F364723

General Info

Members Datasets Scaffolds Average Seq Length
254 149 247 225

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000268|Ga0068855_10000026828
Length 253
Sequence MKIRVKNHLPNAITCANLFSGCIGIVLAFKGELVAASYAIFLSAIFDFFDGLASRVLKAFSGIGKDLDSLADMVSFGVLPAVIMYQLFLQAHQIEKVSEWLNFIAFMIPVFSALRLAKFNVDTRQAENFIGLPTPANAILIASFPIILSHHNRFYTPYLVNPYVLPCIVIVMCTLXXXEMPMMSLKFKNSDFNENIFRYLLLLFSAILILFLKFAAVPLVIXIYIILSVIQFKFANVSIGGTPKKVNTNRSPR

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
5 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
6 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
7 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
145 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
146 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
149 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.06
Metatranscriptomes 1.18
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.27
Nodule 0
Rhizoplane 0
Rhizosphere 83.86
Stem 0
Stem Tuber 0
Unclassified 7.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009512 3300001915 Bacteria 1782
2 JGI24740J21852_10005301 3300001979 Bacteria 5471
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 JGI24735J21928_10009496 3300002067 Bacteria 3122
5 JGI25162J39368_1002026 3300002737 Bacteria 8939
6 JGI25165J46597_1002705 3300003214 Bacteria 5271
7 rootH1_10008508 3300003316 Bacteria 5101
8 rootH1_10172976 3300003316 Bacteria 1270
9 rootH2_10110926 3300003320 Bacteria 1476
10 rootH2_10302283 3300003320 Bacteria 1057
11 rootL2_10162043 3300003322 Bacteria 2968
12 rootH1_10018482 3300003323 Bacteria 48371
13 rootH1_10112320 3300003323 Bacteria 4769
14 rootH1_10174632 3300003323 Bacteria 1124
15 rootH1_10288858 3300003323 Bacteria 1173
16 Ga0070658_10000018 3300005327 Bacteria 200558
17 Ga0070658_10059798 3300005327 Bacteria 3103
18 Ga0070658_10255555 3300005327 Bacteria 1487
19 Ga0070683_100014928 3300005329 Bacteria 6809
20 Ga0068868_100034759 3300005338 Bacteria 3893
21 Ga0070660_100024631 3300005339 Bacteria 4465
22 Ga0070675_100125196 3300005354 Bacteria 2186
23 Ga0070671_100011939 3300005355 Bacteria 6988
24 Ga0070673_100144582 3300005364 Bacteria 2009
25 Ga0070659_100014736 3300005366 Bacteria 5848
26 Ga0070663_100006454 3300005455 Bacteria 7057
27 Ga0070678_100012059 3300005456 Bacteria 5357
28 Ga0070662_100406012 3300005457 Bacteria 1125
29 Ga0070681_10019794 3300005458 Bacteria 6739
30 Ga0068867_100003025 3300005459 Bacteria 11855
31 Ga0070684_100377045 3300005535 Bacteria 1306
32 Ga0068853_100071691 3300005539 Bacteria 3018
33 Ga0070672_100024198 3300005543 Bacteria 4484
34 Ga0068855_100000090 3300005563 Bacteria 110528
35 Ga0068855_100000268 3300005563 Bacteria 64693
36 Ga0068855_100016341 3300005563 Bacteria 8924
37 Ga0068857_100047445 3300005577 Bacteria 3814
38 Ga0068857_100407560 3300005577 Bacteria 1266
39 Ga0068856_100000897 3300005614 Bacteria 31872
40 Ga0068856_100002063 3300005614 Bacteria 20822
41 Ga0068856_100117436 3300005614 Bacteria 2661
42 Ga0068852_100000143 3300005616 Bacteria 48192
43 Ga0068852_100093119 3300005616 Bacteria 2700
44 Ga0075366_10001066 3300006195 Bacteria 13460
45 Ga0075366_10097670 3300006195 Bacteria 1761
46 Ga0097621_100000028 3300006237 Bacteria 71678
47 Ga0075370_10200803 3300006353 Bacteria 1176
48 Ga0068871_100000066 3300006358 Bacteria 57980
49 Ga0068865_100000127 3300006881 Bacteria 39327
50 Ga0105240_10000876 3300009093 Bacteria 54171
51 Ga0105240_10026729 3300009093 Bacteria 7569
52 Ga0105240_10588266 3300009093 Bacteria 1227
53 Ga0105245_10264156 3300009098 Bacteria 1676
54 Ga0105241_10017142 3300009174 Bacteria 5320
55 Ga0105241_10062753 3300009174 Bacteria 2865
56 Ga0105241_10368279 3300009174 Bacteria 1252
