F364769

General Info

Members Datasets Scaffolds Average Seq Length
254 207 506 314

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100108201|Ga0070712_1001082012
Length 343
Sequence MQTQPCDAAGAASFSARPCPLPMEFRLTEKAPAQAASPPRAPSSRRLEPLHNVDAGVLDIAYYEAGPADGPAVMLMHGFPYDIHSYVDVAPLLAAQGCRVIVPYLRGYGPTTFRDKATPRSGEQASIGADMMALMDALGIEHAVFAGYDWGGRAACVGAALWPERCIGLVSVNGYLIQDIAKAMVPARPEREVPLWYQYYFQLERGRAGLAANRRGIAKILWKQWSPNWDFDDACFERTAVAHDNPDYVDVVIHSYRHRFGLADGDPQYAEVQRRLAAQPPITVPTITLDGAGDGVAPATDGSASAPKFTGRRVHRVIPRAGHNLPQEEPEAFAAAVMDLIKA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
177 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
178 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
179 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
184 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
185 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
186 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
190 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
191 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
192 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
193 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
194 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
195 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
196 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
197 2791355199
198 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
199 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
200 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
201 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
202 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
203 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
204 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
205 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
206 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
207 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.2
Nodule 4.33
Rhizoplane 5.91
Rhizosphere 67.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100108201 3300006175 Bacteria 2069
2 JGI25165J46597_1005502 3300003214 Bacteria 2428
3 Ga0070676_10090690 3300005328 Bacteria 1872
4 Ga0070683_100244925 3300005329 Bacteria 1705
5 Ga0070670_100155832 3300005331 Bacteria 1978
6 Ga0070682_100090829 3300005337 Bacteria 1998
7 Ga0068868_100006382 3300005338 Bacteria 8342
8 Ga0070661_100183643 3300005344 Bacteria 1592
9 Ga0070668_100028778 3300005347 Bacteria 4216
10 Ga0070674_100254704 3300005356 Bacteria 1380
11 Ga0070709_10005959 3300005434 Bacteria 6619
12 Ga0070714_100087430 3300005435 Bacteria 2726
13 Ga0070713_100016301 3300005436 Bacteria 5586
14 Ga0070710_10001376 3300005437 Bacteria 11462
15 Ga0070711_100001632 3300005439 Bacteria 12389
16 Ga0070711_100012105 3300005439 Bacteria 5381
17 Ga0070700_100122355 3300005441 Bacteria 1745
18 Ga0070663_100012980 3300005455 Bacteria 5291
19 Ga0070678_100148764 3300005456 Bacteria 1884
20 Ga0070678_100437554 3300005456 Bacteria 1143
