F364723
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 254 | 149 | 247 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100000268|Ga0068855_10000026828 |
| Length | 253 |
| Sequence | MKIRVKNHLPNAITCANLFSGCIGIVLAFKGELVAASYAIFLSAIFDFFDGLASRVLKAFSGIGKDLDSLADMVSFGVLPAVIMYQLFLQAHQIEKVSEWLNFIAFMIPVFSALRLAKFNVDTRQAENFIGLPTPANAILIASFPIILSHHNRFYTPYLVNPYVLPCIVIVMCTLXXXEMPMMSLKFKNSDFNENIFRYLLLLFSAILILFLKFAAVPLVIXIYIILSVIQFKFANVSIGGTPKKVNTNRSPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 2 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 3 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 4 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 5 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 6 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 7 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 8 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 96 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 102 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 103 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 104 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 110 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 111 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 112 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 113 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 114 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 115 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 116 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 143 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 144 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 145 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 146 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 147 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 148 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 149 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.06 |
| Metatranscriptomes | 1.18 |
| Isolates | 2.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.27 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 83.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1009512 | 3300001915 | Bacteria | 1782 |
| 2 | JGI24740J21852_10005301 | 3300001979 | Bacteria | 5471 |
| 3 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 4 | JGI24735J21928_10009496 | 3300002067 | Bacteria | 3122 |
| 5 | JGI25162J39368_1002026 | 3300002737 | Bacteria | 8939 |
| 6 | JGI25165J46597_1002705 | 3300003214 | Bacteria | 5271 |
| 7 | rootH1_10008508 | 3300003316 | Bacteria | 5101 |
| 8 | rootH1_10172976 | 3300003316 | Bacteria | 1270 |
| 9 | rootH2_10110926 | 3300003320 | Bacteria | 1476 |
| 10 | rootH2_10302283 | 3300003320 | Bacteria | 1057 |
| 11 | rootL2_10162043 | 3300003322 | Bacteria | 2968 |
| 12 | rootH1_10018482 | 3300003323 | Bacteria | 48371 |
| 13 | rootH1_10112320 | 3300003323 | Bacteria | 4769 |
| 14 | rootH1_10174632 | 3300003323 | Bacteria | 1124 |
| 15 | rootH1_10288858 | 3300003323 | Bacteria | 1173 |
| 16 | Ga0070658_10000018 | 3300005327 | Bacteria | 200558 |
| 17 | Ga0070658_10059798 | 3300005327 | Bacteria | 3103 |
| 18 | Ga0070658_10255555 | 3300005327 | Bacteria | 1487 |
| 19 | Ga0070683_100014928 | 3300005329 | Bacteria | 6809 |
| 20 | Ga0068868_100034759 | 3300005338 | Bacteria | 3893 |
| 21 | Ga0070660_100024631 | 3300005339 | Bacteria | 4465 |
| 22 | Ga0070675_100125196 | 3300005354 | Bacteria | 2186 |
| 23 | Ga0070671_100011939 | 3300005355 | Bacteria | 6988 |
| 24 | Ga0070673_100144582 | 3300005364 | Bacteria | 2009 |
| 25 | Ga0070659_100014736 | 3300005366 | Bacteria | 5848 |
| 26 | Ga0070663_100006454 | 3300005455 | Bacteria | 7057 |
| 27 | Ga0070678_100012059 | 3300005456 | Bacteria | 5357 |
| 28 | Ga0070662_100406012 | 3300005457 | Bacteria | 1125 |
| 29 | Ga0070681_10019794 | 3300005458 | Bacteria | 6739 |
| 30 | Ga0068867_100003025 | 3300005459 | Bacteria | 11855 |
| 31 | Ga0070684_100377045 | 3300005535 | Bacteria | 1306 |
| 32 | Ga0068853_100071691 | 3300005539 | Bacteria | 3018 |
| 33 | Ga0070672_100024198 | 3300005543 | Bacteria | 4484 |
| 34 | Ga0068855_100000090 | 3300005563 | Bacteria | 110528 |
| 35 | Ga0068855_100000268 | 3300005563 | Bacteria | 64693 |
| 36 | Ga0068855_100016341 | 3300005563 | Bacteria | 8924 |
| 37 | Ga0068857_100047445 | 3300005577 | Bacteria | 3814 |
| 38 | Ga0068857_100407560 | 3300005577 | Bacteria | 1266 |
| 39 | Ga0068856_100000897 | 3300005614 | Bacteria | 31872 |
| 40 | Ga0068856_100002063 | 3300005614 | Bacteria | 20822 |
| 41 | Ga0068856_100117436 | 3300005614 | Bacteria | 2661 |
