F364682

General Info

Members Datasets Scaffolds Average Seq Length
254 133 254 196

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100148874|Ga0070700_1001488742
Length 210
Sequence MRLPGKRLRLFSFNLISMAVYDKFAQRYDSAFAPLERLGLSQSRQEALSLLPVDARILELGCGTGANFEFYPTSRFAISTEFSIEMIKAARSKATSNILVNADAQFLPFGESEFDAAFATLVFCSIPDPVLAFNEIKRVVKPGGKVVLLEHVRPNGALGYIFDALSICTRSLFEDHFNRRTAEIAASSGIRNIEVKSKLFGIVNLIIGTV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0.39
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6353584 2162886012 Unclassified 1013
2 rootL2_10161719 3300003322 Bacteria 1436
3 Ga0065704_10139353 3300005289 Bacteria 1527
4 Ga0065704_10205968 3300005289 Unclassified 1127
5 Ga0065712_10144013 3300005290 Bacteria 1370
6 Ga0065715_10021350 3300005293 Bacteria 2080
7 Ga0065715_10341763 3300005293 Bacteria 966
8 Ga0065707_10004910 3300005295 Bacteria 5576
9 Ga0065707_10016231 3300005295 Bacteria 1850
10 Ga0070676_10021902 3300005328 Bacteria 3580
11 Ga0070676_10093719 3300005328 Bacteria 1844
12 Ga0070676_10318323 3300005328 Bacteria 1060
13 Ga0070690_100182297 3300005330 Unclassified 1451
14 Ga0070670_100014074 3300005331 Bacteria 6864
15 Ga0070677_10421501 3300005333 Bacteria 708
16 Ga0068869_100019758 3300005334 Bacteria 4610
17 Ga0068869_100061637 3300005334 Bacteria 2752
18 Ga0068869_100162259 3300005334 Bacteria 1740
19 Ga0068869_100320370 3300005334 Unclassified 1257
20 Ga0070680_100110262 3300005336 Bacteria 2291
21 Ga0070682_100000076 3300005337 Bacteria 90097
22 Ga0068868_100033567 3300005338 Bacteria 3956
23 Ga0070689_100047453 3300005340 Bacteria 3312
24 Ga0070689_100153887 3300005340 Bacteria 1856
25 Ga0070689_100319129 3300005340 Bacteria 1297
26 Ga0070691_10106947 3300005341 Unclassified 1395
27 Ga0070687_100004254 3300005343 Bacteria 5690
28 Ga0070687_100215441 3300005343 Unclassified 1173
29 Ga0070661_100688368 3300005344 Unclassified 832
30 Ga0070669_100000653 3300005353 Bacteria 25664
31 Ga0070669_100231862 3300005353 Bacteria 1464
32 Ga0070675_100107418 3300005354 Unclassified 2357
33 Ga0070675_100187798 3300005354 Bacteria 1789
34 Ga0070675_100245584 3300005354 Unclassified 1565
35 Ga0070675_101249597 3300005354 Unclassified 684
36 Ga0070674_100084025 3300005356 Bacteria 2282
37 Ga0070673_100070496 3300005364 Bacteria 2805
38 Ga0070673_100106788 3300005364 Unclassified 2315
39 Ga0070701_10041704 3300005438 Bacteria 2340
40 Ga0070701_10109609 3300005438 Bacteria 1540
41 Ga0070701_10515122 3300005438 Bacteria 779
42 Ga0070705_100040720 3300005440 Bacteria 2644
43 Ga0070700_100148874 3300005441 Bacteria 1599
44 Ga0070700_100262684 3300005441 Unclassified 1244
45 Ga0070700_100542192 3300005441 Unclassified 902
46 Ga0070694_100453275 3300005444 Bacteria 1013
47 Ga0070678_100058608 3300005456 Bacteria 2827
48 Ga0070678_100193669 3300005456 Bacteria 1673
49 Ga0070678_100693890 3300005456 Unclassified 917
50 Ga0070662_100062884 3300005457 Bacteria 2713
51 Ga0070662_100095106 3300005457 Bacteria 2245
52 Ga0070662_100843530 3300005457 Unclassified 780
53 Ga0068867_100688924 3300005459 Unclassified 901
54 Ga0070698_100002172 3300005471 Bacteria 21757
55 Ga0070697_100169224 3300005536 Bacteria 1849
56 Ga0070697_100517125 3300005536 Unclassified 1045
57 Ga0070686_100002652 3300005544 Bacteria 9859
58 Ga0070695_100290267 3300005545 Bacteria 1205
59 Ga0070696_100260983 3300005546 Bacteria 1314
60 Ga0070693_100383891 3300005547 Bacteria 970
61 Ga0070704_100105881 3300005549 Bacteria 2130
62 Ga0070704_100123165 3300005549 Bacteria 1996
63 Ga0070704_100264955 3300005549 Bacteria 1417
64 Ga0070664_100702533 3300005564 Bacteria 942
65 Ga0068857_100587205 3300005577 Bacteria 1052
66 Ga0070702_100262537 3300005615 Unclassified 1176
67 Ga0070702_100288499 3300005615 Unclassified 1130
68 Ga0068859_100009613 3300005617 Bacteria 9764
69 Ga0068859_100038062 3300005617 Unclassified 4827
70 Ga0068859_100145193 3300005617 Bacteria 2447
71 Ga0068859_100391753 3300005617 Unclassified 1485
72 Ga0068864_100015663 3300005618 Bacteria 6307