21 Ga0070681_10141503 3300005458 Bacteria 2335
22 Ga0070698_100182128 3300005471 Bacteria 2039
23 Ga0070684_100049748 3300005535 Bacteria 3639
24 Ga0070697_100298059 3300005536 Bacteria 1386
25 Ga0070672_100040690 3300005543 Bacteria 3568
26 Ga0070686_100072845 3300005544 Bacteria 2254
27 Ga0070665_100036591 3300005548 Bacteria 4937
28 Ga0070665_100102472 3300005548 Bacteria 2866
29 Ga0068855_100024415 3300005563 Bacteria 7232
30 Ga0068855_100446994 3300005563 Bacteria 1411
31 Ga0068857_100061887 3300005577 Bacteria 3326
32 Ga0068854_100256699 3300005578 Bacteria 1398
33 Ga0068859_100113626 3300005617 Bacteria 2772
34 Ga0068864_100068729 3300005618 Bacteria 3078
35 Ga0068864_100309555 3300005618 Bacteria 1481
36 Ga0068861_100526854 3300005719 Bacteria 1073
37 Ga0068858_100096452 3300005842 Bacteria 2755
38 Ga0081455_10036064 3300005937 Bacteria 4409
39 Ga0081540_1001913 3300005983 Bacteria 17442
40 Ga0081540_1096410 3300005983 Bacteria 1287
41 Ga0070717_10000576 3300006028 Bacteria 23423
42 Ga0070717_10110456 3300006028 Bacteria 2345
43 Ga0070716_100001127 3300006173 Bacteria 11758
44 Ga0070712_100032769 3300006175 Bacteria 3511
45 Ga0075369_10012872 3300006186 Bacteria 3309
46 Ga0097621_100022951 3300006237 Bacteria 4850
47 Ga0068871_100079478 3300006358 Bacteria 2714
48 Ga0097620_100113620 3300006931 Bacteria 2772
49 Ga0099794_10001673 3300007265 Bacteria 7842
50 Ga0099794_10009708 3300007265 Bacteria 4061
51 Ga0105240_10030084 3300009093 Bacteria 7062
52 Ga0105240_10109874 3300009093 Bacteria 3338
53 Ga0111539_10088658 3300009094 Bacteria 3635
54 Ga0105245_10044014 3300009098 Bacteria 3983
55 Ga0105247_10105868 3300009101 Bacteria 1804
56 Ga0105243_10181837 3300009148 Bacteria 1829
57 Ga0105242_10268233 3300009176 Bacteria 1545
58 Ga0105248_10749968 3300009177 Bacteria 1102
59 Ga0105237_10015984 3300009545 Bacteria 7803
60 Ga0105237_10187848 3300009545 Bacteria 2066
61 Ga0105238_10022627 3300009551 Bacteria 6407
62 Ga0099796_10010879 3300010159 Bacteria 2518
63 Ga0105239_10016594 3300010375 Bacteria 8141
64 Ga0105239_10044505 3300010375 Bacteria 4866
65 Ga0105239_10704803 3300010375 Bacteria 1154
66 Ga0105246_10017484 3300011119 Bacteria 4557
67 Ga0157370_10062091 3300013104 Bacteria 3544
68 Ga0157374_10038498 3300013296 Bacteria 4396
69 Ga0157378_10010562 3300013297 Bacteria 8070
70 Ga0163162_10021132 3300013306 Bacteria 6403
71 Ga0163162_10464844 3300013306 Bacteria 1397
72 Ga0163162_10879699 3300013306 Bacteria 1010
73 Ga0157375_10237252 3300013308 Bacteria 1983
74 Ga0163163_10039498 3300014325 Bacteria 4605
75 Ga0157376_10086278 3300014969 Bacteria 2706
76 Ga0163161_10038526 3300017792 Bacteria 3429
77 Ga0209148_1004817 3300025254 Bacteria 3223
78 Ga0209233_1002791 3300025261 Bacteria 6276
79 Ga0209233_1004403 3300025261 Bacteria 4795
80 Ga0209455_1012410 3300025272 Bacteria 2041
81 Ga0207692_10014259 3300025898 Bacteria 3469
82 Ga0207642_10151657 3300025899 Bacteria 1234
83 Ga0207688_10143346 3300025901 Bacteria 1407