| 42 | Ga0068852_100000143 | 3300005616 | Bacteria | 48192 |
| 43 | Ga0068852_100093119 | 3300005616 | Bacteria | 2700 |
| 44 | Ga0075366_10001066 | 3300006195 | Bacteria | 13460 |
| 45 | Ga0075366_10097670 | 3300006195 | Bacteria | 1761 |
| 46 | Ga0097621_100000028 | 3300006237 | Bacteria | 71678 |
| 47 | Ga0075370_10200803 | 3300006353 | Bacteria | 1176 |
| 48 | Ga0068871_100000066 | 3300006358 | Bacteria | 57980 |
| 49 | Ga0068865_100000127 | 3300006881 | Bacteria | 39327 |
| 50 | Ga0105240_10000876 | 3300009093 | Bacteria | 54171 |
| 51 | Ga0105240_10026729 | 3300009093 | Bacteria | 7569 |
| 52 | Ga0105240_10588266 | 3300009093 | Bacteria | 1227 |
| 53 | Ga0105245_10264156 | 3300009098 | Bacteria | 1676 |
| 54 | Ga0105241_10017142 | 3300009174 | Bacteria | 5320 |
| 55 | Ga0105241_10062753 | 3300009174 | Bacteria | 2865 |
| 56 | Ga0105241_10368279 | 3300009174 | Bacteria | 1252 |
| 57 | Ga0105242_10020443 | 3300009176 | Bacteria | 5191 |
| 58 | Ga0105242_10177230 | 3300009176 | Bacteria | 1878 |
| 59 | Ga0105237_10000233 | 3300009545 | Bacteria | 79346 |
| 60 | Ga0105237_10000485 | 3300009545 | Bacteria | 56664 |
| 61 | Ga0105237_10004544 | 3300009545 | Bacteria | 16031 |
| 62 | Ga0105237_10005170 | 3300009545 | Bacteria | 14766 |
| 63 | Ga0105237_10143216 | 3300009545 | Bacteria | 2385 |
| 64 | Ga0105237_10308185 | 3300009545 | Bacteria | 1586 |
| 65 | Ga0105238_10092755 | 3300009551 | Bacteria | 3008 |
| 66 | Ga0105238_10488050 | 3300009551 | Bacteria | 1232 |
| 67 | Ga0105239_10000039 | 3300010375 | Bacteria | 203537 |
| 68 | Ga0105239_10000120 | 3300010375 | Bacteria | 110003 |
| 69 | Ga0105239_10001068 | 3300010375 | Bacteria | 38074 |
| 70 | Ga0105239_10006088 | 3300010375 | Bacteria | 14046 |
| 71 | Ga0105239_10078643 | 3300010375 | Bacteria | 3630 |
| 72 | Ga0105239_10317402 | 3300010375 | Bacteria | 1757 |
| 73 | Ga0105239_11077377 | 3300010375 | Bacteria | 925 |
| 74 | Ga0157373_10000031 | 3300013100 | Bacteria | 126446 |
| 75 | Ga0157371_10000263 | 3300013102 | Bacteria | 71557 |
| 76 | Ga0157371_10001069 | 3300013102 | Bacteria | 29903 |
| 77 | Ga0157371_10010634 | 3300013102 | Bacteria | 7150 |
| 78 | Ga0157369_10001443 | 3300013105 | Bacteria | 29190 |
| 79 | Ga0157369_10095474 | 3300013105 | Bacteria | 3172 |
| 80 | Ga0157369_10365431 | 3300013105 | Bacteria | 1498 |
| 81 | Ga0157374_10000174 | 3300013296 | Bacteria | 59597 |
| 82 | Ga0157374_10000451 | 3300013296 | Bacteria | 37378 |
| 83 | Ga0157374_10583172 | 3300013296 | Bacteria | 1127 |
| 84 | Ga0157378_10014313 | 3300013297 | Bacteria | 6945 |
| 85 | Ga0157378_10017619 | 3300013297 | Bacteria | 6271 |
| 86 | Ga0163162_10009061 | 3300013306 | Bacteria | 9675 |
| 87 | Ga0163162_10014100 | 3300013306 | Bacteria | 7811 |
| 88 | Ga0157372_10000050 | 3300013307 | Bacteria | 140381 |
| 89 | Ga0157372_10000266 | 3300013307 | Bacteria | 57783 |
| 90 | Ga0157372_10000660 | 3300013307 | Bacteria | 37899 |
| 91 | Ga0157372_10006209 | 3300013307 | Bacteria | 12699 |
| 92 | Ga0157372_10015188 | 3300013307 | Bacteria | 8244 |
| 93 | Ga0157372_10285117 | 3300013307 | Bacteria | 1920 |
| 94 | Ga0157375_10030029 | 3300013308 | Bacteria | 5119 |
| 95 | Ga0157375_10276691 | 3300013308 | Bacteria | 1841 |
| 96 | Ga0157376_10186203 | 3300014969 | Bacteria | 1901 |
| 97 | Ga0163161_10058889 | 3300017792 | Bacteria | 2792 |
| 98 | Ga0206351_10956156 | 3300020077 | Bacteria | 1249 |
| 99 | Ga0206352_10156455 | 3300020078 | Bacteria | 932 |
| 100 | Ga0206350_10935106 | 3300020080 | Bacteria | 1558 |
| 101 | Ga0209563_106392 | 3300025230 | Bacteria | 2028 |
| 102 | Ga0207427_100172 | 3300025231 | Bacteria | 71550 |
| 103 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 104 | Ga0209026_1000219 | 3300025250 | Bacteria | 78822 |
| 105 | Ga0209026_1003422 | 3300025250 | Bacteria | 5214 |
| 106 | Ga0209026_1003780 | 3300025250 | Bacteria | 4800 |
| 107 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 108 | Ga0209233_1008430 | 3300025261 | Bacteria | 3194 |
| 109 | Ga0209455_1009960 | 3300025272 | Bacteria | 2453 |
| 110 | Ga0207647_10000662 | 3300025904 | Bacteria | 26925 |
| 111 | Ga0207647_10180569 | 3300025904 | Bacteria | 1226 |
| 112 | Ga0207645_10001390 | 3300025907 | Bacteria | 19866 |
| 113 | Ga0207705_10000036 | 3300025909 | Bacteria | 200787 |
| 114 | Ga0207705_10040265 | 3300025909 | Bacteria | 3351 |
| 115 | Ga0207705_10223776 | 3300025909 | Bacteria | 1430 |
| 116 | Ga0207654_10005732 | 3300025911 | Bacteria | 6273 |
| 117 | Ga0207654_10064669 | 3300025911 | Bacteria | 2151 |
| 118 | Ga0207707_10015132 | 3300025912 | Bacteria | 6715 |