73 Ga0068864_100283904 3300005618 Bacteria 1546
74 Ga0068864_100575360 3300005618 Unclassified 1091
75 Ga0068864_100801797 3300005618 Bacteria 925
76 Ga0068864_100859088 3300005618 Unclassified 894
77 Ga0068866_10006321 3300005718 Bacteria 4929
78 Ga0068866_10340182 3300005718 Bacteria 950
79 Ga0068861_100288726 3300005719 Bacteria 1415
80 Ga0068861_100392472 3300005719 Unclassified 1229
81 Ga0068861_100468504 3300005719 Bacteria 1132
82 Ga0068870_10098998 3300005840 Unclassified 1644
83 Ga0068870_10326815 3300005840 Unclassified 976
84 Ga0068870_10422220 3300005840 Bacteria 873
85 Ga0068863_100300335 3300005841 Unclassified 1557
86 Ga0068863_100361983 3300005841 Bacteria 1414
87 Ga0068858_100836827 3300005842 Unclassified 898
88 Ga0068860_100107392 3300005843 Bacteria 2667
89 Ga0068860_100223893 3300005843 Bacteria 1827
90 Ga0068862_101220451 3300005844 Unclassified 751
91 Ga0097621_100179496 3300006237 Bacteria 1829
92 Ga0097621_100700521 3300006237 Bacteria 932
93 Ga0068871_100102557 3300006358 Bacteria 2398
94 Ga0075430_100056687 3300006846 Bacteria 3295
95 Ga0075434_101011184 3300006871 Unclassified 845
96 Ga0097620_100009613 3300006931 Bacteria 9764
97 Ga0097620_100038060 3300006931 Unclassified 4827
98 Ga0097620_100145189 3300006931 Bacteria 2447
99 Ga0097620_100391787 3300006931 Unclassified 1485
100 Ga0075435_100562066 3300007076 Unclassified 988
101 Ga0105250_10246506 3300009092 Unclassified 763
102 Ga0111539_10129054 3300009094 Bacteria 2961
103 Ga0111539_10157973 3300009094 Bacteria 2653
104 Ga0111539_10475071 3300009094 Bacteria 1456
105 Ga0111539_11297549 3300009094 Unclassified 845
106 Ga0105245_10011035 3300009098 Bacteria 7865
107 Ga0114129_10042525 3300009147 Bacteria 6398
108 Ga0114129_10126690 3300009147 Bacteria 3510
109 Ga0114129_10393482 3300009147 Bacteria 1827
110 Ga0114129_10508095 3300009147 Unclassified 1573
111 Ga0114129_10544910 3300009147 Unclassified 1509
112 Ga0114129_10647227 3300009147 Unclassified 1365
113 Ga0114129_10679240 3300009147 Bacteria 1326
114 Ga0105243_10074892 3300009148 Bacteria 2746
115 Ga0105243_11016660 3300009148 Bacteria 832
116 Ga0105241_10561516 3300009174 Bacteria 1026
117 Ga0105241_10641416 3300009174 Bacteria 964
118 Ga0105242_10053462 3300009176 Bacteria 3298
119 Ga0105248_10958370 3300009177 Unclassified 966
120 Ga0105249_10044881 3300009553 Bacteria 4019
121 Ga0105249_10062683 3300009553 Bacteria 3414
122 Ga0105249_10132401 3300009553 Bacteria 2382
123 Ga0105239_10359678 3300010375 Unclassified 1644
124 Ga0105246_10658395 3300011119 Unclassified 913
125 Ga0157378_10001282 3300013297 Bacteria 22599
126 Ga0157378_10014402 3300013297 Bacteria 6923
127 Ga0157378_10826106 3300013297 Unclassified 954
128 Ga0163162_10011606 3300013306 Bacteria 8591
129 Ga0163162_10743980 3300013306 Unclassified 1100
130 Ga0163162_10951804 3300013306 Bacteria 970
131 Ga0157372_10380160 3300013307 Bacteria 1645
132 Ga0157375_10004418 3300013308 Bacteria 12206
133 Ga0157375_10160549 3300013308 Bacteria 2389
134 Ga0157375_10184122 3300013308 Bacteria 2241
135 Ga0157375_10732693 3300013308 Unclassified 1141
136 Ga0163163_10001831 3300014325 Bacteria 17942
137 Ga0163163_10137655 3300014325 Bacteria 2483
138 Ga0163163_10192357 3300014325 Bacteria 2088
139 Ga0163163_10326924 3300014325 Bacteria 1587
140 Ga0157380_10001205 3300014326 Bacteria 16752
141 Ga0157380_10011031 3300014326 Bacteria 6517
142 Ga0157380_10036321 3300014326 Bacteria 3811
143 Ga0157380_10080244 3300014326 Bacteria 2667
144 Ga0157377_10290943 3300014745 Bacteria 1074
145 Ga0163161_10148374 3300017792 Bacteria 1781
146 Ga0207697_10050116 3300025315 Bacteria 1724
147 Ga0207680_10128216 3300025903 Unclassified 1669
148 Ga0207645_10012783 3300025907 Bacteria 5687
149 Ga0207645_10075504 3300025907 Bacteria 2157
150 Ga0207643_10132693 3300025908 Bacteria 1483
151 Ga0207684_10049887 3300025910 Bacteria 3550
152 Ga0207662_10020084 3300025918 Bacteria 3810
153 Ga0207662_10022094 3300025918 Bacteria 3642
154 Ga0207681_10000828 3300025923 Bacteria 20413