84 Ga0207688_10261022 3300025901 Bacteria 1051
85 Ga0207685_10051789 3300025905 Bacteria 1587
86 Ga0207699_10000543 3300025906 Bacteria 18645
87 Ga0207707_10070896 3300025912 Bacteria 3037
88 Ga0207693_10002625 3300025915 Bacteria 15606
89 Ga0207693_10027221 3300025915 Bacteria 4520
90 Ga0207693_10086130 3300025915 Bacteria 2461
91 Ga0207663_10005176 3300025916 Bacteria 6558
92 Ga0207660_10021143 3300025917 Bacteria 4374
93 Ga0207657_10130617 3300025919 Bacteria 2059
94 Ga0207649_10069826 3300025920 Bacteria 2239
95 Ga0207681_10244467 3300025923 Bacteria 1398
96 Ga0207694_10151610 3300025924 Bacteria 1868
97 Ga0207650_10098528 3300025925 Bacteria 2246
98 Ga0207687_10070384 3300025927 Bacteria 2497
99 Ga0207700_10121365 3300025928 Bacteria 2120
100 Ga0207664_10082725 3300025929 Bacteria 2615
101 Ga0207664_10099789 3300025929 Bacteria 2396
102 Ga0207686_10117509 3300025934 Bacteria 1804
103 Ga0207669_10002441 3300025937 Bacteria 7927
104 Ga0207669_10088279 3300025937 Bacteria 2010
105 Ga0207704_10006360 3300025938 Bacteria 5505
106 Ga0207665_10004674 3300025939 Bacteria 9097
107 Ga0207711_10031038 3300025941 Bacteria 4509
108 Ga0207661_10276405 3300025944 Bacteria 1500
109 Ga0207667_10024559 3300025949 Bacteria 6613
110 Ga0207651_10294508 3300025960 Bacteria 1347
111 Ga0207668_10040724 3300025972 Bacteria 3136
112 Ga0207677_10015108 3300026023 Bacteria 4530
113 Ga0207703_10269016 3300026035 Bacteria 1543
114 Ga0207678_10016254 3300026067 Bacteria 6531
115 Ga0207678_10021696 3300026067 Bacteria 5631
116 Ga0207708_10104479 3300026075 Bacteria 2195
117 Ga0207641_10394967 3300026088 Bacteria 1327
118 Ga0207648_10611320 3300026089 Bacteria 1005
119 Ga0207676_10054484 3300026095 Bacteria 3135
120 Ga0207674_10140781 3300026116 Bacteria 2372
121 Ga0207674_10219394 3300026116 Bacteria 1850
122 Ga0207675_100177957 3300026118 Bacteria 2036
123 Ga0207675_100718753 3300026118 Bacteria 1009
124 Ga0207683_10324380 3300026121 Bacteria 1411
125 Ga0209588_1001063 3300027671 Bacteria 7070
126 Ga0268266_10000466 3300028379 Bacteria 58721
127 Ga0268266_10008795 3300028379 Bacteria 8948
128 Ga0268266_10040314 3300028379 Bacteria 3980
129 Ga0268266_10369800 3300028379 Bacteria 1350
130 Ga0268264_10151373 3300028381 Bacteria 2080
131 Ga0307517_10002814 3300028786 Bacteria 27650
132 Ga0307515_10192095 3300028794 Bacteria 1948
133 Ga0265330_10010253 3300031235 Bacteria 4423
134 Ga0265330_10028912 3300031235 Bacteria 2495
135 Ga0265325_10044007 3300031241 Bacteria 2327
136 Ga0265340_10021177 3300031247 Bacteria 3334
137 Ga0265331_10150154 3300031250 Bacteria 1058
138 Ga0265316_10111891 3300031344 Bacteria 2067
139 Ga0307509_10063540 3300031507 Bacteria 3886
140 Ga0307408_100318225 3300031548 Bacteria 1310
141 Ga0307508_10001480 3300031616 Bacteria 26337
142 Ga0307516_10150457 3300031730 Bacteria 2089
143 Ga0307516_10185283 3300031730 Bacteria 1812
144 Ga0307409_100241434 3300031995 Bacteria 1645
145 Ga0307411_10005088 3300032005 Bacteria 6409
146 Ga0307415_100081147 3300032126 Bacteria 2316
