F365131

General Info

Members Datasets Scaffolds Average Seq Length
254 193 508 232

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0001956|Ga0495638_0001956_9149_9916
Length 255
Sequence MFRDRQEAGQKLGVEVARLGLHEPVVLALPRGGVPVAAEVAKALNAPLDLIIVRKVGAPGNPELAVAAIVDGDPPDVVLNREIIEAYSLDDAELGALIKRERPELDRRRLAYRGKRQPLSIAGKNAIIVDDGAATGTTMKVAIRALRRRSPKEIIVALPVSPPATVAELSQEADQVVCLSQPGRFLALGYHYRSFPQLTDEEVTAALHEAGRRRATALRASRSKAARPDGQNSHRLQPRALPDRAEAWAPQTKRR

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
52 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
53 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
54 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
55 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
56 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
57 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
58 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
59 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
77 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
78 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
79 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
80 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
81 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
82 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
83 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
84 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
85 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
86 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
87 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
88 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
89 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
90 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
91 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
92 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
93 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
94 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
95 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
96 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
97 2854911287 Brucella lupini LUP21 Isolate Unclassified
98 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
99 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
100 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
101 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
102 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
103 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
104 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
105 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
106 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
107 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
108 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
109 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
110 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
111 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
112 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
113 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
114 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
115 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
116 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
117 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
118 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
119 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
120 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
121 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
122 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
123 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
124 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
125 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
126 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
127 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
128 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
129 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
130 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
131 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
132 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
133 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
134 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