57 Ga0105242_10020443 3300009176 Bacteria 5191
58 Ga0105242_10177230 3300009176 Bacteria 1878
59 Ga0105237_10000233 3300009545 Bacteria 79346
60 Ga0105237_10000485 3300009545 Bacteria 56664
61 Ga0105237_10004544 3300009545 Bacteria 16031
62 Ga0105237_10005170 3300009545 Bacteria 14766
63 Ga0105237_10143216 3300009545 Bacteria 2385
64 Ga0105237_10308185 3300009545 Bacteria 1586
65 Ga0105238_10092755 3300009551 Bacteria 3008
66 Ga0105238_10488050 3300009551 Bacteria 1232
67 Ga0105239_10000039 3300010375 Bacteria 203537
68 Ga0105239_10000120 3300010375 Bacteria 110003
69 Ga0105239_10001068 3300010375 Bacteria 38074
70 Ga0105239_10006088 3300010375 Bacteria 14046
71 Ga0105239_10078643 3300010375 Bacteria 3630
72 Ga0105239_10317402 3300010375 Bacteria 1757
73 Ga0105239_11077377 3300010375 Bacteria 925
74 Ga0157373_10000031 3300013100 Bacteria 126446
75 Ga0157371_10000263 3300013102 Bacteria 71557
76 Ga0157371_10001069 3300013102 Bacteria 29903
77 Ga0157371_10010634 3300013102 Bacteria 7150
78 Ga0157369_10001443 3300013105 Bacteria 29190
79 Ga0157369_10095474 3300013105 Bacteria 3172
80 Ga0157369_10365431 3300013105 Bacteria 1498
81 Ga0157374_10000174 3300013296 Bacteria 59597
82 Ga0157374_10000451 3300013296 Bacteria 37378
83 Ga0157374_10583172 3300013296 Bacteria 1127
84 Ga0157378_10014313 3300013297 Bacteria 6945
85 Ga0157378_10017619 3300013297 Bacteria 6271
86 Ga0163162_10009061 3300013306 Bacteria 9675
87 Ga0163162_10014100 3300013306 Bacteria 7811
88 Ga0157372_10000050 3300013307 Bacteria 140381
89 Ga0157372_10000266 3300013307 Bacteria 57783
90 Ga0157372_10000660 3300013307 Bacteria 37899
91 Ga0157372_10006209 3300013307 Bacteria 12699
92 Ga0157372_10015188 3300013307 Bacteria 8244
93 Ga0157372_10285117 3300013307 Bacteria 1920
94 Ga0157375_10030029 3300013308 Bacteria 5119
95 Ga0157375_10276691 3300013308 Bacteria 1841
96 Ga0157376_10186203 3300014969 Bacteria 1901
97 Ga0163161_10058889 3300017792 Bacteria 2792
98 Ga0206351_10956156 3300020077 Bacteria 1249
99 Ga0206352_10156455 3300020078 Bacteria 932
100 Ga0206350_10935106 3300020080 Bacteria 1558
101 Ga0209563_106392 3300025230 Bacteria 2028
102 Ga0207427_100172 3300025231 Bacteria 71550
103 Ga0209437_100034 3300025233 Bacteria 494007
104 Ga0209026_1000219 3300025250 Bacteria 78822
105 Ga0209026_1003422 3300025250 Bacteria 5214
106 Ga0209026_1003780 3300025250 Bacteria 4800
107 Ga0209233_1000038 3300025261 Bacteria 548972
108 Ga0209233_1008430 3300025261 Bacteria 3194
109 Ga0209455_1009960 3300025272 Bacteria 2453
110 Ga0207647_10000662 3300025904 Bacteria 26925
111 Ga0207647_10180569 3300025904 Bacteria 1226
112 Ga0207645_10001390 3300025907 Bacteria 19866
113 Ga0207705_10000036 3300025909 Bacteria 200787
114 Ga0207705_10040265 3300025909 Bacteria 3351
115 Ga0207705_10223776 3300025909 Bacteria 1430
116 Ga0207654_10005732 3300025911 Bacteria 6273
117 Ga0207654_10064669 3300025911 Bacteria 2151
118 Ga0207707_10015132 3300025912 Bacteria 6715
119 Ga0207695_10000013 3300025913 Bacteria 821265
120 Ga0207695_10032015 3300025913 Bacteria 5759
121 Ga0207695_10121642 3300025913 Bacteria 2577
122 Ga0207695_10414687 3300025913 Bacteria 1231
123 Ga0207671_10000663 3300025914 Bacteria 44922
124 Ga0207671_10011406 3300025914 Bacteria 7239
125 Ga0207671_10012094 3300025914 Bacteria 6969
126 Ga0207671_10207370 3300025914 Bacteria 1532
127 Ga0207671_10408291 3300025914 Bacteria 1080
128 Ga0207657_10034762 3300025919 Bacteria 4528
129 Ga0207652_10326177 3300025921 Bacteria 1386
130 Ga0207694_10185445 3300025924 Bacteria 1689
131 Ga0207644_10013787 3300025931 Bacteria 5399
132 Ga0207690_10008888 3300025932 Bacteria 5963
133 Ga0207706_10558216 3300025933 Bacteria 985