155 Ga0207681_10223154 3300025923 Unclassified 1459
156 Ga0207650_10125800 3300025925 Bacteria 2001
157 Ga0207650_10133632 3300025925 Bacteria 1944
158 Ga0207659_10140660 3300025926 Bacteria 1873
159 Ga0207659_10471045 3300025926 Unclassified 1060
160 Ga0207659_10716088 3300025926 Unclassified 857
161 Ga0207659_10810019 3300025926 Bacteria 805
162 Ga0207687_10100612 3300025927 Bacteria 2127
163 Ga0207706_10223740 3300025933 Bacteria 1647
164 Ga0207686_10335293 3300025934 Bacteria 1134
165 Ga0207670_10429738 3300025936 Bacteria 1061
166 Ga0207669_10280197 3300025937 Bacteria 1257
167 Ga0207691_10017302 3300025940 Bacteria 6837
168 Ga0207691_10167693 3300025940 Bacteria 1924
169 Ga0207691_10401794 3300025940 Bacteria 1169
170 Ga0207711_10171018 3300025941 Bacteria 1971
171 Ga0207689_10010246 3300025942 Bacteria 8075
172 Ga0207689_10033384 3300025942 Bacteria 4276
173 Ga0207689_10038011 3300025942 Bacteria 3988
174 Ga0207689_10137365 3300025942 Bacteria 2013
175 Ga0207679_10267427 3300025945 Unclassified 1461
176 Ga0207679_10423190 3300025945 Bacteria 1176
177 Ga0207679_10673458 3300025945 Bacteria 937
178 Ga0207712_10519015 3300025961 Unclassified 1021
179 Ga0207640_10353298 3300025981 Bacteria 1182
180 Ga0207677_10036141 3300026023 Bacteria 3216
181 Ga0207677_10264075 3300026023 Bacteria 1405
182 Ga0207703_10293514 3300026035 Unclassified 1480
183 Ga0207639_10391675 3300026041 Bacteria 1250
184 Ga0207708_10033530 3300026075 Bacteria 3902
185 Ga0207708_10192492 3300026075 Bacteria 1624
186 Ga0207708_10280435 3300026075 Bacteria 1350
187 Ga0207708_10378335 3300026075 Bacteria 1167
188 Ga0207641_10183438 3300026088 Bacteria 1918
189 Ga0207641_10367944 3300026088 Unclassified 1374
190 Ga0207648_10044710 3300026089 Bacteria 3886
191 Ga0207648_10077324 3300026089 Bacteria 2901
192 Ga0207648_10084539 3300026089 Bacteria 2768
193 Ga0207676_10258935 3300026095 Bacteria 1570
194 Ga0207676_10293055 3300026095 Unclassified 1482
195 Ga0207676_10536709 3300026095 Bacteria 1116
196 Ga0207674_10195526 3300026116 Bacteria 1972
197 Ga0207674_10209867 3300026116 Bacteria 1897
198 Ga0207675_100150384 3300026118 Bacteria 2215
199 Ga0207675_100301190 3300026118 Bacteria 1561
200 Ga0207683_10047855 3300026121 Bacteria 3744
201 Ga0207683_10185303 3300026121 Bacteria 1888
202 Ga0209974_10104505 3300027876 Unclassified 992
203 Ga0207428_10141699 3300027907 Unclassified 1834
204 Ga0207428_10194630 3300027907 Bacteria 1527
205 Ga0268266_10171618 3300028379 Unclassified 1969
206 Ga0268265_10014733 3300028380 Bacteria 5335
207 Ga0268265_11173828 3300028380 Unclassified 764
208 Ga0307408_100138068 3300031548 Bacteria 1910
209 Ga0307408_100801937 3300031548 Bacteria 855
210 Ga0307408_101068726 3300031548 Unclassified 747
211 Ga0307405_10013480 3300031731 Bacteria 4363
212 Ga0307405_10105168 3300031731 Bacteria 1901
213 Ga0307413_10005588 3300031824 Bacteria 5633
214 Ga0307413_10141590 3300031824 Archaea 1663
215 Ga0307413_10947886 3300031824 Unclassified 734
216 Ga0307410_10000368 3300031852 Bacteria 17592
217 Ga0307410_10101310 3300031852 Bacteria 2064
218 Ga0307406_10032797 3300031901 Bacteria 3173
219 Ga0307406_10090021 3300031901 Bacteria 2063
220 Ga0307407_10114029 3300031903 Bacteria 1702
221 Ga0307407_10544641 3300031903 Unclassified 857
222 Ga0307412_10090107 3300031911 Bacteria 2143
223 Ga0307412_10124546 3300031911 Bacteria 1861
224 Ga0307409_100045653 3300031995 Bacteria 3309
225 Ga0307409_100179759 3300031995 Bacteria 1871
226 Ga0307409_100287215 3300031995 Unclassified 1524
227 Ga0307411_10003843 3300032005 Bacteria 7073
228 Ga0307411_10018441 3300032005 Bacteria 4003
229 Ga0307411_10523514 3300032005 Bacteria 1007
230 Ga0373933_0392363 3300035724 Bacteria 905
231 Ga0451837_0433551 3300041494 Unclassified 821
232 Ga0439431_0164103 3300041997 Unclassified 636
233 Ga0439433_0069446 3300041999 Bacteria 847
234 Ga0439434_0009970 3300042435 Bacteria 2796
235 Ga0439434_0160221 3300042435 Unclassified 747
236 Ga0495610_0083919 3300046512 Unclassified 1457