147 Ga0307510_10013037 3300033180 Bacteria 9860
148 Ga0307510_10191277 3300033180 Bacteria 1594
149 Ga0315911_1000021 3300033442 Bacteria 124874
150 Ga0373934_0102743 3300035086 Bacteria 1156
151 Ga0373943_0053282 3300035170 Bacteria 1997
152 Ga0373927_0047454 3300035695 Bacteria 2778
153 Ga0373933_0000163 3300035724 Bacteria 43339
154 Ga0373947_0052621 3300035725 Bacteria 2453
155 Ga0373947_0189618 3300035725 Bacteria 1341
156 Ga0395898_0007133 3300037466 Bacteria 11865
157 Ga0395898_0037517 3300037466 Bacteria 4806
158 Ga0395905_0194254 3300037471 Bacteria 1903
159 Ga0395901_0141669 3300038443 Bacteria 2527
160 Ga0436360_1376398 3300039438 Bacteria 3115
161 Ga0466957_0090752 3300044842 Bacteria 1914
162 Ga0466957_0169192 3300044842 Bacteria 1423
163 Ga0466959_0075148 3300045049 Bacteria 2442
164 Ga0466967_0045267 3300045976 Bacteria 3823
165 Ga0495603_0014498 3300046455 Bacteria 4767
166 Ga0495603_0026385 3300046455 Bacteria 3510
167 Ga0495629_0113225 3300046459 Bacteria 1891
168 Ga0495651_0083204 3300046462 Bacteria 2414
169 Ga0495582_0136362 3300046473 Bacteria 1389
170 Ga0495584_0202379 3300046491 Bacteria 1009
171 Ga0495585_0077287 3300046492 Bacteria 1807
172 Ga0495620_0114184 3300046515 Bacteria 1068
173 Ga0495644_0075881 3300046523 Bacteria 1266
174 Ga0495663_0050659 3300046525 Bacteria 1284
175 Ga0495598_0014210 3300046537 Bacteria 1987
176 Ga0495622_0026025 3300046557 Bacteria 2734
177 Ga0495656_0005172 3300046615 Bacteria 4500
178 Ga0495625_0049994 3300046660 Bacteria 3002
179 Ga0495659_0028609 3300046664 Bacteria 1930
180 Ga0495588_0132424 3300046674 Bacteria 1315
181 Ga0495669_0011538 3300046684 Bacteria 3753
182 Ga0495589_0068815 3300046794 Bacteria 1732
183 Ga0495672_0019659 3300047320 Bacteria 4451
184 Ga0495672_0064515 3300047320 Bacteria 2097
185 Ga0496100_0003444 3300048903 Bacteria 8249
186 Ga0496101_0009681 3300048904 Bacteria 6341
187 Ga0496102_0000549 3300048905 Bacteria 40435
188 Ga0496103_0009442 3300048906 Bacteria 5776
189 Ga0496105_0022715 3300048908 Bacteria 5082
190 Ga0496106_0097485 3300048909 Bacteria 2276
191 Ga0496107_0014085 3300048910 Bacteria 5597
192 Ga0496108_0038973 3300048911 Bacteria 3960
193 Ga0496110_0028925 3300048913 Bacteria 4763
194 Ga0496112_0055691 3300048915 Bacteria 3889
195 Ga0496112_0195259 3300048915 Bacteria 1985
196 Ga0496113_0031279 3300048916 Bacteria 3861
197 Ga0496114_0010265 3300048917 Bacteria 7452
198 Ga0496115_0044758 3300048918 Bacteria 3533
199 Ga0496115_0352233 3300048918 Bacteria 1200
200 Ga0496117_0036476 3300048920 Bacteria 3678
201 Ga0496118_0013053 3300048921 Bacteria 7899
202 Ga0496118_0128257 3300048921 Bacteria 1635
203 Ga0496121_0038127 3300048924 Bacteria 4261
204 Ga0496121_0068180 3300048924 Bacteria 2879
205 Ga0496124_0001503 3300048927 Bacteria 34105
206 Ga0496124_0266562 3300048927 Bacteria 1257
207 Ga0496126_0105894 3300048929 Bacteria 2455
208 Ga0496126_0144434 3300048929 Bacteria 2045
209 Ga0496126_0168824 3300048929 Bacteria 1865