134 Ga0207686_10306407 3300025934 Bacteria 1181
135 Ga0207704_10000044 3300025938 Bacteria 86753
136 Ga0207691_10048348 3300025940 Bacteria 3901
137 Ga0207661_10009939 3300025944 Bacteria 6834
138 Ga0207667_10000009 3300025949 Bacteria 603135
139 Ga0207667_10000971 3300025949 Bacteria 36600
140 Ga0207667_10025169 3300025949 Bacteria 6521
141 Ga0207667_10041690 3300025949 Bacteria 4881
142 Ga0207667_10281087 3300025949 Bacteria 1701
143 Ga0207651_10029023 3300025960 Bacteria 3499
144 Ga0207677_10012208 3300026023 Bacteria 4928
145 Ga0207639_10010971 3300026041 Bacteria 6280
146 Ga0207678_10006043 3300026067 Bacteria 10770
147 Ga0207702_10000797 3300026078 Bacteria 33437
148 Ga0207702_10002698 3300026078 Bacteria 16666
149 Ga0207702_10197459 3300026078 Bacteria 1863
150 Ga0207648_10000529 3300026089 Bacteria 42805
151 Ga0207674_10063810 3300026116 Bacteria 3717
152 Ga0207674_10736748 3300026116 Bacteria 951
153 Ga0207683_10006840 3300026121 Bacteria 9766
154 Ga0207698_10003256 3300026142 Bacteria 9759
155 Ga0307517_10010238 3300028786 Bacteria 13156
156 Ga0307515_10001997 3300028794 Bacteria 45190
157 Ga0307515_10002629 3300028794 Bacteria 38616
158 Ga0265338_10001821 3300028800 Bacteria 33458
159 Ga0265338_10100447 3300028800 Bacteria 2359
160 Ga0307408_100000143 3300031548 Bacteria 79423
161 Ga0307408_100015404 3300031548 Bacteria 5089
162 Ga0307408_100091136 3300031548 Bacteria 2301
163 Ga0307409_100349298 3300031995 Unclassified 1395
164 Ga0307416_100065138 3300032002 Bacteria 2993
165 Ga0307411_10030778 3300032005 Bacteria 3294
166 Ga0307507_10000015 3300033179 Bacteria 237419
167 Ga0307510_10011192 3300033180 Bacteria 10666
168 Ga0373941_0013874 3300035115 Bacteria 2140
169 Ga0395899_0000002 3300037312 Bacteria 1324310
170 Ga0395899_0000640 3300037312 Bacteria 36134
171 Ga0395899_0034511 3300037312 Bacteria 3800
172 Ga0395900_0001234 3300037418 Bacteria 31453
173 Ga0395900_0006335 3300037418 Bacteria 12338
174 Ga0395900_0790117 3300037418 Bacteria 878
175 Ga0395905_0003090 3300037471 Bacteria 17997
176 Ga0395905_0799793 3300037471 Unclassified 846
177 Ga0395901_0004520 3300038443 Bacteria 14030
178 Ga0395901_0196139 3300038443 Bacteria 2117
179 Ga0439455_0024804 3300042012 Bacteria 1453
180 Ga0451577_0000010 3300042876 Bacteria 616686
181 Ga0451577_0049276 3300042876 Unclassified 3761
182 Ga0451577_0051010 3300042876 Bacteria 3693
183 Ga0451577_0240041 3300042876 Bacteria 1640
184 Ga0453683_0000111 3300044673 Bacteria 122663
185 Ga0453683_0003788 3300044673 Bacteria 11017
186 Ga0453683_0199487 3300044673 Bacteria 1270
187 Ga0453683_0403381 3300044673 Bacteria 881
188 Ga0466961_0154216 3300044693 Bacteria 1433
189 Ga0453684_0000130 3300044712 Bacteria 331761
190 Ga0453684_0002144 3300044712 Bacteria 49481
191 Ga0453684_0159147 3300044712 Unclassified 2673
192 Ga0453684_1098588 3300044712 Unclassified 840
193 Ga0451576_0000670 3300045051 Bacteria 70399
194 Ga0451576_0042360 3300045051 Bacteria 4807
195 Ga0451576_0133450 3300045051 Bacteria 2588
196 Ga0451576_0139691 3300045051 Unclassified 2527
197 Ga0451576_0306075 3300045051 Bacteria 1663
198 Ga0451576_0361016 3300045051 Bacteria 1521
199 Ga0466958_0037027 3300045836 Bacteria 2922
200 Ga0495638_0113534 3300046460 Bacteria 1607
201 Ga0495651_0050806 3300046462 Bacteria 3198
202 Ga0495650_0000087 3300046471 Bacteria 234870
203 Ga0495650_0029898 3300046471 Bacteria 2476
204 Ga0495585_0000286 3300046492 Bacteria 50524
205 Ga0495607_0103178 3300046501 Bacteria 1524
206 Ga0495606_0000052 3300046507 Bacteria 201529
207 Ga0495606_0026825 3300046507 Bacteria 4097
208 Ga0495606_0036546 3300046507 Bacteria 3344
209 Ga0495610_0009503 3300046512 Bacteria 6138
210 Ga0495616_0011404 3300046513 Bacteria 5091