| 119 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 120 | Ga0207695_10032015 | 3300025913 | Bacteria | 5759 |
| 121 | Ga0207695_10121642 | 3300025913 | Bacteria | 2577 |
| 122 | Ga0207695_10414687 | 3300025913 | Bacteria | 1231 |
| 123 | Ga0207671_10000663 | 3300025914 | Bacteria | 44922 |
| 124 | Ga0207671_10011406 | 3300025914 | Bacteria | 7239 |
| 125 | Ga0207671_10012094 | 3300025914 | Bacteria | 6969 |
| 126 | Ga0207671_10207370 | 3300025914 | Bacteria | 1532 |
| 127 | Ga0207671_10408291 | 3300025914 | Bacteria | 1080 |
| 128 | Ga0207657_10034762 | 3300025919 | Bacteria | 4528 |
| 129 | Ga0207652_10326177 | 3300025921 | Bacteria | 1386 |
| 130 | Ga0207694_10185445 | 3300025924 | Bacteria | 1689 |
| 131 | Ga0207644_10013787 | 3300025931 | Bacteria | 5399 |
| 132 | Ga0207690_10008888 | 3300025932 | Bacteria | 5963 |
| 133 | Ga0207706_10558216 | 3300025933 | Bacteria | 985 |
| 134 | Ga0207686_10306407 | 3300025934 | Bacteria | 1181 |
| 135 | Ga0207704_10000044 | 3300025938 | Bacteria | 86753 |
| 136 | Ga0207691_10048348 | 3300025940 | Bacteria | 3901 |
| 137 | Ga0207661_10009939 | 3300025944 | Bacteria | 6834 |
| 138 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 139 | Ga0207667_10000971 | 3300025949 | Bacteria | 36600 |
| 140 | Ga0207667_10025169 | 3300025949 | Bacteria | 6521 |
| 141 | Ga0207667_10041690 | 3300025949 | Bacteria | 4881 |
| 142 | Ga0207667_10281087 | 3300025949 | Bacteria | 1701 |
| 143 | Ga0207651_10029023 | 3300025960 | Bacteria | 3499 |
| 144 | Ga0207677_10012208 | 3300026023 | Bacteria | 4928 |
| 145 | Ga0207639_10010971 | 3300026041 | Bacteria | 6280 |
| 146 | Ga0207678_10006043 | 3300026067 | Bacteria | 10770 |
| 147 | Ga0207702_10000797 | 3300026078 | Bacteria | 33437 |
| 148 | Ga0207702_10002698 | 3300026078 | Bacteria | 16666 |
| 149 | Ga0207702_10197459 | 3300026078 | Bacteria | 1863 |
| 150 | Ga0207648_10000529 | 3300026089 | Bacteria | 42805 |
| 151 | Ga0207674_10063810 | 3300026116 | Bacteria | 3717 |
| 152 | Ga0207674_10736748 | 3300026116 | Bacteria | 951 |
| 153 | Ga0207683_10006840 | 3300026121 | Bacteria | 9766 |
| 154 | Ga0207698_10003256 | 3300026142 | Bacteria | 9759 |
| 155 | Ga0307517_10010238 | 3300028786 | Bacteria | 13156 |
| 156 | Ga0307515_10001997 | 3300028794 | Bacteria | 45190 |
| 157 | Ga0307515_10002629 | 3300028794 | Bacteria | 38616 |
| 158 | Ga0265338_10001821 | 3300028800 | Bacteria | 33458 |
| 159 | Ga0265338_10100447 | 3300028800 | Bacteria | 2359 |
| 160 | Ga0307408_100000143 | 3300031548 | Bacteria | 79423 |
| 161 | Ga0307408_100015404 | 3300031548 | Bacteria | 5089 |
| 162 | Ga0307408_100091136 | 3300031548 | Bacteria | 2301 |
| 163 | Ga0307409_100349298 | 3300031995 | Unclassified | 1395 |
| 164 | Ga0307416_100065138 | 3300032002 | Bacteria | 2993 |
| 165 | Ga0307411_10030778 | 3300032005 | Bacteria | 3294 |
| 166 | Ga0307507_10000015 | 3300033179 | Bacteria | 237419 |
| 167 | Ga0307510_10011192 | 3300033180 | Bacteria | 10666 |
| 168 | Ga0373941_0013874 | 3300035115 | Bacteria | 2140 |
| 169 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 170 | Ga0395899_0000640 | 3300037312 | Bacteria | 36134 |
| 171 | Ga0395899_0034511 | 3300037312 | Bacteria | 3800 |
| 172 | Ga0395900_0001234 | 3300037418 | Bacteria | 31453 |
| 173 | Ga0395900_0006335 | 3300037418 | Bacteria | 12338 |
| 174 | Ga0395900_0790117 | 3300037418 | Bacteria | 878 |
| 175 | Ga0395905_0003090 | 3300037471 | Bacteria | 17997 |
| 176 | Ga0395905_0799793 | 3300037471 | Unclassified | 846 |
| 177 | Ga0395901_0004520 | 3300038443 | Bacteria | 14030 |
| 178 | Ga0395901_0196139 | 3300038443 | Bacteria | 2117 |
| 179 | Ga0439455_0024804 | 3300042012 | Bacteria | 1453 |
| 180 | Ga0451577_0000010 | 3300042876 | Bacteria | 616686 |
| 181 | Ga0451577_0049276 | 3300042876 | Unclassified | 3761 |
| 182 | Ga0451577_0051010 | 3300042876 | Bacteria | 3693 |
| 183 | Ga0451577_0240041 | 3300042876 | Bacteria | 1640 |
| 184 | Ga0453683_0000111 | 3300044673 | Bacteria | 122663 |
| 185 | Ga0453683_0003788 | 3300044673 | Bacteria | 11017 |
| 186 | Ga0453683_0199487 | 3300044673 | Bacteria | 1270 |
| 187 | Ga0453683_0403381 | 3300044673 | Bacteria | 881 |
| 188 | Ga0466961_0154216 | 3300044693 | Bacteria | 1433 |
| 189 | Ga0453684_0000130 | 3300044712 | Bacteria | 331761 |
| 190 | Ga0453684_0002144 | 3300044712 | Bacteria | 49481 |
| 191 | Ga0453684_0159147 | 3300044712 | Unclassified | 2673 |
| 192 | Ga0453684_1098588 | 3300044712 | Unclassified | 840 |
| 193 | Ga0451576_0000670 | 3300045051 | Bacteria | 70399 |
| 194 | Ga0451576_0042360 | 3300045051 | Bacteria | 4807 |
| 195 | Ga0451576_0133450 | 3300045051 | Bacteria | 2588 |