135 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
136 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
137 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
138 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
139 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
140 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
141 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
142 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
143 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
144 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
145 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
146 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
147 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
148 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
149 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
150 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
151 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
152 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
153 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
154 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
155 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
156 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
157 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
158 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
159 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
160 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
161 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
162 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
163 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
164 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
165 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
166 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
167 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
168 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
169 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
170 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
171 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
172 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
173 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
174 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
175 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
176 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
177 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
178 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
179 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
180 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
181 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
182 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
183 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
184 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
185 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
186 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
187 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
188 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
189 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
190 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
191 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
192 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
193 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.72
Metatranscriptomes 0
Isolates 45.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 36.22
Rhizoplane 1.97
Rhizosphere 43.31
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0001956 3300046460 Bacteria 17648
2 JGI24740J21852_10007057 3300001979 Bacteria 4604
3 JGI24739J22299_10002508 3300001989 Bacteria 7084
4 JGI24735J21928_10012303 3300002067 Bacteria 2706
5 JGI24751J29686_10010348 3300002459 Bacteria 1922
6 JGI25165J46597_1000351 3300003214 Bacteria 52020
7 rootH1_10016425 3300003316 Bacteria 3672
8 Ga0055542_1001141 3300003762 Bacteria 15670
9 Ga0065715_10125090 3300005293 Bacteria 2139
10 Ga0070674_100128066 3300005356 Bacteria 1889
11 Ga0070667_100578024 3300005367 Bacteria 1034
12 Ga0070662_100000007 3300005457 Bacteria 168761
13 Ga0068867_100254567 3300005459 Bacteria 1429
14 Ga0070693_100002250 3300005547 Bacteria 8850
15 Ga0070665_100045847 3300005548 Bacteria 4391