210 nmdc:mga00v17_122326_c1 3300050491 Bacteria 1658
211 nmdc:mga0yw44_99919_c1 3300050492 Bacteria 1847
212 nmdc:mga07m45_97956_c1 3300050496 Bacteria 1683
213 nmdc:mga08x19_97720_c1 3300050514 Bacteria 1944
214 Ga0495601_0219450 3300053077 Bacteria 1242
215 Ga0500635_0000984 3300053080 Bacteria 6846
216 Ga0495619_0169811 3300053085 Bacteria 1508
217 Ga0500566_0010043 3300053094 Bacteria 5584
218 Ga0500640_000777 3300053095 Bacteria 8678
219 Ga0500554_017192 3300053102 Bacteria 1928
220 Ga0500572_001143 3300053111 Bacteria 7708
221 Ga0500595_000919 3300053119 Bacteria 16715
222 Ga0500595_000985 3300053119 Bacteria 15994
223 Ga0500608_005288 3300053122 Bacteria 5112
224 Ga0500614_002296 3300053123 Bacteria 4289
225 Ga0500559_0005467 3300053136 Bacteria 5841
226 Ga0500559_0021133 3300053136 Bacteria 2756
227 Ga0500603_000247 3300053150 Bacteria 14210
228 Ga0500630_003881 3300053159 Bacteria 7256
229 Ga0500638_007423 3300053162 Bacteria 4584
230 Ga0500638_031406 3300053162 Bacteria 2562
231 Ga0500639_002314 3300053163 Bacteria 9559
232 Ga0500637_0000733 3300053178 Bacteria 13116
233 Ga0500637_0024026 3300053178 Bacteria 3338
234 Ga0500645_012501 3300053730 Bacteria 2741
235 Ga0500596_001713 3300053735 Bacteria 4442
236 Ga0500661_000435 3300055283 Bacteria 7727
237 2513661020 2513237096 Bacteria 8722461
238 2513857327 2513237137 Bacteria 9558895
239 2513918946 2513237145 Bacteria 8979722
240 2517888273 2517572143 Bacteria 9484767
241 2644202937 2643221636 Bacteria 6583769
242 2728753926 2728368998 Bacteria 8720350
243 2793078063
244 2876809262 2876808645 Bacteria 8824342
245 2879112505 2879110137 Bacteria 8907982
246 2889036273 2889033259 Bacteria 9099371
247 2906639127 2906635258 Bacteria 8601019
248 2906666694 2906660503 Bacteria 8595048
249 2922389271 2922386360 Bacteria 7017218
250 8006990606 8006984368 Bacteria 9651211
251 8006997089 8006994254 Bacteria 8309700
252 8056678293 8056673599 Bacteria 7871253
253 8056690909 8056689827 Bacteria 6712655
254 Ga0070712_100108201
255 JGI25165J46597_1005502
256 Ga0070676_10090690
257 Ga0070683_100244925
258 Ga0070670_100155832
259 Ga0070682_100090829
260 Ga0068868_100006382
261 Ga0070661_100183643
262 Ga0070668_100028778
263 Ga0070674_100254704
264 Ga0070709_10005959
265 Ga0070714_100087430
266 Ga0070713_100016301
267 Ga0070710_10001376
268 Ga0070711_100001632
269 Ga0070711_100012105
270 Ga0070700_100122355
271 Ga0070663_100012980
272 Ga0070678_100148764
273 Ga0070678_100437554
274 Ga0070681_10141503
275 Ga0070698_100182128
276 Ga0070684_100049748
277 Ga0070697_100298059
278 Ga0070672_100040690
279 Ga0070686_100072845
280 Ga0070665_100036591
281 Ga0070665_100102472
282 Ga0068855_100024415
283 Ga0068855_100446994
284 Ga0068857_100061887
285 Ga0068854_100256699
286 Ga0068859_100113626
287 Ga0068864_100068729
288 Ga0068864_100309555
289 Ga0068861_100526854
290 Ga0068858_100096452
291 Ga0081455_10036064
292 Ga0081540_1001913
293 Ga0081540_1096410
294 Ga0070717_10000576
295 Ga0070717_10110456