237 Ga0495616_0297452 3300046513 Unclassified 682
238 Ga0495663_0000393 3300046525 Bacteria 16144
239 Ga0495598_0005718 3300046537 Unclassified 2773
240 Ga0495598_0135823 3300046537 Unclassified 847
241 Ga0495621_0000175 3300046539 Bacteria 14565
242 Ga0495668_0113791 3300046616 Bacteria 1480
243 Ga0496112_0478020 3300048915 Bacteria 1183
244 Ga0501036_0632246 3300049572 Bacteria 887
245 Ga0501072_0064137 3300049588 Bacteria 2897
246 nmdc:mga05p37_1360964_c1 3300050507 Unclassified 718
247 nmdc:mga05p37_1387094_c1 3300050507 Unclassified 709
248 nmdc:mga05p37_163177_c1 3300050507 Bacteria 2720
249 nmdc:mga05p37_514090_c1 3300050507 Bacteria 1371
250 nmdc:mga08y16_1206419_c1 3300050511 Unclassified 727
251 nmdc:mga08y16_178435_c1 3300050511 Bacteria 2206
252 nmdc:mga08y16_332610_c1 3300050511 Bacteria 1562
253 nmdc:mga08y16_565332_c1 3300050511 Bacteria 1149
254 Ga0500577_0216505 3300053142 Unclassified 828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046537 Ga0495598_0135823 Ga0495598_0135823_148_636 161
2 3300041997 Ga0439431_0164103 Ga0439431_0164103_103_621 172
3 3300009094 Ga0111539_10157973 Ga0111539_101579733 180
4 3300009147 Ga0114129_10393482 Ga0114129_103934822 180
5 3300010375 Ga0105239_10359678 Ga0105239_103596781 180
6 3300013297 Ga0157378_10001282 Ga0157378_1000128219 180
7 3300013306 Ga0163162_10011606 Ga0163162_100116067 180
8 3300013306 Ga0163162_10951804 Ga0163162_109518041 180
9 3300013308 Ga0157375_10004418 Ga0157375_100044183 180
10 3300035724 Ga0373933_0392363 Ga0373933_0392363_97_642 180
11 3300050507 nmdc:mga05p37_163177_c1 nmdc:mga05p37_163177_c1_1046_1591 180
12 3300009553 Ga0105249_10132401 Ga0105249_101324014 181
13 3300031548 Ga0307408_100138068 Ga0307408_1001380682 188
14 3300031995 Ga0307409_100045653 Ga0307409_1000456532 188
15 3300032005 Ga0307411_10018441 Ga0307411_100184414 188
16 3300026095 Ga0207676_10536709 Ga0207676_105367091 191
17 3300005293 Ga0065715_10341763 Ga0065715_103417632 192
18 3300005328 Ga0070676_10021902 Ga0070676_100219023 192
19 3300005328 Ga0070676_10318323 Ga0070676_103183231 192
20 3300005331 Ga0070670_100014074 Ga0070670_1000140743 192
21 3300005334 Ga0068869_100320370 Ga0068869_1003203702 192
22 3300005340 Ga0070689_100047453 Ga0070689_1000474532 192
23 3300005354 Ga0070675_100245584 Ga0070675_1002455842 192
24 3300005356 Ga0070674_100084025 Ga0070674_1000840252 192
25 3300005364 Ga0070673_100070496 Ga0070673_1000704962 192
26 3300005564 Ga0070664_100702533 Ga0070664_1007025331 192
27 3300005719 Ga0068861_100468504 Ga0068861_1004685041 192
28 3300005840 Ga0068870_10098998 Ga0068870_100989982 192
29 3300009147 Ga0114129_10679240 Ga0114129_106792401 192
30 3300013307 Ga0157372_10380160 Ga0157372_103801602 192
31 3300013308 Ga0157375_10160549 Ga0157375_101605492 192
32 3300013308 Ga0157375_10184122 Ga0157375_101841222 192
33 3300014326 Ga0157380_10011031 Ga0157380_100110317 192
34 3300025907 Ga0207645_10075504 Ga0207645_100755042 192
35 3300025925 Ga0207650_10125800 Ga0207650_101258002 192
36 3300025925 Ga0207650_10133632 Ga0207650_101336322 192
37 3300025926 Ga0207659_10140660 Ga0207659_101406602 192
38 3300025937 Ga0207669_10280197 Ga0207669_102801972 192
39 3300025940 Ga0207691_10167693 Ga0207691_101676932 192
40 3300025945 Ga0207679_10673458 Ga0207679_106734581 192
41 3300026121 Ga0207683_10047855 Ga0207683_100478555 192
42 3300027876 Ga0209974_10104505 Ga0209974_101045052 192
43 3300031731 Ga0307405_10105168 Ga0307405_101051682 192
44 3300031901 Ga0307406_10090021 Ga0307406_100900212 192
45 3300049588 Ga0501072_0064137 Ga0501072_0064137_895_1479 192
46 3300050507 nmdc:mga05p37_1360964_c1 nmdc:mga05p37_1360964_c1_85_666 192
47 3300005289 Ga0065704_10205968 Ga0065704_102059681 193
48 3300031901 Ga0307406_10032797 Ga0307406_100327972 193
49 3300005441 Ga0070700_100148874 Ga0070700_1001488742 194
50 3300005844 Ga0068862_101220451 Ga0068862_1012204511 194
51 3300028380 Ga0268265_11173828 Ga0268265_111738281 194
52 3300031548 Ga0307408_101068726 Ga0307408_1010687261 194