211 Ga0495631_0010350 3300046518 Bacteria 4616
212 Ga0495631_0060149 3300046518 Bacteria 1649
213 Ga0495637_0021664 3300046520 Bacteria 2944
214 Ga0495644_0013350 3300046523 Bacteria 3152
215 Ga0495648_0001785 3300046524 Bacteria 20692
216 Ga0495652_0324062 3300046529 Bacteria 1112
217 Ga0495609_0006171 3300046538 Bacteria 6162
218 Ga0495622_0188165 3300046557 Bacteria 924
219 Ga0495633_0000035 3300046558 Bacteria 185403
220 Ga0495633_0003276 3300046558 Bacteria 10897
221 Ga0495668_0000032 3300046616 Bacteria 254951
222 Ga0495625_0000008 3300046660 Bacteria 536165
223 Ga0495625_0000753 3300046660 Bacteria 45225
224 Ga0495625_0001038 3300046660 Bacteria 36510
225 Ga0495625_0082824 3300046660 Bacteria 2230
226 Ga0495625_0172526 3300046660 Bacteria 1443
227 Ga0495625_0285619 3300046660 Bacteria 1060
228 Ga0495661_0009214 3300046665 Bacteria 6782
229 Ga0495661_0021105 3300046665 Bacteria 4249
230 Ga0495671_0125292 3300046692 Bacteria 1253
231 Ga0495649_0000018 3300046694 Bacteria 220586
232 Ga0495683_0112410 3300047323 Bacteria 1299
233 Ga0495687_004055 3300047443 Bacteria 10153
234 Ga0495679_046375 3300047446 Bacteria 1323
235 Ga0495686_0006391 3300047472 Bacteria 9035
236 Ga0495686_0206287 3300047472 Bacteria 1125
237 Ga0495614_0114704 3300048089 Bacteria 1184
238 nmdc:mga0k408_1225_c1 3300050493 Bacteria 14065
239 nmdc:mga0k408_3989_c1 3300050493 Bacteria 7825
240 nmdc:mga07m45_232030_c1 3300050496 Bacteria 1074
241 Ga0500608_000203 3300053122 Bacteria 23751
242 Ga0500618_000037 3300053125 Bacteria 117320
243 Ga0500618_043626 3300053125 Bacteria 1025
244 Ga0500642_0028794 3300053130 Bacteria 2295
245 Ga0500622_0003444 3300053156 Bacteria 10568
246 Ga0500624_000572 3300053157 Bacteria 10163
247 Ga0500634_0041116 3300053161 Bacteria 2511

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0051010 Ga0451577_0051010_2495_3106 171
2 3300044712 Ga0453684_0002144 Ga0453684_0002144_6552_7163 171
3 3300045051 Ga0451576_0042360 Ga0451576_0042360_2573_3184 171
4 3300053161 Ga0500634_0041116 Ga0500634_0041116_39_659 173
5 3300037418 Ga0395900_0001234 Ga0395900_0001234_19581_20324 177
6 3300037418 Ga0395900_0790117 Ga0395900_0790117_57_710 177
7 3300028786 Ga0307517_10010238 Ga0307517_100102382 184
8 3300033180 Ga0307510_10011192 Ga0307510_100111926 184
9 3300003316 rootH1_10172976 rootH1_101729762 186
10 3300005327 Ga0070658_10000018 Ga0070658_10000018102 187
11 3300005563 Ga0068855_100016341 Ga0068855_1000163413 187
12 3300010375 Ga0105239_10317402 Ga0105239_103174022 187
13 3300025909 Ga0207705_10000036 Ga0207705_1000003693 187
14 3300025949 Ga0207667_10041690 Ga0207667_100416905 187
15 3300042012 Ga0439455_0024804 Ga0439455_0024804_615_1337 189
16 3300005355 Ga0070671_100011939 Ga0070671_1000119392 190
17 3300025931 Ga0207644_10013787 Ga0207644_100137872 190
18 3300005457 Ga0070662_100406012 Ga0070662_1004060122 191
19 3300009098 Ga0105245_10264156 Ga0105245_102641564 191
20 3300013307 Ga0157372_10285117 Ga0157372_102851172 191
21 3300013308 Ga0157375_10276691 Ga0157375_102766911 191
22 3300025933 Ga0207706_10558216 Ga0207706_105582161 191
23 3300005338 Ga0068868_100034759 Ga0068868_1000347593 192
24 3300005354 Ga0070675_100125196 Ga0070675_1001251962 192
25 3300005364 Ga0070673_100144582 Ga0070673_1001445823 192
26 3300005456 Ga0070678_100012059 Ga0070678_1000120594 192
27 3300005459 Ga0068867_100003025 Ga0068867_1000030259 192
28 3300005543 Ga0070672_100024198 Ga0070672_1000241985 192
29 3300005616 Ga0068852_100000143 Ga0068852_1000001435 192
30 3300006237 Ga0097621_100000028 Ga0097621_10000002822 192
31 3300006358 Ga0068871_100000066 Ga0068871_10000006619 192
32 3300006881 Ga0068865_100000127 Ga0068865_10000012737 192