| 196 | Ga0451576_0139691 | 3300045051 | Unclassified | 2527 |
| 197 | Ga0451576_0306075 | 3300045051 | Bacteria | 1663 |
| 198 | Ga0451576_0361016 | 3300045051 | Bacteria | 1521 |
| 199 | Ga0466958_0037027 | 3300045836 | Bacteria | 2922 |
| 200 | Ga0495638_0113534 | 3300046460 | Bacteria | 1607 |
| 201 | Ga0495651_0050806 | 3300046462 | Bacteria | 3198 |
| 202 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 203 | Ga0495650_0029898 | 3300046471 | Bacteria | 2476 |
| 204 | Ga0495585_0000286 | 3300046492 | Bacteria | 50524 |
| 205 | Ga0495607_0103178 | 3300046501 | Bacteria | 1524 |
| 206 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 207 | Ga0495606_0026825 | 3300046507 | Bacteria | 4097 |
| 208 | Ga0495606_0036546 | 3300046507 | Bacteria | 3344 |
| 209 | Ga0495610_0009503 | 3300046512 | Bacteria | 6138 |
| 210 | Ga0495616_0011404 | 3300046513 | Bacteria | 5091 |
| 211 | Ga0495631_0010350 | 3300046518 | Bacteria | 4616 |
| 212 | Ga0495631_0060149 | 3300046518 | Bacteria | 1649 |
| 213 | Ga0495637_0021664 | 3300046520 | Bacteria | 2944 |
| 214 | Ga0495644_0013350 | 3300046523 | Bacteria | 3152 |
| 215 | Ga0495648_0001785 | 3300046524 | Bacteria | 20692 |
| 216 | Ga0495652_0324062 | 3300046529 | Bacteria | 1112 |
| 217 | Ga0495609_0006171 | 3300046538 | Bacteria | 6162 |
| 218 | Ga0495622_0188165 | 3300046557 | Bacteria | 924 |
| 219 | Ga0495633_0000035 | 3300046558 | Bacteria | 185403 |
| 220 | Ga0495633_0003276 | 3300046558 | Bacteria | 10897 |
| 221 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 222 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 223 | Ga0495625_0000753 | 3300046660 | Bacteria | 45225 |
| 224 | Ga0495625_0001038 | 3300046660 | Bacteria | 36510 |
| 225 | Ga0495625_0082824 | 3300046660 | Bacteria | 2230 |
| 226 | Ga0495625_0172526 | 3300046660 | Bacteria | 1443 |
| 227 | Ga0495625_0285619 | 3300046660 | Bacteria | 1060 |
| 228 | Ga0495661_0009214 | 3300046665 | Bacteria | 6782 |
| 229 | Ga0495661_0021105 | 3300046665 | Bacteria | 4249 |
| 230 | Ga0495671_0125292 | 3300046692 | Bacteria | 1253 |
| 231 | Ga0495649_0000018 | 3300046694 | Bacteria | 220586 |
| 232 | Ga0495683_0112410 | 3300047323 | Bacteria | 1299 |
| 233 | Ga0495687_004055 | 3300047443 | Bacteria | 10153 |
| 234 | Ga0495679_046375 | 3300047446 | Bacteria | 1323 |
| 235 | Ga0495686_0006391 | 3300047472 | Bacteria | 9035 |
| 236 | Ga0495686_0206287 | 3300047472 | Bacteria | 1125 |
| 237 | Ga0495614_0114704 | 3300048089 | Bacteria | 1184 |
| 238 | nmdc:mga0k408_1225_c1 | 3300050493 | Bacteria | 14065 |
| 239 | nmdc:mga0k408_3989_c1 | 3300050493 | Bacteria | 7825 |
| 240 | nmdc:mga07m45_232030_c1 | 3300050496 | Bacteria | 1074 |
| 241 | Ga0500608_000203 | 3300053122 | Bacteria | 23751 |
| 242 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 243 | Ga0500618_043626 | 3300053125 | Bacteria | 1025 |
| 244 | Ga0500642_0028794 | 3300053130 | Bacteria | 2295 |
| 245 | Ga0500622_0003444 | 3300053156 | Bacteria | 10568 |
| 246 | Ga0500624_000572 | 3300053157 | Bacteria | 10163 |
| 247 | Ga0500634_0041116 | 3300053161 | Bacteria | 2511 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0051010 | Ga0451577_0051010_2495_3106 | 171 |
| 2 | 3300044712 | Ga0453684_0002144 | Ga0453684_0002144_6552_7163 | 171 |
| 3 | 3300045051 | Ga0451576_0042360 | Ga0451576_0042360_2573_3184 | 171 |
| 4 | 3300053161 | Ga0500634_0041116 | Ga0500634_0041116_39_659 | 173 |
| 5 | 3300037418 | Ga0395900_0001234 | Ga0395900_0001234_19581_20324 | 177 |
| 6 | 3300037418 | Ga0395900_0790117 | Ga0395900_0790117_57_710 | 177 |
| 7 | 3300028786 | Ga0307517_10010238 | Ga0307517_100102382 | 184 |
| 8 | 3300033180 | Ga0307510_10011192 | Ga0307510_100111926 | 184 |
| 9 | 3300003316 | rootH1_10172976 | rootH1_101729762 | 186 |
| 10 | 3300005327 | Ga0070658_10000018 | Ga0070658_10000018102 | 187 |
| 11 | 3300005563 | Ga0068855_100016341 | Ga0068855_1000163413 | 187 |
| 12 | 3300010375 | Ga0105239_10317402 | Ga0105239_103174022 | 187 |
| 13 | 3300025909 | Ga0207705_10000036 | Ga0207705_1000003693 | 187 |
| 14 | 3300025949 | Ga0207667_10041690 | Ga0207667_100416905 | 187 |
| 15 | 3300042012 | Ga0439455_0024804 | Ga0439455_0024804_615_1337 | 189 |
| 16 | 3300005355 | Ga0070671_100011939 | Ga0070671_1000119392 | 190 |
| 17 | 3300025931 | Ga0207644_10013787 | Ga0207644_100137872 | 190 |
| 18 | 3300005457 | Ga0070662_100406012 | Ga0070662_1004060122 | 191 |
| 19 | 3300009098 | Ga0105245_10264156 | Ga0105245_102641564 | 191 |
| 20 | 3300013307 | Ga0157372_10285117 | Ga0157372_102851172 | 191 |
| 21 | 3300013308 | Ga0157375_10276691 | Ga0157375_102766911 | 191 |