296 Ga0070716_100001127
297 Ga0070712_100032769
298 Ga0075369_10012872
299 Ga0097621_100022951
300 Ga0068871_100079478
301 Ga0097620_100113620
302 Ga0099794_10001673
303 Ga0099794_10009708
304 Ga0105240_10030084
305 Ga0105240_10109874
306 Ga0111539_10088658
307 Ga0105245_10044014
308 Ga0105247_10105868
309 Ga0105243_10181837
310 Ga0105242_10268233
311 Ga0105248_10749968
312 Ga0105237_10015984
313 Ga0105237_10187848
314 Ga0105238_10022627
315 Ga0099796_10010879
316 Ga0105239_10016594
317 Ga0105239_10044505
318 Ga0105239_10704803
319 Ga0105246_10017484
320 Ga0157370_10062091
321 Ga0157374_10038498
322 Ga0157378_10010562
323 Ga0163162_10021132
324 Ga0163162_10464844
325 Ga0163162_10879699
326 Ga0157375_10237252
327 Ga0163163_10039498
328 Ga0157376_10086278
329 Ga0163161_10038526
330 Ga0209148_1004817
331 Ga0209233_1002791
332 Ga0209233_1004403
333 Ga0209455_1012410
334 Ga0207692_10014259
335 Ga0207642_10151657
336 Ga0207688_10143346
337 Ga0207688_10261022
338 Ga0207685_10051789
339 Ga0207699_10000543
340 Ga0207707_10070896
341 Ga0207693_10002625
342 Ga0207693_10027221
343 Ga0207693_10086130
344 Ga0207663_10005176
345 Ga0207660_10021143
346 Ga0207657_10130617
347 Ga0207649_10069826
348 Ga0207681_10244467
349 Ga0207694_10151610
350 Ga0207650_10098528
351 Ga0207687_10070384
352 Ga0207700_10121365
353 Ga0207664_10082725
354 Ga0207664_10099789
355 Ga0207686_10117509
356 Ga0207669_10002441
357 Ga0207669_10088279
358 Ga0207704_10006360
359 Ga0207665_10004674
360 Ga0207711_10031038
361 Ga0207661_10276405
362 Ga0207667_10024559
363 Ga0207651_10294508
364 Ga0207668_10040724
365 Ga0207677_10015108
366 Ga0207703_10269016
367 Ga0207678_10016254
368 Ga0207678_10021696
369 Ga0207708_10104479
370 Ga0207641_10394967
371 Ga0207648_10611320
372 Ga0207676_10054484
373 Ga0207674_10140781
374 Ga0207674_10219394
375 Ga0207675_100177957
376 Ga0207675_100718753
377 Ga0207683_10324380
378 Ga0209588_1001063
379 Ga0268266_10000466
380 Ga0268266_10008795
381 Ga0268266_10040314
382 Ga0268266_10369800
383 Ga0268264_10151373
384 Ga0307517_10002814
385 Ga0307515_10192095
386 Ga0265330_10010253
387 Ga0265330_10028912
388 Ga0265325_10044007
389 Ga0265340_10021177
390 Ga0265331_10150154
391 Ga0265316_10111891
392 Ga0307509_10063540
393 Ga0307408_100318225
394 Ga0307508_10001480
395 Ga0307516_10150457
396 Ga0307516_10185283
397 Ga0307409_100241434
398 Ga0307411_10005088
399 Ga0307415_100081147
400 Ga0307510_10013037
401 Ga0307510_10191277
402 Ga0315911_1000021
403 Ga0373934_0102743
404 Ga0373943_0053282
405 Ga0373927_0047454
406 Ga0373933_0000163
407 Ga0373947_0052621
408 Ga0373947_0189618
409 Ga0395898_0007133
410 Ga0395898_0037517
411 Ga0395905_0194254
412 Ga0395901_0141669
413 Ga0436360_1376398
414 Ga0466957_0090752
415 Ga0466957_0169192
416 Ga0466959_0075148
417 Ga0466967_0045267
418 Ga0495603_0014498
419 Ga0495603_0026385
420 Ga0495629_0113225
421 Ga0495651_0083204
422 Ga0495582_0136362
423 Ga0495584_0202379
424 Ga0495585_0077287
425 Ga0495620_0114184