33 3300009176 Ga0105242_10020443 Ga0105242_100204432 192
34 3300009545 Ga0105237_10005170 Ga0105237_1000517010 192
35 3300009551 Ga0105238_10092755 Ga0105238_100927552 192
36 3300010375 Ga0105239_11077377 Ga0105239_110773771 192
37 3300013296 Ga0157374_10000174 Ga0157374_1000017466 192
38 3300013297 Ga0157378_10014313 Ga0157378_100143135 192
39 3300014969 Ga0157376_10186203 Ga0157376_101862032 192
40 3300025907 Ga0207645_10001390 Ga0207645_1000139018 192
41 3300025924 Ga0207694_10185445 Ga0207694_101854452 192
42 3300025934 Ga0207686_10306407 Ga0207686_103064072 192
43 3300025938 Ga0207704_10000044 Ga0207704_1000004453 192
44 3300025940 Ga0207691_10048348 Ga0207691_100483482 192
45 3300025960 Ga0207651_10029023 Ga0207651_100290231 192
46 3300026023 Ga0207677_10012208 Ga0207677_100122085 192
47 3300026041 Ga0207639_10010971 Ga0207639_100109717 192
48 3300026089 Ga0207648_10000529 Ga0207648_1000052920 192
49 3300026121 Ga0207683_10006840 Ga0207683_100068405 192
50 3300026142 Ga0207698_10003256 Ga0207698_100032569 192
51 3300046518 Ga0495631_0010350 Ga0495631_0010350_399_1121 192
52 3300046660 Ga0495625_0285619 Ga0495625_0285619_312_1034 192
53 3300028800 Ga0265338_10001821 Ga0265338_1000182127 193
54 3300005339 Ga0070660_100024631 Ga0070660_1000246312 194
55 3300005539 Ga0068853_100071691 Ga0068853_1000716915 194
56 3300013307 Ga0157372_10006209 Ga0157372_100062094 194
57 3300025919 Ga0207657_10034762 Ga0207657_100347622 194
58 3300053157 Ga0500624_000572 Ga0500624_000572_6071_6802 194
59 3300003323 rootH1_10112320 rootH1_101123203 195
60 3300003323 rootH1_10288858 rootH1_102888582 195
61 3300009093 Ga0105240_10000876 Ga0105240_1000087661 195
62 3300009174 Ga0105241_10017142 Ga0105241_100171422 195
63 3300009545 Ga0105237_10000233 Ga0105237_100002333 195
64 3300010375 Ga0105239_10001068 Ga0105239_1000106824 195
65 3300025911 Ga0207654_10005732 Ga0207654_100057322 195
66 3300025913 Ga0207695_10000013 Ga0207695_10000013264 195
67 3300025914 Ga0207671_10000663 Ga0207671_100006633 195
68 3300053156 Ga0500622_0003444 Ga0500622_0003444_1983_2666 195
69 3300005563 Ga0068855_100000090 Ga0068855_10000009072 197
70 3300005614 Ga0068856_100117436 Ga0068856_1001174364 197
71 3300025949 Ga0207667_10000009 Ga0207667_10000009368 197
72 3300026078 Ga0207702_10197459 Ga0207702_101974592 197
73 3300042876 Ga0451577_0240041 Ga0451577_0240041_115_798 197
74 3300045051 Ga0451576_0139691 Ga0451576_0139691_493_1185 197
75 3300025913 Ga0207695_10121642 Ga0207695_101216422 201
76 3300028800 Ga0265338_10100447 Ga0265338_101004474 201
77 3300044693 Ga0466961_0154216 Ga0466961_0154216_797_1411 201
78 3300053122 Ga0500608_000203 Ga0500608_000203_4330_5052 201
79 3300009174 Ga0105241_10368279 Ga0105241_103682791 202
80 3300017792 Ga0163161_10058889 Ga0163161_100588892 202
81 3300025949 Ga0207667_10281087 Ga0207667_102810871 202
82 3300046501 Ga0495607_0103178 Ga0495607_0103178_197_919 202
83 3300046507 Ga0495606_0026825 Ga0495606_0026825_45_791 202
84 3300010375 Ga0105239_10000120 Ga0105239_1000012086 203
85 3300031548 Ga0307408_100015404 Ga0307408_1000154042 203
86 3300031548 Ga0307408_100091136 Ga0307408_1000911363 203
87 3300031995 Ga0307409_100349298 Ga0307409_1003492981 203
88 3300002067 JGI24735J21928_10009496 JGI24735J21928_100094962 204
89 3300005366 Ga0070659_100014736 Ga0070659_1000147364 204
90 3300005577 Ga0068857_100047445 Ga0068857_1000474455 204
91 3300006195 Ga0075366_10001066 Ga0075366_100010662 204
92 3300013102 Ga0157371_10000263 Ga0157371_100002635 204
93 3300013105 Ga0157369_10095474 Ga0157369_100954742 204
94 3300013307 Ga0157372_10000266 Ga0157372_1000026638 204
95 3300025261 Ga0209233_1008430 Ga0209233_10084303 204