53 3300031731 Ga0307405_10013480 Ga0307405_100134802 194
54 3300031824 Ga0307413_10005588 Ga0307413_100055883 194
55 3300031824 Ga0307413_10141590 Ga0307413_101415902 194
56 3300031824 Ga0307413_10947886 Ga0307413_109478861 194
57 3300031852 Ga0307410_10000368 Ga0307410_1000036810 194
58 3300031852 Ga0307410_10101310 Ga0307410_101013103 194
59 3300031903 Ga0307407_10114029 Ga0307407_101140291 194
60 3300031911 Ga0307412_10090107 Ga0307412_100901072 194
61 3300031911 Ga0307412_10124546 Ga0307412_101245462 194
62 3300031995 Ga0307409_100179759 Ga0307409_1001797592 194
63 3300031995 Ga0307409_100287215 Ga0307409_1002872152 194
64 3300032005 Ga0307411_10003843 Ga0307411_100038433 194
65 3300032005 Ga0307411_10523514 Ga0307411_105235142 194
66 3300041494 Ga0451837_0433551 Ga0451837_0433551_131_736 194
67 3300005289 Ga0065704_10139353 Ga0065704_101393531 195
68 3300005295 Ga0065707_10004910 Ga0065707_100049107 195
69 3300005295 Ga0065707_10016231 Ga0065707_100162312 195
70 3300005334 Ga0068869_100019758 Ga0068869_1000197586 195
71 3300005336 Ga0070680_100110262 Ga0070680_1001102622 195
72 3300005337 Ga0070682_100000076 Ga0070682_10000007679 195
73 3300005343 Ga0070687_100004254 Ga0070687_1000042546 195
74 3300005344 Ga0070661_100688368 Ga0070661_1006883682 195
75 3300005353 Ga0070669_100000653 Ga0070669_10000065317 195
76 3300005354 Ga0070675_100107418 Ga0070675_1001074182 195
77 3300005441 Ga0070700_100542192 Ga0070700_1005421922 195
78 3300005457 Ga0070662_100062884 Ga0070662_1000628844 195
79 3300005457 Ga0070662_100095106 Ga0070662_1000951064 195
80 3300005457 Ga0070662_100843530 Ga0070662_1008435301 195
81 3300005459 Ga0068867_100688924 Ga0068867_1006889241 195
82 3300005544 Ga0070686_100002652 Ga0070686_1000026525 195
83 3300005577 Ga0068857_100587205 Ga0068857_1005872051 195
84 3300005618 Ga0068864_100283904 Ga0068864_1002839042 195
85 3300005618 Ga0068864_100859088 Ga0068864_1008590881 195
86 3300005718 Ga0068866_10340182 Ga0068866_103401822 195
87 3300005719 Ga0068861_100288726 Ga0068861_1002887263 195
88 3300005840 Ga0068870_10326815 Ga0068870_103268152 195
89 3300005841 Ga0068863_100361983 Ga0068863_1003619831 195
90 3300005843 Ga0068860_100223893 Ga0068860_1002238931 195
91 3300007076 Ga0075435_100562066 Ga0075435_1005620662 195
92 3300009094 Ga0111539_10475071 Ga0111539_104750713 195
93 3300009147 Ga0114129_10544910 Ga0114129_105449103 195
94 3300009148 Ga0105243_10074892 Ga0105243_100748923 195
95 3300009148 Ga0105243_11016660 Ga0105243_110166602 195
96 3300009174 Ga0105241_10641416 Ga0105241_106414162 195
97 3300009176 Ga0105242_10053462 Ga0105242_100534624 195
98 3300009553 Ga0105249_10044881 Ga0105249_100448813 195
99 3300014325 Ga0163163_10137655 Ga0163163_101376554 195
100 3300014326 Ga0157380_10001205 Ga0157380_1000120518 195
101 3300025918 Ga0207662_10020084 Ga0207662_100200843 195
102 3300025923 Ga0207681_10000828 Ga0207681_100008288 195
103 3300025926 Ga0207659_10810019 Ga0207659_108100191 195
104 3300025934 Ga0207686_10335293 Ga0207686_103352932 195
105 3300025942 Ga0207689_10033384 Ga0207689_100333842 195
106 3300026075 Ga0207708_10192492 Ga0207708_101924923 195
107 3300026088 Ga0207641_10183438 Ga0207641_101834381 195
108 3300026089 Ga0207648_10077324 Ga0207648_100773243 195
109 3300026089 Ga0207648_10084539 Ga0207648_100845392 195
110 3300026095 Ga0207676_10258935 Ga0207676_102589352 195
111 3300026116 Ga0207674_10209867 Ga0207674_102098673 195
112 3300027907 Ga0207428_10141699 Ga0207428_101416992 195
113 3300028380 Ga0268265_10014733 Ga0268265_100147333 195
114 3300031903 Ga0307407_10544641 Ga0307407_105446411 195
115 3300046512 Ga0495610_0083919 Ga0495610_0083919_202_792 195
116 3300046525 Ga0495663_0000393 Ga0495663_0000393_2000_2590 195
117 3300046537 Ga0495598_0005718 Ga0495598_0005718_151_741 195
118 3300046539 Ga0495621_0000175 Ga0495621_0000175_11929_12519 195
119 3300046616 Ga0495668_0113791 Ga0495668_0113791_720_1310 195
120 3300050507 nmdc:mga05p37_1387094_c1 nmdc:mga05p37_1387094_c1_58_648 195