| 22 | 3300025933 | Ga0207706_10558216 | Ga0207706_105582161 | 191 |
| 23 | 3300005338 | Ga0068868_100034759 | Ga0068868_1000347593 | 192 |
| 24 | 3300005354 | Ga0070675_100125196 | Ga0070675_1001251962 | 192 |
| 25 | 3300005364 | Ga0070673_100144582 | Ga0070673_1001445823 | 192 |
| 26 | 3300005456 | Ga0070678_100012059 | Ga0070678_1000120594 | 192 |
| 27 | 3300005459 | Ga0068867_100003025 | Ga0068867_1000030259 | 192 |
| 28 | 3300005543 | Ga0070672_100024198 | Ga0070672_1000241985 | 192 |
| 29 | 3300005616 | Ga0068852_100000143 | Ga0068852_1000001435 | 192 |
| 30 | 3300006237 | Ga0097621_100000028 | Ga0097621_10000002822 | 192 |
| 31 | 3300006358 | Ga0068871_100000066 | Ga0068871_10000006619 | 192 |
| 32 | 3300006881 | Ga0068865_100000127 | Ga0068865_10000012737 | 192 |
| 33 | 3300009176 | Ga0105242_10020443 | Ga0105242_100204432 | 192 |
| 34 | 3300009545 | Ga0105237_10005170 | Ga0105237_1000517010 | 192 |
| 35 | 3300009551 | Ga0105238_10092755 | Ga0105238_100927552 | 192 |
| 36 | 3300010375 | Ga0105239_11077377 | Ga0105239_110773771 | 192 |
| 37 | 3300013296 | Ga0157374_10000174 | Ga0157374_1000017466 | 192 |
| 38 | 3300013297 | Ga0157378_10014313 | Ga0157378_100143135 | 192 |
| 39 | 3300014969 | Ga0157376_10186203 | Ga0157376_101862032 | 192 |
| 40 | 3300025907 | Ga0207645_10001390 | Ga0207645_1000139018 | 192 |
| 41 | 3300025924 | Ga0207694_10185445 | Ga0207694_101854452 | 192 |
| 42 | 3300025934 | Ga0207686_10306407 | Ga0207686_103064072 | 192 |
| 43 | 3300025938 | Ga0207704_10000044 | Ga0207704_1000004453 | 192 |
| 44 | 3300025940 | Ga0207691_10048348 | Ga0207691_100483482 | 192 |
| 45 | 3300025960 | Ga0207651_10029023 | Ga0207651_100290231 | 192 |
| 46 | 3300026023 | Ga0207677_10012208 | Ga0207677_100122085 | 192 |
| 47 | 3300026041 | Ga0207639_10010971 | Ga0207639_100109717 | 192 |
| 48 | 3300026089 | Ga0207648_10000529 | Ga0207648_1000052920 | 192 |
| 49 | 3300026121 | Ga0207683_10006840 | Ga0207683_100068405 | 192 |
| 50 | 3300026142 | Ga0207698_10003256 | Ga0207698_100032569 | 192 |
| 51 | 3300046518 | Ga0495631_0010350 | Ga0495631_0010350_399_1121 | 192 |
| 52 | 3300046660 | Ga0495625_0285619 | Ga0495625_0285619_312_1034 | 192 |
| 53 | 3300028800 | Ga0265338_10001821 | Ga0265338_1000182127 | 193 |
| 54 | 3300005339 | Ga0070660_100024631 | Ga0070660_1000246312 | 194 |
| 55 | 3300005539 | Ga0068853_100071691 | Ga0068853_1000716915 | 194 |
| 56 | 3300013307 | Ga0157372_10006209 | Ga0157372_100062094 | 194 |
| 57 | 3300025919 | Ga0207657_10034762 | Ga0207657_100347622 | 194 |
| 58 | 3300053157 | Ga0500624_000572 | Ga0500624_000572_6071_6802 | 194 |
| 59 | 3300003323 | rootH1_10112320 | rootH1_101123203 | 195 |
| 60 | 3300003323 | rootH1_10288858 | rootH1_102888582 | 195 |
| 61 | 3300009093 | Ga0105240_10000876 | Ga0105240_1000087661 | 195 |
| 62 | 3300009174 | Ga0105241_10017142 | Ga0105241_100171422 | 195 |
| 63 | 3300009545 | Ga0105237_10000233 | Ga0105237_100002333 | 195 |
| 64 | 3300010375 | Ga0105239_10001068 | Ga0105239_1000106824 | 195 |
| 65 | 3300025911 | Ga0207654_10005732 | Ga0207654_100057322 | 195 |
| 66 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013264 | 195 |
| 67 | 3300025914 | Ga0207671_10000663 | Ga0207671_100006633 | 195 |
| 68 | 3300053156 | Ga0500622_0003444 | Ga0500622_0003444_1983_2666 | 195 |
| 69 | 3300005563 | Ga0068855_100000090 | Ga0068855_10000009072 | 197 |
| 70 | 3300005614 | Ga0068856_100117436 | Ga0068856_1001174364 | 197 |
| 71 | 3300025949 | Ga0207667_10000009 | Ga0207667_10000009368 | 197 |
| 72 | 3300026078 | Ga0207702_10197459 | Ga0207702_101974592 | 197 |
| 73 | 3300042876 | Ga0451577_0240041 | Ga0451577_0240041_115_798 | 197 |
| 74 | 3300045051 | Ga0451576_0139691 | Ga0451576_0139691_493_1185 | 197 |
| 75 | 3300025913 | Ga0207695_10121642 | Ga0207695_101216422 | 201 |
| 76 | 3300028800 | Ga0265338_10100447 | Ga0265338_101004474 | 201 |
| 77 | 3300044693 | Ga0466961_0154216 | Ga0466961_0154216_797_1411 | 201 |
| 78 | 3300053122 | Ga0500608_000203 | Ga0500608_000203_4330_5052 | 201 |
| 79 | 3300009174 | Ga0105241_10368279 | Ga0105241_103682791 | 202 |
| 80 | 3300017792 | Ga0163161_10058889 | Ga0163161_100588892 | 202 |
| 81 | 3300025949 | Ga0207667_10281087 | Ga0207667_102810871 | 202 |
| 82 | 3300046501 | Ga0495607_0103178 | Ga0495607_0103178_197_919 | 202 |
| 83 | 3300046507 | Ga0495606_0026825 | Ga0495606_0026825_45_791 | 202 |
| 84 | 3300010375 | Ga0105239_10000120 | Ga0105239_1000012086 | 203 |
| 85 | 3300031548 | Ga0307408_100015404 | Ga0307408_1000154042 | 203 |
| 86 | 3300031548 | Ga0307408_100091136 | Ga0307408_1000911363 | 203 |