96 3300025904 Ga0207647_10000662 Ga0207647_1000066221 204
97 3300025932 Ga0207690_10008888 Ga0207690_100088884 204
98 3300026116 Ga0207674_10063810 Ga0207674_100638105 204
99 3300038443 Ga0395901_0196139 Ga0395901_0196139_33_773 204
100 3300050493 nmdc:mga0k408_1225_c1 nmdc:mga0k408_1225_c1_11409_12131 204
101 3300009176 Ga0105242_10177230 Ga0105242_101772302 205
102 3300031548 Ga0307408_100000143 Ga0307408_10000014365 205
103 3300032005 Ga0307411_10030778 Ga0307411_100307785 205
104 3300035115 Ga0373941_0013874 Ga0373941_0013874_1154_1894 205
105 iso_pu_bacteria 2852623160 2852626906 205
106 iso_pu_bacteria 2884933994 2884938042 205
107 iso_pu_bacteria 2919437846 2919439007 205
108 iso_pu_bacteria 2928078545 2928080626 205
109 iso_pu_bacteria 2928147474 2928150851 205
110 iso_pu_bacteria 2932082852 2932082989 205
111 3300025949 Ga0207667_10025169 Ga0207667_100251696 206
112 3300032002 Ga0307416_100065138 Ga0307416_1000651382 206
113 3300044673 Ga0453683_0003788 Ga0453683_0003788_587_1321 206
114 3300044712 Ga0453684_1098588 Ga0453684_1098588_12_746 206
115 3300045051 Ga0451576_0133450 Ga0451576_0133450_87_821 206
116 3300045051 Ga0451576_0361016 Ga0451576_0361016_87_821 206
117 3300047472 Ga0495686_0006391 Ga0495686_0006391_3919_4641 206
118 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004115 207
119 3300003316 rootH1_10008508 rootH1_100085082 207
120 3300003322 rootL2_10162043 rootL2_101620432 207
121 3300003323 rootH1_10174632 rootH1_101746321 207
122 3300005329 Ga0070683_100014928 Ga0070683_1000149288 207
123 3300005535 Ga0070684_100377045 Ga0070684_1003770452 207
124 3300005577 Ga0068857_100407560 Ga0068857_1004075602 207
125 3300005614 Ga0068856_100002063 Ga0068856_10000206321 207
126 3300006195 Ga0075366_10097670 Ga0075366_100976703 207
127 3300006353 Ga0075370_10200803 Ga0075370_102008032 207
128 3300013100 Ga0157373_10000031 Ga0157373_1000003115 207
129 3300013102 Ga0157371_10010634 Ga0157371_100106347 207
130 3300013105 Ga0157369_10365431 Ga0157369_103654312 207
131 3300013297 Ga0157378_10017619 Ga0157378_100176195 207
132 3300013306 Ga0163162_10014100 Ga0163162_100141002 207
133 3300013307 Ga0157372_10000660 Ga0157372_1000066017 207
134 3300013307 Ga0157372_10015188 Ga0157372_100151884 207
135 3300013308 Ga0157375_10030029 Ga0157375_100300296 207
136 3300020077 Ga0206351_10956156 Ga0206351_109561561 207
137 3300020078 Ga0206352_10156455 Ga0206352_101564552 207
138 3300020080 Ga0206350_10935106 Ga0206350_109351062 207
139 3300025904 Ga0207647_10180569 Ga0207647_101805692 207
140 3300025944 Ga0207661_10009939 Ga0207661_100099392 207
141 3300026078 Ga0207702_10002698 Ga0207702_1000269816 207
142 3300026116 Ga0207674_10736748 Ga0207674_107367481 207
143 3300037312 Ga0395899_0034511 Ga0395899_0034511_1764_2495 207
144 3300037418 Ga0395900_0006335 Ga0395900_0006335_7254_7985 207
145 3300037471 Ga0395905_0003090 Ga0395905_0003090_1036_1767 207
146 3300038443 Ga0395901_0004520 Ga0395901_0004520_5540_6271 207
147 3300042876 Ga0451577_0000010 Ga0451577_0000010_279983_280720 207
148 3300042876 Ga0451577_0049276 Ga0451577_0049276_279_1016 207
149 3300044673 Ga0453683_0000111 Ga0453683_0000111_38894_39631 207
150 3300044673 Ga0453683_0199487 Ga0453683_0199487_116_853 207
151 3300044673 Ga0453683_0403381 Ga0453683_0403381_17_754 207
152 3300044712 Ga0453684_0000130 Ga0453684_0000130_68300_69037 207
153 3300044712 Ga0453684_0159147 Ga0453684_0159147_1305_2042 207
154 3300045051 Ga0451576_0000670 Ga0451576_0000670_60332_61069 207
155 3300045051 Ga0451576_0306075 Ga0451576_0306075_660_1397 207
156 3300046460 Ga0495638_0113534 Ga0495638_0113534_335_1057 207
157 3300046471 Ga0495650_0000087 Ga0495650_0000087_33468_34190 207