121 3300050511 nmdc:mga08y16_1206419_c1 nmdc:mga08y16_1206419_c1_76_666 195
122 3300050511 nmdc:mga08y16_332610_c1 nmdc:mga08y16_332610_c1_882_1472 195
123 3300005293 Ga0065715_10021350 Ga0065715_100213501 196
124 3300005330 Ga0070690_100182297 Ga0070690_1001822971 196
125 3300005334 Ga0068869_100162259 Ga0068869_1001622591 196
126 3300005338 Ga0068868_100033567 Ga0068868_1000335672 196
127 3300005340 Ga0070689_100319129 Ga0070689_1003191293 196
128 3300005343 Ga0070687_100215441 Ga0070687_1002154411 196
129 3300005353 Ga0070669_100231862 Ga0070669_1002318622 196
130 3300005354 Ga0070675_100187798 Ga0070675_1001877982 196
131 3300005354 Ga0070675_101249597 Ga0070675_1012495971 196
132 3300005438 Ga0070701_10109609 Ga0070701_101096091 196
133 3300005438 Ga0070701_10515122 Ga0070701_105151221 196
134 3300005440 Ga0070705_100040720 Ga0070705_1000407202 196
135 3300005444 Ga0070694_100453275 Ga0070694_1004532752 196
136 3300005456 Ga0070678_100058608 Ga0070678_1000586083 196
137 3300005456 Ga0070678_100693890 Ga0070678_1006938901 196
138 3300005471 Ga0070698_100002172 Ga0070698_10000217213 196
139 3300005536 Ga0070697_100169224 Ga0070697_1001692242 196
140 3300005536 Ga0070697_100517125 Ga0070697_1005171252 196
141 3300005545 Ga0070695_100290267 Ga0070695_1002902672 196
142 3300005546 Ga0070696_100260983 Ga0070696_1002609831 196
143 3300005547 Ga0070693_100383891 Ga0070693_1003838912 196
144 3300005549 Ga0070704_100264955 Ga0070704_1002649552 196
145 3300005615 Ga0070702_100262537 Ga0070702_1002625371 196
146 3300005615 Ga0070702_100288499 Ga0070702_1002884993 196
147 3300005617 Ga0068859_100009613 Ga0068859_10000961312 196
148 3300005618 Ga0068864_100015663 Ga0068864_1000156632 196
149 3300005618 Ga0068864_100801797 Ga0068864_1008017971 196
150 3300005718 Ga0068866_10006321 Ga0068866_100063211 196
151 3300005719 Ga0068861_100392472 Ga0068861_1003924721 196
152 3300005841 Ga0068863_100300335 Ga0068863_1003003353 196
153 3300005842 Ga0068858_100836827 Ga0068858_1008368272 196
154 3300005843 Ga0068860_100107392 Ga0068860_1001073923 196
155 3300006237 Ga0097621_100179496 Ga0097621_1001794963 196
156 3300006237 Ga0097621_100700521 Ga0097621_1007005212 196
157 3300006358 Ga0068871_100102557 Ga0068871_1001025574 196
158 3300006871 Ga0075434_101011184 Ga0075434_1010111841 196
159 3300006931 Ga0097620_100009613 Ga0097620_10000961312 196
160 3300009092 Ga0105250_10246506 Ga0105250_102465061 196
161 3300009098 Ga0105245_10011035 Ga0105245_100110356 196
162 3300009147 Ga0114129_10508095 Ga0114129_105080951 196
163 3300009147 Ga0114129_10647227 Ga0114129_106472272 196
164 3300009174 Ga0105241_10561516 Ga0105241_105615162 196
165 3300009177 Ga0105248_10958370 Ga0105248_109583702 196
166 3300009553 Ga0105249_10062683 Ga0105249_100626834 196
167 3300011119 Ga0105246_10658395 Ga0105246_106583952 196
168 3300013297 Ga0157378_10014402 Ga0157378_100144021 196
169 3300013297 Ga0157378_10826106 Ga0157378_108261061 196
170 3300013306 Ga0163162_10743980 Ga0163162_107439802 196
171 3300013308 Ga0157375_10732693 Ga0157375_107326932 196
172 3300014325 Ga0163163_10001831 Ga0163163_100018314 196
173 3300014325 Ga0163163_10192357 Ga0163163_101923571 196
174 3300014325 Ga0163163_10326924 Ga0163163_103269241 196
175 3300014326 Ga0157380_10080244 Ga0157380_100802444 196
176 3300014745 Ga0157377_10290943 Ga0157377_102909432 196
177 3300017792 Ga0163161_10148374 Ga0163161_101483742 196
178 3300025315 Ga0207697_10050116 Ga0207697_100501161 196
179 3300025910 Ga0207684_10049887 Ga0207684_100498873 196
180 3300025918 Ga0207662_10022094 Ga0207662_100220944 196
181 3300025923 Ga0207681_10223154 Ga0207681_102231542 196
182 3300025926 Ga0207659_10471045 Ga0207659_104710451 196
183 3300025926 Ga0207659_10716088 Ga0207659_107160882 196
184 3300025927 Ga0207687_10100612 Ga0207687_101006123 196
185 3300025933 Ga0207706_10223740 Ga0207706_102237403 196
186 3300025936 Ga0207670_10429738 Ga0207670_104297382 196
187 3300025940 Ga0207691_10017302 Ga0207691_100173025 196
188 3300025941 Ga0207711_10171018 Ga0207711_101710182 196