| 87 | 3300031995 | Ga0307409_100349298 | Ga0307409_1003492981 | 203 |
| 88 | 3300002067 | JGI24735J21928_10009496 | JGI24735J21928_100094962 | 204 |
| 89 | 3300005366 | Ga0070659_100014736 | Ga0070659_1000147364 | 204 |
| 90 | 3300005577 | Ga0068857_100047445 | Ga0068857_1000474455 | 204 |
| 91 | 3300006195 | Ga0075366_10001066 | Ga0075366_100010662 | 204 |
| 92 | 3300013102 | Ga0157371_10000263 | Ga0157371_100002635 | 204 |
| 93 | 3300013105 | Ga0157369_10095474 | Ga0157369_100954742 | 204 |
| 94 | 3300013307 | Ga0157372_10000266 | Ga0157372_1000026638 | 204 |
| 95 | 3300025261 | Ga0209233_1008430 | Ga0209233_10084303 | 204 |
| 96 | 3300025904 | Ga0207647_10000662 | Ga0207647_1000066221 | 204 |
| 97 | 3300025932 | Ga0207690_10008888 | Ga0207690_100088884 | 204 |
| 98 | 3300026116 | Ga0207674_10063810 | Ga0207674_100638105 | 204 |
| 99 | 3300038443 | Ga0395901_0196139 | Ga0395901_0196139_33_773 | 204 |
| 100 | 3300050493 | nmdc:mga0k408_1225_c1 | nmdc:mga0k408_1225_c1_11409_12131 | 204 |
| 101 | 3300009176 | Ga0105242_10177230 | Ga0105242_101772302 | 205 |
| 102 | 3300031548 | Ga0307408_100000143 | Ga0307408_10000014365 | 205 |
| 103 | 3300032005 | Ga0307411_10030778 | Ga0307411_100307785 | 205 |
| 104 | 3300035115 | Ga0373941_0013874 | Ga0373941_0013874_1154_1894 | 205 |
| 105 | iso_pu_bacteria | 2852623160 | 2852626906 | 205 |
| 106 | iso_pu_bacteria | 2884933994 | 2884938042 | 205 |
| 107 | iso_pu_bacteria | 2919437846 | 2919439007 | 205 |
| 108 | iso_pu_bacteria | 2928078545 | 2928080626 | 205 |
| 109 | iso_pu_bacteria | 2928147474 | 2928150851 | 205 |
| 110 | iso_pu_bacteria | 2932082852 | 2932082989 | 205 |
| 111 | 3300025949 | Ga0207667_10025169 | Ga0207667_100251696 | 206 |
| 112 | 3300032002 | Ga0307416_100065138 | Ga0307416_1000651382 | 206 |
| 113 | 3300044673 | Ga0453683_0003788 | Ga0453683_0003788_587_1321 | 206 |
| 114 | 3300044712 | Ga0453684_1098588 | Ga0453684_1098588_12_746 | 206 |
| 115 | 3300045051 | Ga0451576_0133450 | Ga0451576_0133450_87_821 | 206 |
| 116 | 3300045051 | Ga0451576_0361016 | Ga0451576_0361016_87_821 | 206 |
| 117 | 3300047472 | Ga0495686_0006391 | Ga0495686_0006391_3919_4641 | 206 |
| 118 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_10000004115 | 207 |
| 119 | 3300003316 | rootH1_10008508 | rootH1_100085082 | 207 |
| 120 | 3300003322 | rootL2_10162043 | rootL2_101620432 | 207 |
| 121 | 3300003323 | rootH1_10174632 | rootH1_101746321 | 207 |
| 122 | 3300005329 | Ga0070683_100014928 | Ga0070683_1000149288 | 207 |
| 123 | 3300005535 | Ga0070684_100377045 | Ga0070684_1003770452 | 207 |
| 124 | 3300005577 | Ga0068857_100407560 | Ga0068857_1004075602 | 207 |
| 125 | 3300005614 | Ga0068856_100002063 | Ga0068856_10000206321 | 207 |
| 126 | 3300006195 | Ga0075366_10097670 | Ga0075366_100976703 | 207 |
| 127 | 3300006353 | Ga0075370_10200803 | Ga0075370_102008032 | 207 |
| 128 | 3300013100 | Ga0157373_10000031 | Ga0157373_1000003115 | 207 |
| 129 | 3300013102 | Ga0157371_10010634 | Ga0157371_100106347 | 207 |
| 130 | 3300013105 | Ga0157369_10365431 | Ga0157369_103654312 | 207 |
| 131 | 3300013297 | Ga0157378_10017619 | Ga0157378_100176195 | 207 |
| 132 | 3300013306 | Ga0163162_10014100 | Ga0163162_100141002 | 207 |
| 133 | 3300013307 | Ga0157372_10000660 | Ga0157372_1000066017 | 207 |
| 134 | 3300013307 | Ga0157372_10015188 | Ga0157372_100151884 | 207 |
| 135 | 3300013308 | Ga0157375_10030029 | Ga0157375_100300296 | 207 |
| 136 | 3300020077 | Ga0206351_10956156 | Ga0206351_109561561 | 207 |
| 137 | 3300020078 | Ga0206352_10156455 | Ga0206352_101564552 | 207 |
| 138 | 3300020080 | Ga0206350_10935106 | Ga0206350_109351062 | 207 |
| 139 | 3300025904 | Ga0207647_10180569 | Ga0207647_101805692 | 207 |
| 140 | 3300025944 | Ga0207661_10009939 | Ga0207661_100099392 | 207 |
| 141 | 3300026078 | Ga0207702_10002698 | Ga0207702_1000269816 | 207 |
| 142 | 3300026116 | Ga0207674_10736748 | Ga0207674_107367481 | 207 |
| 143 | 3300037312 | Ga0395899_0034511 | Ga0395899_0034511_1764_2495 | 207 |
| 144 | 3300037418 | Ga0395900_0006335 | Ga0395900_0006335_7254_7985 | 207 |
| 145 | 3300037471 | Ga0395905_0003090 | Ga0395905_0003090_1036_1767 | 207 |
| 146 | 3300038443 | Ga0395901_0004520 | Ga0395901_0004520_5540_6271 | 207 |
| 147 | 3300042876 | Ga0451577_0000010 | Ga0451577_0000010_279983_280720 | 207 |
| 148 | 3300042876 | Ga0451577_0049276 | Ga0451577_0049276_279_1016 | 207 |
| 149 | 3300044673 | Ga0453683_0000111 | Ga0453683_0000111_38894_39631 | 207 |
| 150 | 3300044673 | Ga0453683_0199487 | Ga0453683_0199487_116_853 | 207 |