158 3300046492 Ga0495585_0000286 Ga0495585_0000286_22001_22723 207
159 3300046507 Ga0495606_0000052 Ga0495606_0000052_160886_161608 207
160 3300046512 Ga0495610_0009503 Ga0495610_0009503_23_745 207
161 3300046513 Ga0495616_0011404 Ga0495616_0011404_2124_2846 207
162 3300046520 Ga0495637_0021664 Ga0495637_0021664_1729_2451 207
163 3300046529 Ga0495652_0324062 Ga0495652_0324062_11_760 207
164 3300046538 Ga0495609_0006171 Ga0495609_0006171_2497_3219 207
165 3300046557 Ga0495622_0188165 Ga0495622_0188165_56_778 207
166 3300046558 Ga0495633_0003276 Ga0495633_0003276_812_1534 207
167 3300046660 Ga0495625_0000008 Ga0495625_0000008_525756_526478 207
168 3300046660 Ga0495625_0082824 Ga0495625_0082824_132_854 207
169 3300046660 Ga0495625_0172526 Ga0495625_0172526_101_823 207
170 3300046665 Ga0495661_0021105 Ga0495661_0021105_37_759 207
171 3300046692 Ga0495671_0125292 Ga0495671_0125292_206_928 207
172 3300046694 Ga0495649_0000018 Ga0495649_0000018_9688_10410 207
173 3300047323 Ga0495683_0112410 Ga0495683_0112410_237_959 207
174 3300047443 Ga0495687_004055 Ga0495687_004055_6284_7006 207
175 3300047446 Ga0495679_046375 Ga0495679_046375_503_1225 207
176 3300047472 Ga0495686_0206287 Ga0495686_0206287_172_894 207
177 3300050496 nmdc:mga07m45_232030_c1 nmdc:mga07m45_232030_c1_244_966 207
178 3300053125 Ga0500618_000037 Ga0500618_000037_21840_22589 207
179 3300053125 Ga0500618_043626 Ga0500618_043626_209_931 207
180 3300003320 rootH2_10110926 rootH2_101109262 208
181 3300005614 Ga0068856_100000897 Ga0068856_10000089715 208
182 3300025921 Ga0207652_10326177 Ga0207652_103261772 208
183 3300026078 Ga0207702_10000797 Ga0207702_1000079731 208
184 3300037312 Ga0395899_0000002 Ga0395899_0000002_1016458_1017192 208
185 3300003320 rootH2_10302283 rootH2_103022831 209
186 3300005616 Ga0068852_100093119 Ga0068852_1000931192 209
187 3300009093 Ga0105240_10588266 Ga0105240_105882663 209
188 3300009545 Ga0105237_10004544 Ga0105237_100045447 209
189 3300009545 Ga0105237_10143216 Ga0105237_101432162 209
190 3300010375 Ga0105239_10078643 Ga0105239_100786435 209
191 3300013296 Ga0157374_10000451 Ga0157374_1000045142 209
192 3300013296 Ga0157374_10583172 Ga0157374_105831722 209
193 3300013306 Ga0163162_10009061 Ga0163162_100090614 209
194 3300025250 Ga0209026_1000219 Ga0209026_100021961 209
195 3300025250 Ga0209026_1003422 Ga0209026_10034227 209
196 3300025250 Ga0209026_1003780 Ga0209026_10037803 209
197 3300025913 Ga0207695_10414687 Ga0207695_104146872 209
198 3300025914 Ga0207671_10012094 Ga0207671_100120947 209
199 3300025914 Ga0207671_10408291 Ga0207671_104082911 209
200 3300028794 Ga0307515_10001997 Ga0307515_1000199726 209
201 3300028794 Ga0307515_10002629 Ga0307515_1000262940 209
202 3300033179 Ga0307507_10000015 Ga0307507_1000001551 209
203 3300037471 Ga0395905_0799793 Ga0395905_0799793_76_825 209
204 3300046471 Ga0495650_0029898 Ga0495650_0029898_60_782 209
205 3300046518 Ga0495631_0060149 Ga0495631_0060149_474_1196 209
206 3300046523 Ga0495644_0013350 Ga0495644_0013350_249_971 209
207 3300046524 Ga0495648_0001785 Ga0495648_0001785_16792_17514 209
208 3300046558 Ga0495633_0000035 Ga0495633_0000035_137530_138252 209
209 3300046616 Ga0495668_0000032 Ga0495668_0000032_59106_59828 209
210 3300046660 Ga0495625_0000753 Ga0495625_0000753_13253_13993 209
211 3300046660 Ga0495625_0001038 Ga0495625_0001038_20275_20997 209
212 3300046665 Ga0495661_0009214 Ga0495661_0009214_10_732 209
213 3300048089 Ga0495614_0114704 Ga0495614_0114704_214_936 209
214 3300050493 nmdc:mga0k408_3989_c1 nmdc:mga0k408_3989_c1_604_1344 209
215 3300053130 Ga0500642_0028794 Ga0500642_0028794_224_946 209
216 3300001915 JGI24741J21665_1009512 JGI24741J21665_10095124 210
