 Ga0068861_102226658
294 Ga0068870_10154017
295 Ga0068870_10951030
296 Ga0068863_102710941
297 Ga0068858_100420977
298 Ga0068860_100034817
299 Ga0068862_100019987
300 Ga0068862_101051094
301 Ga0070712_100000152
302 Ga0097621_100211990
303 Ga0068871_100849716
304 Ga0075428_100142006
305 Ga0075428_100489218
306 Ga0075428_100648291
307 Ga0075428_100750999
308 Ga0075430_100006478
309 Ga0075430_100036645
310 Ga0075430_100358303
311 Ga0075430_100453630
312 Ga0075431_100123979
313 Ga0075431_100695821
314 Ga0075433_10000920
315 Ga0075433_10015154
316 Ga0075433_10159472
317 Ga0075433_11660731
318 Ga0075434_100014863
319 Ga0075434_100081248
320 Ga0075434_100500576
321 Ga0075429_100021143
322 Ga0097620_100269362
323 Ga0097620_100475939
324 Ga0075435_100031963
325 Ga0105240_10102105
326 Ga0111539_10002878
327 Ga0111539_10651775
328 Ga0111539_12404032
329 Ga0114129_10351490
330 Ga0114129_10485707
331 Ga0114129_10696922
332 Ga0105242_11533374
333 Ga0105249_10182665
334 Ga0105246_10059389
335 Ga0157315_1008397
336 Ga0157370_10685761
337 Ga0157374_10925503
338 Ga0163162_10042183
339 Ga0157375_10279585
340 Ga0157380_10111329
341 Ga0157377_10070126
342 Ga0157379_10007406
343 Ga0157376_10344111
344 Ga0163161_10151647
345 Ga0207697_10024251
346 Ga0207682_10032661
347 Ga0207688_10000448
348 Ga0207647_10395024
349 Ga0207645_10067774
350 Ga0207643_10001060
351 Ga0207695_10116031
352 Ga0207693_10038508
353 Ga0207663_11340472
354 Ga0207662_10007717
355 Ga0207681_10011859
356 Ga0207659_10734635
357 Ga0207659_11120341
358 Ga0207690_10133156
359 Ga0207706_10013090
360 Ga0207691_10279916
361 Ga0207689_10125652
362 Ga0207689_10150754
363 Ga0207661_10000008
364 Ga0207679_10039441
365 Ga0207712_10074605
366 Ga0207668_10617158
367 Ga0207658_11272730
368 Ga0207677_10098994
369 Ga0207703_10713407
370 Ga0207708_10009589
371 Ga0207648_10012763
372 Ga0207676_10036993
373 Ga0207675_100001882
374 Ga0207683_10029327
375 Ga0209983_1059472
376 Ga0209971_1057770
377 Ga0209966_1170933
378 Ga0207428_10016685
379 Ga0207428_10046167
380 Ga0268266_10219987
381 Ga0268265_10152417
382 Ga0268265_11162803
383 Ga0265323_10002723
384 Ga0265325_10348101
385 Ga0265316_10001397
386 Ga0265316_10026290
387 Ga0265316_10116101
388 Ga0265316_10194891
389 Ga0265316_10342423
390 Ga0265316_10996847
391 Ga0307405_10345353
392 Ga0307413_10611599
393 Ga0307412_11591948
394 Ga0307415_101052460
395 Ga0373958_0040340
396 Ga0373941_0043978
397 Ga0373946_0290949
398 Ga0373931_0130646
399 Ga0373947_0822122
400 Ga0373937_1158597
401 Ga0373925_0021017
402 Ga0436365_0123954
403 Ga0436362_0011928
404 Ga0439453_0149586
405 Ga0451800_1453073
406 Ga0451853_1734547
407 Ga0439435_0001328
408 Ga0439435_0038416
409 Ga0439460_0299026
410 Ga0451577_0149283
411 Ga0451576_0510644
412 Ga0466967_1937719
413 Ga0495638_0047924
414 Ga0495669_0457901
415 Ga0495674_0000024
416 Ga0495593_0033033
417 Ga0496101_0207760
418 Ga0496102_0964342
419 Ga0496109_0428232
420 Ga0496110_0541489
421 Ga0496112_0338033
422 Ga0501031_0015630
423 Ga0501032_0099603
424 Ga0501032_0711271
425 Ga0501033_0048185
426 Ga0501033_0519261
427 Ga0501036_0029538
428 Ga0501036_0330839
429 Ga0501036_0498102
430 Ga0501037_0025296
431 Ga0501038_0002057
432 Ga0501039_0016341
433 Ga0501039_0483071
434 Ga0501040_0026574
435 Ga0501041_0010597
436 Ga0501041_0185665
437 Ga0501042_0009155
438 Ga0501042_0135010
439 Ga0501043_0010538
440 Ga0501046_0104254
441 Ga0501046_1138209
442 Ga0501048_0012115
443 Ga0501048_0040517
444 Ga0501048_0077745
445 Ga0501048_0361930
446 Ga0501048_0943120
447 Ga0501068_0009535
448 Ga0501069_0018992
449 Ga0501070_0014080
450 Ga0501071_0001915
451 Ga0501071_0009102
452 Ga0501071_0364392
453 Ga0501072_0043971
454 Ga0501073_0056873
455 Ga0501074_0043103
456 Ga0501075_0070059
457 Ga0501075_0320423
458 Ga0501075_0907326
459 Ga0501076_0024577
460 Ga0501076_0041475
461 Ga0501076_0085594
462 Ga0501076_0142603
463 Ga0501076_0324956
464 Ga0501076_0497771
465 Ga0501076_0556420
466 Ga0501076_1015681
467 Ga0501079_0014596
468 Ga0501079_0294380
469 Ga0501079_0683348
470 Ga0501080_0029553
471 Ga0501081_0007368
472 Ga0501081_0009315
473 Ga0501083_0006865
474 Ga0501083_0027163
475 Ga0501035_0001451
476 Ga0501044_0207323
477 Ga0501045_0023232
478 nmdc:mga05p37_314425_c1
479 nmdc:mga05p37_379718_c1
480 nmdc:mga05p37_446148_c1
481 nmdc:mga05p37_532248_c1
482 nmdc:mga09592_1619_c1
483 nmdc:mga09592_3258_c1
484 nmdc:mga0qj67_200673_c1
485 nmdc:mga0qj67_70_c1
486 nmdc:mga0qj67_87547_c1
487 nmdc:mga06r32_181941_c1
488 nmdc:mga06r32_27230_c1
489 nmdc:mga06r32_281660_c1
490 nmdc:mga06r32_4305_c1
491 nmdc:mga08y16_130745_c1
492 nmdc:mga08y16_14454_c1
493 nmdc:mga0n895_29538_c1
494 nmdc:mga0n895_5992_c1
495 nmdc:mga0rr50_1019057_c1
496 nmdc:mga0rr50_229635_c1
497 nmdc:mga0rr50_28342_c1
498 nmdc:mga08x19_10786_c1
499 nmdc:mga0a205_2040_c1
500 nmdc:mga0a205_3340_c1
501 nmdc:mga0a205_8740_c1
502 Ga0501084_0028648
503 Ga0501084_0658936
504 Ga0587067_086592
505 Ga0501082_0026148
506 Ga0501082_0814422
507 Ga0501082_0821082
508 Ga0530510_0070530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

133

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.9482 1 141
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.9354 1 141
1w8i-assembly1.cif.gz_A-2 the structure of gene product af1683 from archaeoglobus fulgidus. 0.7965 1 130
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7908 2 128
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7669 2 139
ID Description Score Start End Superfamily
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9645 3 135 3.40.50.1010
af_O53501_3_137_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.964 4 137 3.40.50.1010
af_P9WF55_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9562 1 132 3.40.50.1010
af_P9WF85_2_140_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9527 3 138 3.40.50.1010
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9506 3 135 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7Y2HPM1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9867 1 141 GO:0000287
GO:0004540
GO:0045926
GO:0090729
AF-A0A1Q3PV32-F1-model_v4 deleted 0.985 1 145
AF-A0A418KWG0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9844 1 141 GO:0000287
GO:0004540
GO:0045926
GO:0090729
AF-A0A7T9GFG5-F1-model_v4 deleted 0.9823 1 141
AF-A0A6L4AW66-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9804 1 143 GO:0000287
GO:0004540
GO:0045926
GO:0090729

Map