426 Ga0495644_0075881
427 Ga0495663_0050659
428 Ga0495598_0014210
429 Ga0495622_0026025
430 Ga0495656_0005172
431 Ga0495625_0049994
432 Ga0495659_0028609
433 Ga0495588_0132424
434 Ga0495669_0011538
435 Ga0495589_0068815
436 Ga0495672_0019659
437 Ga0495672_0064515
438 Ga0496100_0003444
439 Ga0496101_0009681
440 Ga0496102_0000549
441 Ga0496103_0009442
442 Ga0496105_0022715
443 Ga0496106_0097485
444 Ga0496107_0014085
445 Ga0496108_0038973
446 Ga0496110_0028925
447 Ga0496112_0055691
448 Ga0496112_0195259
449 Ga0496113_0031279
450 Ga0496114_0010265
451 Ga0496115_0044758
452 Ga0496115_0352233
453 Ga0496117_0036476
454 Ga0496118_0013053
455 Ga0496118_0128257
456 Ga0496121_0038127
457 Ga0496121_0068180
458 Ga0496124_0001503
459 Ga0496124_0266562
460 Ga0496126_0105894
461 Ga0496126_0144434
462 Ga0496126_0168824
463 nmdc:mga00v17_122326_c1
464 nmdc:mga0yw44_99919_c1
465 nmdc:mga07m45_97956_c1
466 nmdc:mga08x19_97720_c1
467 Ga0495601_0219450
468 Ga0500635_0000984
469 Ga0495619_0169811
470 Ga0500566_0010043
471 Ga0500640_000777
472 Ga0500554_017192
473 Ga0500572_001143
474 Ga0500595_000919
475 Ga0500595_000985
476 Ga0500608_005288
477 Ga0500614_002296
478 Ga0500559_0005467
479 Ga0500559_0021133
480 Ga0500603_000247
481 Ga0500630_003881
482 Ga0500638_007423
483 Ga0500638_031406
484 Ga0500639_002314
485 Ga0500637_0000733
486 Ga0500637_0024026
487 Ga0500645_012501
488 Ga0500596_001713
489 Ga0500661_000435
490 2513661020
491 2513857327
492 2513918946
493 2517888273
494 2644202937
495 2728753926
496 2793078063
497 2876809262
498 2879112505
499 2889036273
500 2906639127
501 2906666694
502 2922389271
503 8006990606
504 8006997089
505 8056678293
506 8056690909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

71

330

0.89

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

73

336

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.9457 13 312
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.9366 13 312
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8794 18 140
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8786 18 140
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8767 18 140
ID Description Score Start End Superfamily
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9509 16 312 3.40.50.1820
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9356 16 312 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.895 18 109 3.40.50.12270
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8648 31 140 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.84 18 109 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A1H3G878-F1-model_v4 Alpha/beta hydrolase fold 0.9897 20 112 GO:0016787
AF-A0A529Y2I4-F1-model_v4 Alpha/beta fold hydrolase 0.976 17 112 GO:0016020
GO:0016787
AF-A0A366KLG2-F1-model_v4 Alpha/beta hydrolase 0.9631 16 311 GO:0016020
GO:0046464
GO:0047372
AF-A0A848NLJ7-F1-model_v4 Alpha/beta hydrolase 0.9604 18 135 GO:0016020
GO:0016787
AF-A0A6L6WVB2-F1-model_v4 Alpha/beta fold hydrolase 0.9603 14 311 GO:0016787

Map