217 3300001979 JGI24740J21852_10005301 JGI24740J21852_100053016 210
218 3300002737 JGI25162J39368_1002026 JGI25162J39368_10020265 210
219 3300003214 JGI25165J46597_1002705 JGI25165J46597_10027056 210
220 3300003323 rootH1_10018482 rootH1_1001848256 210
221 3300005327 Ga0070658_10059798 Ga0070658_100597982 210
222 3300005327 Ga0070658_10255555 Ga0070658_102555552 210
223 3300005455 Ga0070663_100006454 Ga0070663_1000064545 210
224 3300005458 Ga0070681_10019794 Ga0070681_100197945 210
225 3300005563 Ga0068855_100000268 Ga0068855_10000026828 210
226 3300009093 Ga0105240_10026729 Ga0105240_100267295 210
227 3300009174 Ga0105241_10062753 Ga0105241_100627532 210
228 3300009545 Ga0105237_10000485 Ga0105237_1000048523 210
229 3300009545 Ga0105237_10308185 Ga0105237_103081852 210
230 3300009551 Ga0105238_10488050 Ga0105238_104880502 210
231 3300010375 Ga0105239_10000039 Ga0105239_10000039137 210
232 3300010375 Ga0105239_10006088 Ga0105239_100060887 210
233 3300013102 Ga0157371_10001069 Ga0157371_100010692 210
234 3300013105 Ga0157369_10001443 Ga0157369_1000144318 210
235 3300013307 Ga0157372_10000050 Ga0157372_1000005098 210
236 3300025230 Ga0209563_106392 Ga0209563_1063923 210
237 3300025231 Ga0207427_100172 Ga0207427_10017261 210
238 3300025233 Ga0209437_100034 Ga0209437_100034166 210
239 3300025261 Ga0209233_1000038 Ga0209233_1000038166 210
240 3300025272 Ga0209455_1009960 Ga0209455_10099602 210
241 3300025909 Ga0207705_10040265 Ga0207705_100402652 210
242 3300025909 Ga0207705_10223776 Ga0207705_102237762 210
243 3300025911 Ga0207654_10064669 Ga0207654_100646692 210
244 3300025912 Ga0207707_10015132 Ga0207707_100151322 210
245 3300025913 Ga0207695_10032015 Ga0207695_100320152 210
246 3300025914 Ga0207671_10011406 Ga0207671_100114065 210
247 3300025914 Ga0207671_10207370 Ga0207671_102073702 210
248 3300025949 Ga0207667_10000971 Ga0207667_1000097114 210
249 3300026067 Ga0207678_10006043 Ga0207678_1000604310 210
250 3300037312 Ga0395899_0000640 Ga0395899_0000640_27524_28234 210
251 3300045836 Ga0466958_0037027 Ga0466958_0037027_144_854 210
252 3300046462 Ga0495651_0050806 Ga0495651_0050806_1997_2740 210
253 3300046507 Ga0495606_0036546 Ga0495606_0036546_1086_1799 210
254 iso_pu_bacteria 2977232053 2977236252 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

7

177

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7742 4 204
6wmv-assembly1.cif.gz_C structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.7199 10 177
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.7186 10 179
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.7177 10 179
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7038 10 177
ID Description Score Start End Superfamily
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8708 1 180 1.20.120.1760
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.832 2 180 1.20.120.1760
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8281 6 184 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.803 8 179 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8001 4 205 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A258LCG4-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9551 6 189 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A2E9G8U8-F1-model_v4 deleted 0.9484 5 192
AF-A0A349Q2J5-F1-model_v4 Phosphatidylserine synthase 0.9473 4 141 GO:0008654
GO:0016020
GO:0016780
AF-A0A497CZS9-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9444 6 122 GO:0008654
GO:0016020
GO:0016780
AF-A0A258LCG4-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9401 6 189 GO:0003882
GO:0008654
GO:0012505
GO:0016020

Feature Viewer

pLDDT pTM Quality
80.38 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map