| 151 | 3300044673 | Ga0453683_0403381 | Ga0453683_0403381_17_754 | 207 |
| 152 | 3300044712 | Ga0453684_0000130 | Ga0453684_0000130_68300_69037 | 207 |
| 153 | 3300044712 | Ga0453684_0159147 | Ga0453684_0159147_1305_2042 | 207 |
| 154 | 3300045051 | Ga0451576_0000670 | Ga0451576_0000670_60332_61069 | 207 |
| 155 | 3300045051 | Ga0451576_0306075 | Ga0451576_0306075_660_1397 | 207 |
| 156 | 3300046460 | Ga0495638_0113534 | Ga0495638_0113534_335_1057 | 207 |
| 157 | 3300046471 | Ga0495650_0000087 | Ga0495650_0000087_33468_34190 | 207 |
| 158 | 3300046492 | Ga0495585_0000286 | Ga0495585_0000286_22001_22723 | 207 |
| 159 | 3300046507 | Ga0495606_0000052 | Ga0495606_0000052_160886_161608 | 207 |
| 160 | 3300046512 | Ga0495610_0009503 | Ga0495610_0009503_23_745 | 207 |
| 161 | 3300046513 | Ga0495616_0011404 | Ga0495616_0011404_2124_2846 | 207 |
| 162 | 3300046520 | Ga0495637_0021664 | Ga0495637_0021664_1729_2451 | 207 |
| 163 | 3300046529 | Ga0495652_0324062 | Ga0495652_0324062_11_760 | 207 |
| 164 | 3300046538 | Ga0495609_0006171 | Ga0495609_0006171_2497_3219 | 207 |
| 165 | 3300046557 | Ga0495622_0188165 | Ga0495622_0188165_56_778 | 207 |
| 166 | 3300046558 | Ga0495633_0003276 | Ga0495633_0003276_812_1534 | 207 |
| 167 | 3300046660 | Ga0495625_0000008 | Ga0495625_0000008_525756_526478 | 207 |
| 168 | 3300046660 | Ga0495625_0082824 | Ga0495625_0082824_132_854 | 207 |
| 169 | 3300046660 | Ga0495625_0172526 | Ga0495625_0172526_101_823 | 207 |
| 170 | 3300046665 | Ga0495661_0021105 | Ga0495661_0021105_37_759 | 207 |
| 171 | 3300046692 | Ga0495671_0125292 | Ga0495671_0125292_206_928 | 207 |
| 172 | 3300046694 | Ga0495649_0000018 | Ga0495649_0000018_9688_10410 | 207 |
| 173 | 3300047323 | Ga0495683_0112410 | Ga0495683_0112410_237_959 | 207 |
| 174 | 3300047443 | Ga0495687_004055 | Ga0495687_004055_6284_7006 | 207 |
| 175 | 3300047446 | Ga0495679_046375 | Ga0495679_046375_503_1225 | 207 |
| 176 | 3300047472 | Ga0495686_0206287 | Ga0495686_0206287_172_894 | 207 |
| 177 | 3300050496 | nmdc:mga07m45_232030_c1 | nmdc:mga07m45_232030_c1_244_966 | 207 |
| 178 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_21840_22589 | 207 |
| 179 | 3300053125 | Ga0500618_043626 | Ga0500618_043626_209_931 | 207 |
| 180 | 3300003320 | rootH2_10110926 | rootH2_101109262 | 208 |
| 181 | 3300005614 | Ga0068856_100000897 | Ga0068856_10000089715 | 208 |
| 182 | 3300025921 | Ga0207652_10326177 | Ga0207652_103261772 | 208 |
| 183 | 3300026078 | Ga0207702_10000797 | Ga0207702_1000079731 | 208 |
| 184 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_1016458_1017192 | 208 |
| 185 | 3300003320 | rootH2_10302283 | rootH2_103022831 | 209 |
| 186 | 3300005616 | Ga0068852_100093119 | Ga0068852_1000931192 | 209 |
| 187 | 3300009093 | Ga0105240_10588266 | Ga0105240_105882663 | 209 |
| 188 | 3300009545 | Ga0105237_10004544 | Ga0105237_100045447 | 209 |
| 189 | 3300009545 | Ga0105237_10143216 | Ga0105237_101432162 | 209 |
| 190 | 3300010375 | Ga0105239_10078643 | Ga0105239_100786435 | 209 |
| 191 | 3300013296 | Ga0157374_10000451 | Ga0157374_1000045142 | 209 |
| 192 | 3300013296 | Ga0157374_10583172 | Ga0157374_105831722 | 209 |
| 193 | 3300013306 | Ga0163162_10009061 | Ga0163162_100090614 | 209 |
| 194 | 3300025250 | Ga0209026_1000219 | Ga0209026_100021961 | 209 |
| 195 | 3300025250 | Ga0209026_1003422 | Ga0209026_10034227 | 209 |
| 196 | 3300025250 | Ga0209026_1003780 | Ga0209026_10037803 | 209 |
| 197 | 3300025913 | Ga0207695_10414687 | Ga0207695_104146872 | 209 |
| 198 | 3300025914 | Ga0207671_10012094 | Ga0207671_100120947 | 209 |
| 199 | 3300025914 | Ga0207671_10408291 | Ga0207671_104082911 | 209 |
| 200 | 3300028794 | Ga0307515_10001997 | Ga0307515_1000199726 | 209 |
| 201 | 3300028794 | Ga0307515_10002629 | Ga0307515_1000262940 | 209 |
| 202 | 3300033179 | Ga0307507_10000015 | Ga0307507_1000001551 | 209 |
| 203 | 3300037471 | Ga0395905_0799793 | Ga0395905_0799793_76_825 | 209 |
| 204 | 3300046471 | Ga0495650_0029898 | Ga0495650_0029898_60_782 | 209 |
| 205 | 3300046518 | Ga0495631_0060149 | Ga0495631_0060149_474_1196 | 209 |
| 206 | 3300046523 | Ga0495644_0013350 | Ga0495644_0013350_249_971 | 209 |
| 207 | 3300046524 | Ga0495648_0001785 | Ga0495648_0001785_16792_17514 | 209 |
| 208 | 3300046558 | Ga0495633_0000035 | Ga0495633_0000035_137530_138252 | 209 |
| 209 | 3300046616 | Ga0495668_0000032 | Ga0495668_0000032_59106_59828 | 209 |
| 210 | 3300046660 | Ga0495625_0000753 | Ga0495625_0000753_13253_13993 | 209 |
| 211 | 3300046660 | Ga0495625_0001038 | Ga0495625_0001038_20275_20997 | 209 |
| 212 | 3300046665 | Ga0495661_0009214 | Ga0495661_0009214_10_732 | 209 |