189 3300025942 Ga0207689_10010246 Ga0207689_100102469 196
190 3300025942 Ga0207689_10038011 Ga0207689_100380113 196
191 3300025945 Ga0207679_10267427 Ga0207679_102674273 196
192 3300025961 Ga0207712_10519015 Ga0207712_105190152 196
193 3300025981 Ga0207640_10353298 Ga0207640_103532982 196
194 3300026023 Ga0207677_10036141 Ga0207677_100361414 196
195 3300026023 Ga0207677_10264075 Ga0207677_102640753 196
196 3300026035 Ga0207703_10293514 Ga0207703_102935142 196
197 3300026041 Ga0207639_10391675 Ga0207639_103916752 196
198 3300026075 Ga0207708_10033530 Ga0207708_100335304 196
199 3300026088 Ga0207641_10367944 Ga0207641_103679441 196
200 3300026089 Ga0207648_10044710 Ga0207648_100447105 196
201 3300026095 Ga0207676_10293055 Ga0207676_102930552 196
202 3300026118 Ga0207675_100150384 Ga0207675_1001503841 196
203 3300026118 Ga0207675_100301190 Ga0207675_1003011903 196
204 3300026121 Ga0207683_10185303 Ga0207683_101853033 196
205 3300028379 Ga0268266_10171618 Ga0268266_101716182 196
206 3300041999 Ga0439433_0069446 Ga0439433_0069446_142_759 196
207 3300042435 Ga0439434_0009970 Ga0439434_0009970_1373_1966 196
208 3300042435 Ga0439434_0160221 Ga0439434_0160221_59_652 196
209 3300048915 Ga0496112_0478020 Ga0496112_0478020_281_874 196
210 3300053142 Ga0500577_0216505 Ga0500577_0216505_47_646 196
211 2162886012 MBSR1b_contig_6353584 MBSR1b_0491.00004770 197
212 3300003322 rootL2_10161719 rootL2_101617193 197
213 3300005290 Ga0065712_10144013 Ga0065712_101440132 197
214 3300005328 Ga0070676_10093719 Ga0070676_100937192 197
215 3300005333 Ga0070677_10421501 Ga0070677_104215011 197
216 3300005334 Ga0068869_100061637 Ga0068869_1000616372 197
217 3300005340 Ga0070689_100153887 Ga0070689_1001538873 197
218 3300005341 Ga0070691_10106947 Ga0070691_101069472 197
219 3300005364 Ga0070673_100106788 Ga0070673_1001067881 197
220 3300005438 Ga0070701_10041704 Ga0070701_100417041 197
221 3300005441 Ga0070700_100262684 Ga0070700_1002626842 197
222 3300005456 Ga0070678_100193669 Ga0070678_1001936693 197
223 3300005549 Ga0070704_100105881 Ga0070704_1001058812 197
224 3300005549 Ga0070704_100123165 Ga0070704_1001231651 197
225 3300005617 Ga0068859_100038062 Ga0068859_1000380628 197
226 3300005617 Ga0068859_100145193 Ga0068859_1001451933 197
227 3300005617 Ga0068859_100391753 Ga0068859_1003917533 197
228 3300005618 Ga0068864_100575360 Ga0068864_1005753602 197
229 3300005840 Ga0068870_10422220 Ga0068870_104222202 197
230 3300006846 Ga0075430_100056687 Ga0075430_1000566874 197
231 3300006931 Ga0097620_100038060 Ga0097620_1000380608 197
232 3300006931 Ga0097620_100145189 Ga0097620_1001451893 197
233 3300006931 Ga0097620_100391787 Ga0097620_1003917873 197
234 3300009094 Ga0111539_10129054 Ga0111539_101290544 197
235 3300009094 Ga0111539_11297549 Ga0111539_112975491 197
236 3300009147 Ga0114129_10042525 Ga0114129_100425251 197
237 3300009147 Ga0114129_10126690 Ga0114129_101266904 197
238 3300014326 Ga0157380_10036321 Ga0157380_100363214 197
239 3300025903 Ga0207680_10128216 Ga0207680_101282162 197
240 3300025907 Ga0207645_10012783 Ga0207645_100127838 197
241 3300025908 Ga0207643_10132693 Ga0207643_101326933 197
242 3300025940 Ga0207691_10401794 Ga0207691_104017942 197
243 3300025942 Ga0207689_10137365 Ga0207689_101373652 197
244 3300025945 Ga0207679_10423190 Ga0207679_104231902 197
245 3300026075 Ga0207708_10280435 Ga0207708_102804352 197
246 3300026075 Ga0207708_10378335 Ga0207708_103783352 197
247 3300026116 Ga0207674_10195526 Ga0207674_101955262 197
248 3300027907 Ga0207428_10194630 Ga0207428_101946303 197
249 3300031548 Ga0307408_100801937 Ga0307408_1008019371 197
250 3300046513 Ga0495616_0297452 Ga0495616_0297452_26_625 197
251 3300049572 Ga0501036_0632246 Ga0501036_0632246_183_776 197
252 3300050507 nmdc:mga05p37_514090_c1 nmdc:mga05p37_514090_c1_547_1149 197
253 3300050511 nmdc:mga08y16_178435_c1 nmdc:mga08y16_178435_c1_653_1246 197
254 3300050511 nmdc:mga08y16_565332_c1 nmdc:mga08y16_565332_c1_369_974 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

58

148

0.95

PF13649

Methyltransf_25

Methyltransferase domain

57

144

0.89

PF13847

Methyltransf_31

Methyltransferase domain

52

178

0.87

PF08242

Methyltransf_12

Methyltransferase domain

58

146

0.8

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

16

165

0.79

PF13489

Methyltransf_23

Methyltransferase domain

26

183

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bus-assembly2.cif.gz_B crystal structure of rebm 0.8292 26 197
6p3o-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with (s)-cis-n-methylstylopine and s-adenosylhomocysteine 0.7921 26 139
6f5z-assembly1.cif.gz_B complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase 0.7889 1 196
6p3n-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylmethionine 0.7873 26 139
6p3m-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylhomocysteine 0.7869 26 139
ID Description Score Start End Superfamily
af_A0A144A060_258_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.859 40 104 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8364 30 134 3.40.50.150
af_Q4DS78_179_367_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8287 22 197 3.40.50.150
2zulA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8252 26 196 3.40.50.150
af_P30866_6_206_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8226 60 197 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V1LTR9-F1-model_v4 Class I SAM-dependent methyltransferase 0.8783 6 134 GO:0008757
GO:0032259
AF-A0A520KPK9-F1-model_v4 Class I SAM-dependent methyltransferase 0.8593 6 195 GO:0008757
GO:0032259
AF-A0A1G3C466-F1-model_v4 Methyltransferase domain-containing protein 0.8571 37 196 GO:0008168
GO:0032259
AF-A0A455SGT2-F1-model_v4 Fatty-acid O-methyltransferase 0.8537 26 183 GO:0008757
GO:0032259
AF-A0A1I5LWF7-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.8533 3 195 GO:0009234
GO:0016020
GO:0016765
GO:0032259
GO:0043770

Feature Viewer

pLDDT pTM Quality
77.4 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map