16 Ga0068855_100200492 3300005563 Bacteria 2246
17 Ga0068852_100426544 3300005616 Bacteria 1309
18 Ga0068852_100492114 3300005616 Bacteria 1220
19 Ga0075365_10040944 3300006038 Bacteria 3024
20 Ga0075364_10110592 3300006051 Bacteria 1833
21 Ga0075367_10006333 3300006178 Bacteria 5969
22 Ga0075370_10030695 3300006353 Bacteria 2999
23 Ga0075370_10169465 3300006353 Bacteria 1283
24 Ga0075370_10173957 3300006353 Bacteria 1266
25 Ga0105240_10044459 3300009093 Bacteria 5643
26 Ga0105240_10066754 3300009093 Bacteria 4461
27 Ga0105240_10182470 3300009093 Bacteria 2475
28 Ga0105240_10183004 3300009093 Bacteria 2471
29 Ga0105240_10297126 3300009093 Bacteria 1849
30 Ga0105243_10095189 3300009148 Bacteria 2461
31 Ga0105241_10009052 3300009174 Bacteria 7324
32 Ga0105237_10029717 3300009545 Bacteria 5553
33 Ga0105237_10086292 3300009545 Bacteria 3128
34 Ga0105238_10056040 3300009551 Bacteria 3955
35 Ga0105238_10225393 3300009551 Bacteria 1851
36 Ga0105238_10283788 3300009551 Bacteria 1637
37 Ga0105238_10360220 3300009551 Bacteria 1444
38 Ga0105239_10011971 3300010375 Bacteria 9673
39 Ga0105239_10014404 3300010375 Bacteria 8775
40 Ga0105239_10020245 3300010375 Bacteria 7341
41 Ga0105239_10043155 3300010375 Bacteria 4941
42 Ga0105239_10281443 3300010375 Bacteria 1872
43 Ga0157373_10273872 3300013100 Bacteria 1195
44 Ga0157369_10117097 3300013105 Bacteria 2828
45 Ga0157369_10521651 3300013105 Bacteria 1229
46 Ga0157369_10838863 3300013105 Bacteria 944
47 Ga0157374_10055022 3300013296 Bacteria 3713
48 Ga0157374_10109860 3300013296 Bacteria 2651
49 Ga0163163_10395128 3300014325 Bacteria 1441
50 Ga0182008_10014660 3300014497 Bacteria 4099
51 Ga0182008_10043341 3300014497 Bacteria 2240
52 Ga0182006_1012048 3300015261 Bacteria 3787
53 Ga0163161_10433564 3300017792 Bacteria 1059
54 Ga0209148_1000921 3300025254 Bacteria 19607
55 Ga0209148_1012222 3300025254 Bacteria 1575
56 Ga0209233_1000310 3300025261 Bacteria 56582
57 Ga0209233_1004037 3300025261 Bacteria 5081
58 Ga0209455_1000150 3300025272 Bacteria 130892
59 Ga0209758_1042640 3300025297 Bacteria 1680
60 Ga0207647_10003622 3300025904 Bacteria 11566
61 Ga0207654_10029174 3300025911 Bacteria 3016
62 Ga0207695_10444433 3300025913 Bacteria 1180
63 Ga0207694_10215302 3300025924 Bacteria 1566
64 Ga0207694_10217943 3300025924 Bacteria 1556
65 Ga0207694_10249637 3300025924 Bacteria 1452
66 Ga0207694_10353773 3300025924 Bacteria 1216
67 Ga0207706_10000018 3300025933 Bacteria 168729
68 Ga0207667_10228522 3300025949 Bacteria 1905
69 Ga0207674_10445846 3300026116 Bacteria 1251
70 Ga0207698_10456920 3300026142 Bacteria 1234
71 Ga0268266_10988689 3300028379 Bacteria 814
72 Ga0395900_0060589 3300037418 Bacteria 3894
73 Ga0395905_0050617 3300037471 Bacteria 3892
74 Ga0395905_0058990 3300037471 Bacteria 3588
75 Ga0395905_0518679 3300037471 Bacteria 1092
76 Ga0395901_0004406 3300038443 Bacteria 14190
77 Ga0395901_0018515 3300038443 Bacteria 7110
78 Ga0495638_0007105 3300046460 Bacteria 8073
79 Ga0496104_0591982 3300048907 Bacteria 1019
80 Ga0496109_0462791 3300048912 Bacteria 1198
81 Ga0496110_0771500 3300048913 Bacteria 865
82 Ga0496112_0010398 3300048915 Bacteria 8437
83 Ga0496113_0117683 3300048916 Bacteria 2075
84 Ga0496119_0015667 3300048922 Bacteria 5816
85 Ga0496119_0120068 3300048922 Bacteria 1446
86 Ga0496120_0003224 3300048923 Bacteria 15142
87 Ga0496124_0359601 3300048927 Bacteria 1026
88 Ga0501031_0000010 3300049568 Bacteria 146435
89 Ga0501031_0085438 3300049568 Bacteria 2057
90 Ga0501031_0088784 3300049568 Bacteria 2016
91 Ga0501032_0000023 3300049569 Bacteria 146435
92 Ga0501032_0004356 3300049569 Bacteria 10691
93 Ga0501032_0018222 3300049569 Bacteria 4921
94 Ga0501033_0000481 3300049570 Bacteria 37583
95 Ga0501033_0001512 3300049570 Bacteria 20576
96 Ga0501033_0005738 3300049570 Bacteria 9782
97 Ga0501033_0349223 3300049570 Bacteria 1036
98 Ga0501034_0000116 3300049571 Bacteria 146442
99 Ga0501034_0001737 3300049571 Bacteria 27988
100 Ga0501034_0053094 3300049571 Bacteria 4083
101 Ga0501034_0085451 3300049571 Bacteria 3157
102 Ga0501036_0000015 3300049572 Bacteria 146442
103 Ga0501036_0063349 3300049572 Bacteria 3131
104 Ga0501036_0184551 3300049572 Bacteria 1755
105 Ga0501037_0000023 3300049573 Bacteria 146542
106 Ga0501037_0020811 3300049573 Bacteria 4843
107 Ga0501037_0115308 3300049573 Bacteria 1934
108 Ga0501038_0000025 3300049574 Bacteria 146542
109 Ga0501038_0027734 3300049574 Bacteria 5034
110 Ga0501039_0000691 3300049575 Bacteria 24283
111 Ga0501039_0028417 3300049575 Bacteria 4305
112 Ga0501040_0007003 3300049576 Bacteria 7306
113 Ga0501043_0000070 3300049579 Bacteria 89839
114 Ga0501043_0008235 3300049579 Bacteria 8216
115 Ga0501043_0095921 3300049579 Bacteria 2331
116 Ga0501046_0156020 3300049580 Bacteria 1719
117 Ga0501047_0029107 3300049581 Bacteria 5327
118 Ga0501047_0031757 3300049581 Bacteria 5094
119 Ga0501047_0195980 3300049581 Bacteria 1882
120 Ga0501067_0013899 3300049583 Bacteria 4458
121 Ga0501070_0031361 3300049586 Bacteria 4454
122 Ga0501070_0088683 3300049586 Bacteria 2560
123 Ga0501070_0413236 3300049586 Unclassified 1090
124 Ga0501080_0373192 3300049742 Bacteria 1286
125 Ga0501035_0001454 3300049822 Bacteria 24283
126 Ga0501035_0026988 3300049822 Bacteria 5251
127 Ga0501044_0000505 3300049823 Bacteria 47475
128 Ga0501044_0002585 3300049823 Bacteria 20595
129 Ga0501044_0009510 3300049823 Bacteria 10581
130 Ga0501044_0579222 3300049823 Unclassified 1017
131 nmdc:mga03n38_92005_c1 3300050490 Bacteria 1446
132 nmdc:mga0yw44_17132_c1 3300050492 Bacteria 3935
133 nmdc:mga0yw44_247476_c1 3300050492 Bacteria 1186
134 nmdc:mga0yw44_2528_c1 3300050492 Bacteria 7839
135 nmdc:mga0yw44_284158_c1 3300050492 Bacteria 1106
136 nmdc:mga06z11_60797_c1 3300050494 Bacteria 1968
137 nmdc:mga07m45_202900_c1 3300050496 Bacteria 1153
138 Ga0500620_000310 3300053155 Bacteria 9330
139 Ga0500627_0157083 3300053158 Bacteria 1027
140 2512928823 2512875016 Bacteria 6529530
141 2513613803 2513237090 Bacteria 7096802
142 2514417978 2513237305 Bacteria 7293571
143 2514591971 2513237351 Bacteria 6968952
144 2588518031 2588253730 Bacteria 6881675
145 2643772657 2643221550 Bacteria 4619371
146 2643986546 2643221595 Bacteria 6565519
147 2643988630 2643221595 Bacteria 6565519
148 2644132320 2643221623 Bacteria 5239945
149 2644156390 2643221627 Bacteria 6761570
150 2644157009 2643221627 Bacteria 6761570
151 2694631734 2693429783 Bacteria 7019804
152 2694638024 2693429784 Bacteria 7241525
153 2723578394 2721755686 Bacteria 7343952
154 2756677882 2756170246 Bacteria 7451806
155 2792745520 2791355123 Bacteria 8049106
156 2844004920 2844002411 Bacteria 7168230
157 2854915459 2854911287 Bacteria 5582813
158 2856321611 2856320880 Bacteria 7263508
159 2856343034 2856342000 Bacteria 7176905
160 2857354091 2857349434 Bacteria 7926032
161 2869165672 2869162929 Bacteria 6399702
162 2869284538 2869278585 Bacteria 7077053
163 2871468654 2871466892 Bacteria 6923287
164 2871492335 2871488783 Bacteria 6929816
165 2871501017 2871495908 Bacteria 6935695
166 2874139823 2874139085 Bacteria 7021506
167 2876369134 2876363079 Bacteria 6544991
168 2876378679 2876377896 Bacteria 6565995
169 2878739924 2878738818 Bacteria 7136951
170 2878759651 2878753008 Bacteria 6922523
171 2878765042 2878760144 Bacteria 6823465
172 2878772203 2878767105 Bacteria 6898628
173 2881847722 2881845957 Bacteria 6611900
174 2881868928 2881861095 Bacteria 7128710
175 2882912594 2882912400 Bacteria 6801539
176 2885308170 2885305155 Bacteria 7348390
177 2885316183 2885312484 Bacteria 6415165
178 2885322248 2885318864 Bacteria 6729568
179 2885328917 2885326080 Bacteria 7134805
180 2885334514 2885334103 Bacteria 7216818
181 2888340307 2888337043 Bacteria 6629336
182 2888352026 2888350351 Bacteria 7372807
183 2889014012 2889010040 Bacteria 6749192
184 2889021281 2889016732 Bacteria 6700763
185 2889915025 2889914905 Bacteria 5702301
186 2903449341 2903448605 Bacteria 7357801
187 2903496934 2903492973 Bacteria 13473544
188 2903526398 2903521522 Bacteria 6525694
189 2903529685 2903528002 Bacteria 6586099
190 2903545832 2903540706 Bacteria 7062119
191 2906328783 2906328253 Bacteria 6585166
192 2906332067 2906328253 Bacteria 6585166
193 2906383836 2906378014 Bacteria 6911440
194 2922136038 2922130491 Bacteria 7173936
195 2922154705 2922151315 Bacteria 6902399
196 2922190618 2922185730 Bacteria 7113964
197 2924723488 2924718760 Bacteria 6331356
198 2924768764 2924762789 Bacteria 6561353
199 2924777522 2924776078 Bacteria 7492003
200 2924785350 2924784321 Bacteria 7416538
201 2937849062 2937848649 Bacteria 6983481
202 2937883667 2937877337 Bacteria 7246526
203 2937895046 2937891427 Bacteria 6357007
204 2937976170 2937972304 Bacteria 7532020
205 2937999684 2937994558 Bacteria 7036190
206 2958038965 2958034702 Bacteria 6989922
207 2958056245 2958041894 Bacteria 13082850
208 2958090945 2958084443 Bacteria 7312792
209 2958099731 2958092219 Bacteria 6861151
210 2958106358 2958100919 Bacteria 6800575
211 2958149101 2958144490 Bacteria 6677056
212 2958170154 2958165035 Bacteria 6906348
213 2958176415 2958172287 Bacteria 6716688
214 2961168607 2961163497 Bacteria 6901077
215 2961173591 2961170736 Bacteria 7072258
216 2963650410 2963644680 Bacteria 6530403
217 2965023427 2965018300 Bacteria 6883036
218 2965112174 2965110997 Bacteria 6693150
219 2965121269 2965119406 Bacteria 6956431
220 2968005813 2968003550 Bacteria 6929263
221 2968016807 2968016561 Bacteria 7022047
222 2968085582 2968083720 Bacteria 7351627
223 2968120370 2968117919 Bacteria 6536078
224 2968177018 2968171901 Bacteria 6894245
225 2970470250 2970469710 Bacteria 6969209
226 2970506183 2970503327 Bacteria 7099517
227 2970544268 2970540015 Bacteria 6977556
228 2970559890 2970554993 Bacteria 6814252
229 2970599153 2970593180 Bacteria 7073582
230 2977828173 2977821940 Bacteria 6906439
231 2977863537 2977858184 Bacteria 6215359
232 2977923160 2977922695 Bacteria 6956781
233 2977949756 2977942078 Bacteria 7570577
234 2977987065 2977986579 Bacteria 6581278
235 2979714353 2979710463 Bacteria 6785254
236 2979743539 2979742915 Bacteria 7301278
237 2979800912 2979793036 Bacteria 6808957
238 2979810905 2979808191 Bacteria 7179355
239 2987642499 2987636660 Bacteria 8088555
240 2987653949 2987652177 Bacteria 6969023
241 2987664635 2987659509 Bacteria 6966464
242 2987670442 2987666974 Bacteria 6509233
243 2987679661 2987673487 Bacteria 6884027
244 2996355413 2996348954 Bacteria 7239054
245 3000138254 3000135777 Bacteria 6891109
246 3004193686 3004188549 Bacteria 6952365
247 3004210580 3004203850 Bacteria 7307914
248 3004211610 3004211236 Bacteria 7417683
249 3004218857 3004218560 Bacteria 7421728
250 3004281946 3004275668 Bacteria 7114440
251 3004292102 3004289098 Bacteria 6135450
252 637078542 637000159 Bacteria 7596297
253 8004381153 8004374579 Bacteria 6898112
254 8004449592 8004445564 Bacteria 6322258
255 Ga0495638_0001956
256 JGI24740J21852_10007057
257 JGI24739J22299_10002508
258 JGI24735J21928_10012303
259 JGI24751J29686_10010348
260 JGI25165J46597_1000351
261 rootH1_10016425
262 Ga0055542_1001141
263 Ga0065715_10125090
264 Ga0070674_100128066
265 Ga0070667_100578024
266 Ga0070662_100000007
267 Ga0068867_100254567
268 Ga0070693_100002250
269 Ga0070665_100045847
270 Ga0068855_100200492
271 Ga0068852_100426544
272 Ga0068852_100492114
273 Ga0075365_10040944
274 Ga0075364_10110592
275 Ga0075367_10006333
276 Ga0075370_10030695
277 Ga0075370_10169465
278 Ga0075370_10173957
279 Ga0105240_10044459
280 Ga0105240_10066754
281 Ga0105240_10182470
282 Ga0105240_10183004
283 Ga0105240_10297126
284 Ga0105243_10095189
285 Ga0105241_10009052
286 Ga0105237_10029717
287 Ga0105237_10086292
288 Ga0105238_10056040
289 Ga0105238_10225393
290 Ga0105238_10283788
291 Ga0105238_10360220
292 Ga0105239_10011971
293 Ga0105239_10014404
294 Ga0105239_10020245
295 Ga0105239_10043155
296 Ga0105239_10281443
297 Ga0157373_10273872
298 Ga0157369_10117097
299 Ga0157369_10521651
300 Ga0157369_10838863
301 Ga0157374_10055022
302 Ga0157374_10109860
303 Ga0163163_10395128
304 Ga0182008_10014660
305 Ga0182008_10043341
306 Ga0182006_1012048
307 Ga0163161_10433564
308 Ga0209148_1000921
309 Ga0209148_1012222
310 Ga0209233_1000310
311 Ga0209233_1004037
312 Ga0209455_1000150
313 Ga0209758_1042640
314 Ga0207647_10003622
315 Ga0207654_10029174
316 Ga0207695_10444433
317 Ga0207694_10215302
318 Ga0207694_10217943
319 Ga0207694_10249637
320 Ga0207694_10353773
321 Ga0207706_10000018
322 Ga0207667_10228522
323 Ga0207674_10445846
324 Ga0207698_10456920
325 Ga0268266_10988689
326 Ga0395900_0060589
327 Ga0395905_0050617
328 Ga0395905_0058990
329 Ga0395905_0518679
330 Ga0395901_0004406
331 Ga0395901_0018515
332 Ga0495638_0007105
333 Ga0496104_0591982
334 Ga0496109_0462791
335 Ga0496110_0771500
336 Ga0496112_0010398
337 Ga0496113_0117683
338 Ga0496119_0015667
339 Ga0496119_0120068
340 Ga0496120_0003224
341 Ga0496124_0359601
342 Ga0501031_0000010
343 Ga0501031_0085438
344 Ga0501031_0088784
345 Ga0501032_0000023
346 Ga0501032_0004356
347 Ga0501032_0018222
348 Ga0501033_0000481
349 Ga0501033_0001512
350 Ga0501033_0005738
351 Ga0501033_0349223
352 Ga0501034_0000116
353 Ga0501034_0001737
354 Ga0501034_0053094
355 Ga0501034_0085451
356 Ga0501036_0000015
357 Ga0501036_0063349
358 Ga0501036_0184551
359 Ga0501037_0000023
360 Ga0501037_0020811
361 Ga0501037_0115308
362 Ga0501038_0000025
363 Ga0501038_0027734
364 Ga0501039_0000691
365 Ga0501039_0028417
366 Ga0501040_0007003
367 Ga0501043_0000070
368 Ga0501043_0008235
369 Ga0501043_0095921
370 Ga0501046_0156020
371 Ga0501047_0029107
372 Ga0501047_0031757
373 Ga0501047_0195980
374 Ga0501067_0013899
375 Ga0501070_0031361
376 Ga0501070_0088683
377 Ga0501070_0413236
378 Ga0501080_0373192
379 Ga0501035_0001454
380 Ga0501035_0026988
381 Ga0501044_0000505
382 Ga0501044_0002585
383 Ga0501044_0009510
384 Ga0501044_0579222
385 nmdc:mga03n38_92005_c1
386 nmdc:mga0yw44_17132_c1
387 nmdc:mga0yw44_247476_c1
388 nmdc:mga0yw44_2528_c1
389 nmdc:mga0yw44_284158_c1
390 nmdc:mga06z11_60797_c1
391 nmdc:mga07m45_202900_c1
392 Ga0500620_000310
393 Ga0500627_0157083
394 2512928823
395 2513613803
396 2514417978
397 2514591971
398 2588518031
399 2643772657
400 2643986546
401 2643988630
402 2644132320
403 2644156390
404 2644157009
405 2694631734
406 2694638024
407 2723578394
408 2756677882
409 2792745520
410 2844004920
411 2854915459
412 2856321611
413 2856343034
414 2857354091
415 2869165672
416 2869284538
417 2871468654
418 2871492335
419 2871501017
420 2874139823
421 2876369134
422 2876378679
423 2878739924
424 2878759651
425 2878765042
426 2878772203
427 2881847722
428 2881868928
429 2882912594
430 2885308170
431 2885316183
432 2885322248
433 2885328917
434 2885334514
435 2888340307
436 2888352026
437 2889014012
438 2889021281
439 2889915025
440 2903449341
441 2903496934
442 2903526398
443 2903529685
444 2903545832
445 2906328783
446 2906332067
447 2906383836
448 2922136038
449 2922154705
450 2922190618
451 2924723488
452 2924768764
453 2924777522
454 2924785350
455 2937849062
456 2937883667
457 2937895046
458 2937976170
459 2937999684
460 2958038965
461 2958056245
462 2958090945
463 2958099731
464 2958106358
465 2958149101
466 2958170154
467 2958176415
468 2961168607
469 2961173591
470 2963650410
471 2965023427
472 2965112174
473 2965121269
474 2968005813
475 2968016807
476 2968085582
477 2968120370
478 2968177018
479 2970470250
480 2970506183
481 2970544268
482 2970559890
483 2970599153
484 2977828173
485 2977863537
486 2977923160
487 2977949756
488 2977987065
489 2979714353
490 2979743539
491 2979800912
492 2979810905
493 2987642499
494 2987653949
495 2987664635
496 2987670442
497 2987679661
498 2996355413
499 3000138254
500 3004193686
501 3004210580
502 3004211610
503 3004218857
504 3004281946
505 3004292102
506 637078542
507 8004381153
508 8004449592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

10

191

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wd5-assembly1.cif.gz_A crystal structure of tt1426 from thermus thermophilus hb8 0.8326 2 207
1wd5-assembly1.cif.gz_A crystal structure of tt1426 from thermus thermophilus hb8 0.8036 2 207
7v5i-assembly1.cif.gz_B structural insights into the substrate selectivity of acyl-coa transferase 0.7371 126 178
7n3r-assembly1.cif.gz_B the ternary complex of human bisphosphoglycerate mutase with 3-phosphoglycerate and 2-phosphoglycolate 0.6964 6 45
4rzs-assembly1.cif.gz_B lac repressor engineered to bind sucralose, unliganded tetramer 0.689 124 183
ID Description Score Start End Superfamily
af_P9WHK1_54_116_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8769 53 113 3.40.50.2020
1wd5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8665 1 209 3.40.50.2020
1wd5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8442 1 209 3.40.50.2020
af_P9WHK1_54_116_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.815 53 113 3.40.50.2020
af_Q54PR8_66_128_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7984 53 116 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A503PIJ5-F1-model_v4 Phosphoribosyltransferase 0.9493 1 237 GO:0016757
AF-A0A1X7PH48-F1-model_v4 Putative phosphoribosyl transferase 0.9449 1 219 GO:0016740
AF-A0A7W9AVF7-F1-model_v4 Putative phosphoribosyl transferase 0.9439 1 221 GO:0016740
AF-A0A2P7SCL0-F1-model_v4 Phosphoribosyltransferase 0.9424 1 210 GO:0016757
AF-A0A528ECB9-F1-model_v4 Phosphoribosyltransferase 0.9423 1 218 GO:0016757

Map