| 213 | 3300048089 | Ga0495614_0114704 | Ga0495614_0114704_214_936 | 209 |
| 214 | 3300050493 | nmdc:mga0k408_3989_c1 | nmdc:mga0k408_3989_c1_604_1344 | 209 |
| 215 | 3300053130 | Ga0500642_0028794 | Ga0500642_0028794_224_946 | 209 |
| 216 | 3300001915 | JGI24741J21665_1009512 | JGI24741J21665_10095124 | 210 |
| 217 | 3300001979 | JGI24740J21852_10005301 | JGI24740J21852_100053016 | 210 |
| 218 | 3300002737 | JGI25162J39368_1002026 | JGI25162J39368_10020265 | 210 |
| 219 | 3300003214 | JGI25165J46597_1002705 | JGI25165J46597_10027056 | 210 |
| 220 | 3300003323 | rootH1_10018482 | rootH1_1001848256 | 210 |
| 221 | 3300005327 | Ga0070658_10059798 | Ga0070658_100597982 | 210 |
| 222 | 3300005327 | Ga0070658_10255555 | Ga0070658_102555552 | 210 |
| 223 | 3300005455 | Ga0070663_100006454 | Ga0070663_1000064545 | 210 |
| 224 | 3300005458 | Ga0070681_10019794 | Ga0070681_100197945 | 210 |
| 225 | 3300005563 | Ga0068855_100000268 | Ga0068855_10000026828 | 210 |
| 226 | 3300009093 | Ga0105240_10026729 | Ga0105240_100267295 | 210 |
| 227 | 3300009174 | Ga0105241_10062753 | Ga0105241_100627532 | 210 |
| 228 | 3300009545 | Ga0105237_10000485 | Ga0105237_1000048523 | 210 |
| 229 | 3300009545 | Ga0105237_10308185 | Ga0105237_103081852 | 210 |
| 230 | 3300009551 | Ga0105238_10488050 | Ga0105238_104880502 | 210 |
| 231 | 3300010375 | Ga0105239_10000039 | Ga0105239_10000039137 | 210 |
| 232 | 3300010375 | Ga0105239_10006088 | Ga0105239_100060887 | 210 |
| 233 | 3300013102 | Ga0157371_10001069 | Ga0157371_100010692 | 210 |
| 234 | 3300013105 | Ga0157369_10001443 | Ga0157369_1000144318 | 210 |
| 235 | 3300013307 | Ga0157372_10000050 | Ga0157372_1000005098 | 210 |
| 236 | 3300025230 | Ga0209563_106392 | Ga0209563_1063923 | 210 |
| 237 | 3300025231 | Ga0207427_100172 | Ga0207427_10017261 | 210 |
| 238 | 3300025233 | Ga0209437_100034 | Ga0209437_100034166 | 210 |
| 239 | 3300025261 | Ga0209233_1000038 | Ga0209233_1000038166 | 210 |
| 240 | 3300025272 | Ga0209455_1009960 | Ga0209455_10099602 | 210 |
| 241 | 3300025909 | Ga0207705_10040265 | Ga0207705_100402652 | 210 |
| 242 | 3300025909 | Ga0207705_10223776 | Ga0207705_102237762 | 210 |
| 243 | 3300025911 | Ga0207654_10064669 | Ga0207654_100646692 | 210 |
| 244 | 3300025912 | Ga0207707_10015132 | Ga0207707_100151322 | 210 |
| 245 | 3300025913 | Ga0207695_10032015 | Ga0207695_100320152 | 210 |
| 246 | 3300025914 | Ga0207671_10011406 | Ga0207671_100114065 | 210 |
| 247 | 3300025914 | Ga0207671_10207370 | Ga0207671_102073702 | 210 |
| 248 | 3300025949 | Ga0207667_10000971 | Ga0207667_1000097114 | 210 |
| 249 | 3300026067 | Ga0207678_10006043 | Ga0207678_1000604310 | 210 |
| 250 | 3300037312 | Ga0395899_0000640 | Ga0395899_0000640_27524_28234 | 210 |
| 251 | 3300045836 | Ga0466958_0037027 | Ga0466958_0037027_144_854 | 210 |
| 252 | 3300046462 | Ga0495651_0050806 | Ga0495651_0050806_1997_2740 | 210 |
| 253 | 3300046507 | Ga0495606_0036546 | Ga0495606_0036546_1086_1799 | 210 |
| 254 | iso_pu_bacteria | 2977232053 | 2977236252 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.7742 | 4 | 204 |
| 6wmv-assembly1.cif.gz_C | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.7199 | 10 | 177 |
| 6wm5-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii | 0.7186 | 10 | 179 |
| 6wmv-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.7177 | 10 | 179 |
| 5d92-assembly2.cif.gz_B | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.7038 | 10 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZGY5_32_207_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8708 | 1 | 180 | 1.20.120.1760 |
| af_E7F188_23_199_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.832 | 2 | 180 | 1.20.120.1760 |
| af_P9WPG1_2_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8281 | 6 | 184 | 1.20.120.1760 |
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.803 | 8 | 179 | 1.20.120.1760 |
| af_Q58609_4_200_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8001 | 4 | 205 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258LCG4-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9551 | 6 | 189 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-A0A2E9G8U8-F1-model_v4 | deleted | 0.9484 | 5 | 192 |
|
| AF-A0A349Q2J5-F1-model_v4 | Phosphatidylserine synthase | 0.9473 | 4 | 141 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A497CZS9-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase | 0.9444 | 6 | 122 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A258LCG4-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9401 | 6 | 189 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar