F364579

General Info

Members Datasets Scaffolds Average Seq Length
254 182 508 138

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10305873|Ga0065715_103058731
Length 153
Sequence MAIDVRGLAPLLEVFDMPSSIAFYRGTLGFEVIATSRPGPNFDWALLSLNGVEIMLNTAYEAAARPAYPDPARIAAHADTAIYFGCPDVDAAYEYLRAKGVKTEKVQTAPYGMRQLYLLDPDGYKLCLQWPASEQMRAEWKKRYGSGGATVAG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 3.15
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0
Rhizosphere 94.88
Stem 0
Stem Tuber 0
Unclassified 21.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10305873 3300005293 Bacteria 1031
2 rootL2_10194155 3300003322 Bacteria 3855
3 rootH1_10238914 3300003323 Bacteria 2421
4 Ga0058862_10271461 3300004803 Unclassified 575
5 Ga0065704_10291670 3300005289 Unclassified 902
6 Ga0065715_10308805 3300005293 Bacteria 1025
7 Ga0070658_11181029 3300005327 Unclassified 665
8 Ga0070676_10109745 3300005328 Bacteria 1716
9 Ga0070683_100214536 3300005329 Bacteria 1829
10 Ga0070683_102208373 3300005329 Unclassified 528
11 Ga0070670_100056342 3300005331 Bacteria 3373
12 Ga0070670_100158712 3300005331 Bacteria 1959
13 Ga0070670_100532011 3300005331 Bacteria 1047
14 Ga0070677_10366443 3300005333 Bacteria 750
15 Ga0068869_101633360 3300005334 Bacteria 574
16 Ga0070680_100063789 3300005336 Bacteria 3018
17 Ga0070682_100222381 3300005337 Bacteria 1345
18 Ga0068868_101415525 3300005338 Unclassified 649
19 Ga0070689_100042231 3300005340 Bacteria 3501
20 Ga0070687_100167265 3300005343 Bacteria 1305
21 Ga0070692_10017437 3300005345 Bacteria 3433
22 Ga0070668_100211122 3300005347 Bacteria 1597
23 Ga0070669_100128362 3300005353 Bacteria 1942
24 Ga0070675_100891674 3300005354 Bacteria 815
25 Ga0070675_101187251 3300005354 Unclassified 702
26 Ga0070671_100139728 3300005355 Bacteria 2044
27 Ga0070673_100878090 3300005364 Bacteria 831
28 Ga0070673_100996737 3300005364 Bacteria 780
29 Ga0070688_100038529 3300005365 Bacteria 2919
30 Ga0070667_100175524 3300005367 Bacteria 1893
31 Ga0070713_101176706 3300005436 Unclassified 742
32 Ga0070705_100479827 3300005440 Unclassified 939
33 Ga0070700_100080786 3300005441 Bacteria 2099
34 Ga0070694_100770111 3300005444 Unclassified 787
35 Ga0070708_100292897 3300005445 Bacteria 1532
36 Ga0070663_100121272 3300005455 Bacteria 1975
37 Ga0070678_100150757 3300005456 Bacteria 1873
38 Ga0070662_100107512 3300005457 Bacteria 2121
39 Ga0068867_100980943 3300005459 Bacteria 765
40 Ga0068867_102246128 3300005459 Bacteria 518
41 Ga0070685_10224058 3300005466 Bacteria 1233
42 Ga0070706_100048165 3300005467 Bacteria 3934
43 Ga0070706_100119895 3300005467 Bacteria 2452
44 Ga0070707_100001566 3300005468 Bacteria 22158
45 Ga0070707_100188694 3300005468 Unclassified 2010
46 Ga0070707_100537940 3300005468 Bacteria 1130
47 Ga0070698_100006417 3300005471 Bacteria 12760
48 Ga0070698_102220526 3300005471 Unclassified 502
49 Ga0070699_100140838 3300005518 Bacteria 2130
50 Ga0070699_100767062 3300005518 Bacteria 882
51 Ga0070684_100638129 3300005535 Unclassified 991
52 Ga0070697_100079762 3300005536 Unclassified 2695
53 Ga0068853_100186284 3300005539 Bacteria 1884
54 Ga0068853_100757455 3300005539 Unclassified 928
55 Ga0070672_100227835 3300005543 Bacteria 1565
56 Ga0070672_100346393 3300005543 Bacteria 1266
57 Ga0070672_100405304 3300005543 Bacteria 1169
58 Ga0070672_101442945 3300005543 Bacteria 616
59 Ga0070686_101259718 3300005544 Bacteria 616
60 Ga0070695_101265818 3300005545 Bacteria 608
61 Ga0070665_100000062 3300005548 Bacteria 220304
62 Ga0070704_100423782 3300005549 Bacteria 1140
63 Ga0068855_100190147 3300005563 Bacteria 2316
64 Ga0068855_101517681 3300005563 Unclassified 687
65 Ga0068854_100274991 3300005578 Unclassified 1354
66 Ga0068856_100370735 3300005614 Bacteria 1451
67 Ga0068852_100227073 3300005616 Unclassified 1778
68 Ga0068859_100009237 3300005617 Bacteria 9961
69 Ga0068864_100085815 3300005618 Bacteria 2768
70 Ga0068861_100088081 3300005719 Bacteria 2444
71 Ga0068861_100403763 3300005719 Unclassified 1213
72 Ga0068861_101338010 3300005719 Bacteria 698
73 Ga0068863_100004876 3300005841 Bacteria 13217
74 Ga0068863_100118359 3300005841 Bacteria 2525
75 Ga0068863_101339655 3300005841 Unclassified 723
76 Ga0068858_100057273 3300005842 Bacteria 3602
77 Ga0068858_101286376 3300005842 Unclassified 720
78 Ga0068862_100068905 3300005844 Bacteria 3053
79 Ga0070717_11000927 3300006028 Unclassified 761
80 Ga0070716_100086526 3300006173 Bacteria 1885
81 Ga0070716_101523156 3300006173 Unclassified 547
82 Ga0070712_100596459 3300006175 Unclassified 934
83 Ga0075433_10002728 3300006852 Bacteria 13494
84 Ga0075433_10005659 3300006852 Bacteria 9819
85 Ga0075433_10123391 3300006852 Bacteria 2301
86 Ga0075433_11245254 3300006852 Bacteria 645
87 Ga0075434_100007924 3300006871 Bacteria 9843
88 Ga0075434_100026148 3300006871 Bacteria 5716
89 Ga0075434_100159457 3300006871 Bacteria 2276
90 Ga0075436_100015559 3300006914 Bacteria 5208
91 Ga0075436_100391463 3300006914 Bacteria 1006
92 Ga0097620_100009237 3300006931 Bacteria 9961
93 Ga0075435_100011288 3300007076 Bacteria 6563
94 Ga0075435_100019287 3300007076 Bacteria 5206
95 Ga0075435_100270612 3300007076 Unclassified 1449
96 Ga0099794_10001184 3300007265 Bacteria 8958
97 Ga0099794_10041693 3300007265 Bacteria 2186
98 Ga0099795_10001397 3300007788 Bacteria 5221
99 Ga0105240_10190836 3300009093 Bacteria 2410
100 Ga0111539_10106964 3300009094 Bacteria 3282
101 Ga0111539_10315227 3300009094 Unclassified 1820
102 Ga0111539_10768044 3300009094 Bacteria 1122
103 Ga0111539_13209675 3300009094 Unclassified 527
104 Ga0105247_10379910 3300009101 Bacteria 1001
105 Ga0114129_10133733 3300009147 Bacteria 3405
106 Ga0114129_10208809 3300009147 Unclassified 2641
107 Ga0114129_12962881 3300009147 Bacteria 559
108 Ga0105243_11388667 3300009148 Unclassified 722
109 Ga0105237_10622097 3300009545 Unclassified 1087
110 Ga0105249_10005724 3300009553 Bacteria 10749
111 Ga0105249_10018385 3300009553 Bacteria 6216
112 Ga0105249_10077000 3300009553 Bacteria 3092
113 Ga0105032_100651 3300009979 Bacteria 3390
114 Ga0157373_10081059 3300013100 Bacteria 2288
115 Ga0157370_10136927 3300013104 Bacteria 2282
116 Ga0157369_10017935 3300013105 Bacteria 7947
117 Ga0157369_10074957 3300013105 Unclassified 3628
118 Ga0157369_10306154 3300013105 Bacteria 1653
119 Ga0157369_11075595 3300013105 Unclassified 822
120 Ga0157378_10025631 3300013297 Bacteria 5191
121 Ga0163162_10088344 3300013306 Bacteria 3179
122 Ga0163162_10151483 3300013306 Bacteria 2437
123 Ga0157372_12927156 3300013307 Unclassified 546
124 Ga0157375_10437201 3300013308 Unclassified 1474
125 Ga0157375_10683451 3300013308 Bacteria 1181
126 Ga0163163_10329780 3300014325 Bacteria 1580
127 Ga0163163_10625246 3300014325 Bacteria 1140
128 Ga0157380_10019184 3300014326 Bacteria 5093
129 Ga0206352_10759613 3300020078 Unclassified 594
130 Ga0154015_1685445 3300020610 Bacteria 1919
131 Ga0213872_10000080 3300021361 Bacteria 88817
132 Ga0213876_10014658 3300021384 Bacteria 4152
133 Ga0213875_10000024 3300021388 Bacteria 200333
134 Ga0213875_10190663 3300021388 Bacteria 964
135 Ga0224712_10100248 3300022467 Unclassified 1227
136 Ga0207645_10044590 3300025907 Bacteria 2838
137 Ga0207684_10011261 3300025910 Bacteria 7833
138 Ga0207684_10420054 3300025910 Unclassified 1149
139 Ga0207695_10099049 3300025913 Bacteria 2913
140 Ga0207671_10363191 3300025914 Unclassified 1149
141 Ga0207693_10317050 3300025915 Unclassified 1220
142 Ga0207660_10474550 3300025917 Unclassified 1013
143 Ga0207662_10171064 3300025918 Bacteria 1393
144 Ga0207649_10861972 3300025920 Bacteria 709
145 Ga0207646_10001799 3300025922 Bacteria 25924
146 Ga0207646_10073874 3300025922 Bacteria 3046
147 Ga0207646_10554163 3300025922 Bacteria 1034
148 Ga0207681_10085528 3300025923 Bacteria 2238
149 Ga0207694_10757718 3300025924 Unclassified 820
150 Ga0207650_10107785 3300025925 Bacteria 2152
151 Ga0207650_10860891 3300025925 Bacteria 769
152 Ga0207650_11239248 3300025925 Bacteria 635
153 Ga0207644_10745040 3300025931 Unclassified 818
154 Ga0207670_10207402 3300025936 Bacteria 1492
155 Ga0207704_10828490 3300025938 Bacteria 774
156 Ga0207665_10110184 3300025939 Bacteria 1933
157 Ga0207691_10301171 3300025940 Bacteria 1377
158 Ga0207689_11224384 3300025942 Bacteria 632
159 Ga0207661_11257439 3300025944 Bacteria 681
160 Ga0207667_10055165 3300025949 Bacteria 4178
161 Ga0207667_10785802 3300025949 Bacteria 949
162 Ga0207712_10109767 3300025961 Bacteria 2067
163 Ga0207712_10284851 3300025961 Bacteria 1350
164 Ga0207640_10171034 3300025981 Bacteria 1619
165 Ga0207658_10017797 3300025986 Bacteria 4896
166 Ga0207703_10044033 3300026035 Bacteria 3585
167 Ga0207703_11075162 3300026035 Bacteria 772
168 Ga0207678_10085660 3300026067 Bacteria 2693
169 Ga0207708_10189143 3300026075 Bacteria 1638
170 Ga0207702_10438239 3300026078 Bacteria 1266
171 Ga0207641_10036422 3300026088 Bacteria 4107
172 Ga0207641_10146669 3300026088 Bacteria 2134
173 Ga0207676_10083568 3300026095 Bacteria 2600
174 Ga0207675_100106713 3300026118 Bacteria 2640
175 Ga0207675_100118598 3300026118 Bacteria 2502
176 Ga0207683_10460558 3300026121 Bacteria 1173
177 Ga0207683_10586202 3300026121 Bacteria 1032
178 Ga0209588_1124540 3300027671 Bacteria 823
179 Ga0207428_10371162 3300027907 Bacteria 1051
180 Ga0265356_1016530 3300028017 Bacteria 799
181 Ga0268266_10000001 3300028379 Bacteria 4040580
182 Ga0268266_11517422 3300028379 Unclassified 646
183 Ga0268265_10360382 3300028380 Bacteria 1331
184 Ga0268265_10485972 3300028380 Bacteria 1161
185 Ga0268265_10874319 3300028380 Bacteria 881
186 Ga0268265_11402715 3300028380 Unclassified 701
187 Ga0265765_1008123 3300030879 Bacteria 1139
188 Ga0265760_10003424 3300031090 Bacteria 4611
189 Ga0265327_10051606 3300031251 Bacteria 2146
190 Ga0265316_10003724 3300031344 Bacteria 15340
191 Ga0307508_10055648 3300031616 Bacteria 3504
192 Ga0307415_100690784 3300032126 Unclassified 920
193 Ga0373954_0063742 3300035118 Bacteria 1742
194 Ga0373927_0811727 3300035695 Bacteria 618
195 Ga0395898_0582090 3300037466 Bacteria 1062
196 Ga0436364_0995872 3300037853 Bacteria 2829
197 Ga0436364_1117385 3300037853 Bacteria 890
198 Ga0436364_1265330 3300037853 Bacteria 89074
199 Ga0436365_1877380 3300039437 Bacteria 14377
200 Ga0436361_0247001 3300039447 Bacteria 107036
201 Ga0451835_1086623 3300041492 Bacteria 625
202 Ga0466959_0144385 3300045049 Bacteria 1680
203 Ga0466967_0237798 3300045976 Bacteria 1736
204 Ga0495592_0094388 3300046454 Bacteria 2141
205 Ga0495641_0082953 3300046461 Bacteria 1436
206 Ga0495653_0170240 3300046463 Bacteria 1504
207 Ga0495662_0021934 3300046476 Bacteria 3086
208 Ga0495664_0002378 3300046477 Bacteria 10084
209 Ga0495628_0043226 3300046516 Bacteria 3590
210 Ga0495665_0334187 3300046531 Unclassified 773
211 Ga0495640_0130556 3300046533 Bacteria 1626
212 Ga0495645_0027000 3300046543 Bacteria 4170
213 Ga0495667_0134160 3300046559 Bacteria 1596
214 Ga0495634_0070442 3300046642 Bacteria 2305
215 Ga0495625_0107929 3300046660 Bacteria 1905
216 Ga0495599_0013637 3300046678 Bacteria 5022
217 Ga0495623_0152833 3300046679 Bacteria 1363
218 Ga0495613_0575519 3300046689 Bacteria 751
219 Ga0495600_0035510 3300046809 Unclassified 3238
220 Ga0495674_0085460 3300047319 Bacteria 2702
221 Ga0495602_0153413 3300048088 Unclassified 1807
222 Ga0501298_036933 3300049521 Unclassified 979
223 Ga0501041_0288730 3300049577 Bacteria 1033
224 Ga0501068_0192204 3300049584 Bacteria 1293
225 Ga0501072_0649457 3300049588 Bacteria 830
226 Ga0501073_0500411 3300049589 Bacteria 840
227 Ga0501075_0415800 3300049591 Unclassified 1025
228 Ga0501076_0144460 3300049592 Bacteria 1934
229 Ga0501079_0137369 3300049741 Bacteria 1904
230 Ga0501080_0686912 3300049742 Bacteria 904
231 Ga0501081_0066215 3300049743 Bacteria 2512
232 Ga0501045_0032266 3300049824 Bacteria 3795
233 nmdc:mga05p37_395383_c2 3300050507 Bacteria 1301
234 nmdc:mga08y16_1030961_c1 3300050511 Unclassified 801
235 nmdc:mga08y16_189682_c1 3300050511 Unclassified 2132
236 nmdc:mga08y16_1981625_c1 3300050511 Unclassified 532
237 nmdc:mga08y16_280141_c1 3300050511 Bacteria 1720
238 nmdc:mga0n895_105334_c1 3300050512 Bacteria 2833
239 nmdc:mga0n895_14490_c1 3300050512 Bacteria 7163
240 nmdc:mga0n895_4324_c1 3300050512 Bacteria 11644
241 nmdc:mga0rr50_34449_c1 3300050513 Bacteria 3626
242 nmdc:mga0rr50_8491_c1 3300050513 Bacteria 6398
243 nmdc:mga0rr50_85888_c1 3300050513 Bacteria 2439
244 nmdc:mga08x19_29194_c1 3300050514 Bacteria 3458
245 nmdc:mga0a205_1039286_c1 3300050515 Unclassified 666
246 nmdc:mga0a205_132_c1 3300050515 Bacteria 46466
247 nmdc:mga0a205_1847_c1 3300050515 Bacteria 18309
248 Ga0500556_0098061 3300053104 Bacteria 1126
249 Ga0501084_0503861 3300054114 Bacteria 1023
250 Ga0590071_184798 3300059421 Unclassified 547
251 Ga0587076_027355 3300059645 Unclassified 988
252 Ga0587071_101774 3300060344 Viruses 665
253 Ga0501082_0065516 3300060353 Bacteria 3129
254 2896088620 2896085136 Bacteria 6129793
255 Ga0065715_10305873
256 rootL2_10194155
257 rootH1_10238914
258 Ga0058862_10271461
259 Ga0065704_10291670
260 Ga0065715_10308805
261 Ga0070658_11181029
262 Ga0070676_10109745
263 Ga0070683_100214536
264 Ga0070683_102208373
265 Ga0070670_100056342
266 Ga0070670_100158712
267 Ga0070670_100532011
268 Ga0070677_10366443
269 Ga0068869_101633360
270 Ga0070680_100063789
271 Ga0070682_100222381
272 Ga0068868_101415525
273 Ga0070689_100042231
274 Ga0070687_100167265
275 Ga0070692_10017437
276 Ga0070668_100211122
277 Ga0070669_100128362
278 Ga0070675_100891674
279 Ga0070675_101187251
280 Ga0070671_100139728
281 Ga0070673_100878090
282 Ga0070673_100996737
283 Ga0070688_100038529
284 Ga0070667_100175524
285 Ga0070713_101176706
286 Ga0070705_100479827
287 Ga0070700_100080786
288 Ga0070694_100770111
289 Ga0070708_100292897
290 Ga0070663_100121272
291 Ga0070678_100150757
292 Ga0070662_100107512
293 Ga0068867_100980943
294 Ga0068867_102246128
295 Ga0070685_10224058
296 Ga0070706_100048165
297 Ga0070706_100119895
298 Ga0070707_100001566
299 Ga0070707_100188694
300 Ga0070707_100537940
301 Ga0070698_100006417
302 Ga0070698_102220526
303 Ga0070699_100140838
304 Ga0070699_100767062
305 Ga0070684_100638129
306 Ga0070697_100079762
307 Ga0068853_100186284
308 Ga0068853_100757455
309 Ga0070672_100227835
310 Ga0070672_100346393
311 Ga0070672_100405304
312 Ga0070672_101442945
313 Ga0070686_101259718
314 Ga0070695_101265818
315 Ga0070665_100000062
316 Ga0070704_100423782
317 Ga0068855_100190147
318 Ga0068855_101517681
319 Ga0068854_100274991
320 Ga0068856_100370735
321 Ga0068852_100227073
322 Ga0068859_100009237
323 Ga0068864_100085815
324 Ga0068861_100088081
325 Ga0068861_100403763
326 Ga0068861_101338010
327 Ga0068863_100004876
328 Ga0068863_100118359
329 Ga0068863_101339655
330 Ga0068858_100057273
331 Ga0068858_101286376
332 Ga0068862_100068905
333 Ga0070717_11000927
334 Ga0070716_100086526
335 Ga0070716_101523156
336 Ga0070712_100596459
337 Ga0075433_10002728
338 Ga0075433_10005659
339 Ga0075433_10123391
340 Ga0075433_11245254
341 Ga0075434_100007924
342 Ga0075434_100026148
343 Ga0075434_100159457
344 Ga0075436_100015559
345 Ga0075436_100391463
346 Ga0097620_100009237
347 Ga0075435_100011288
348 Ga0075435_100019287
349 Ga0075435_100270612
350 Ga0099794_10001184
351 Ga0099794_10041693
352 Ga0099795_10001397
353 Ga0105240_10190836
354 Ga0111539_10106964
355 Ga0111539_10315227
356 Ga0111539_10768044
357 Ga0111539_13209675
358 Ga0105247_10379910
359 Ga0114129_10133733
360 Ga0114129_10208809
361 Ga0114129_12962881
362 Ga0105243_11388667
363 Ga0105237_10622097
364 Ga0105249_10005724
365 Ga0105249_10018385
366 Ga0105249_10077000
367 Ga0105032_100651
368 Ga0157373_10081059
369 Ga0157370_10136927
370 Ga0157369_10017935
371 Ga0157369_10074957
372 Ga0157369_10306154
373 Ga0157369_11075595
374 Ga0157378_10025631
375 Ga0163162_10088344
376 Ga0163162_10151483
377 Ga0157372_12927156
378 Ga0157375_10437201
379 Ga0157375_10683451
380 Ga0163163_10329780
381 Ga0163163_10625246
382 Ga0157380_10019184
383 Ga0206352_10759613
384 Ga0154015_1685445
385 Ga0213872_10000080
386 Ga0213876_10014658
387 Ga0213875_10000024
388 Ga0213875_10190663
389 Ga0224712_10100248
390 Ga0207645_10044590
391 Ga0207684_10011261
392 Ga0207684_10420054
393 Ga0207695_10099049
394 Ga0207671_10363191
395 Ga0207693_10317050
396 Ga0207660_10474550
397 Ga0207662_10171064
398 Ga0207649_10861972
399 Ga0207646_10001799
400 Ga0207646_10073874
401 Ga0207646_10554163
402 Ga0207681_10085528
403 Ga0207694_10757718
404 Ga0207650_10107785
405 Ga0207650_10860891
406 Ga0207650_11239248
407 Ga0207644_10745040
408 Ga0207670_10207402
409 Ga0207704_10828490
410 Ga0207665_10110184
411 Ga0207691_10301171
412 Ga0207689_11224384
413 Ga0207661_11257439
414 Ga0207667_10055165
415 Ga0207667_10785802
416 Ga0207712_10109767
417 Ga0207712_10284851
418 Ga0207640_10171034
419 Ga0207658_10017797
420 Ga0207703_10044033
421 Ga0207703_11075162
422 Ga0207678_10085660
423 Ga0207708_10189143
424 Ga0207702_10438239
425 Ga0207641_10036422
426 Ga0207641_10146669
427 Ga0207676_10083568
428 Ga0207675_100106713
429 Ga0207675_100118598
430 Ga0207683_10460558
431 Ga0207683_10586202
432 Ga0209588_1124540
433 Ga0207428_10371162
434 Ga0265356_1016530
435 Ga0268266_10000001
436 Ga0268266_11517422
437 Ga0268265_10360382
438 Ga0268265_10485972
439 Ga0268265_10874319
440 Ga0268265_11402715
441 Ga0265765_1008123
442 Ga0265760_10003424
443 Ga0265327_10051606
444 Ga0265316_10003724
445 Ga0307508_10055648
446 Ga0307415_100690784
447 Ga0373954_0063742
448 Ga0373927_0811727
449 Ga0395898_0582090
450 Ga0436364_0995872
451 Ga0436364_1117385
452 Ga0436364_1265330
453 Ga0436365_1877380
454 Ga0436361_0247001
455 Ga0451835_1086623
456 Ga0466959_0144385
457 Ga0466967_0237798
458 Ga0495592_0094388
459 Ga0495641_0082953
460 Ga0495653_0170240
461 Ga0495662_0021934
462 Ga0495664_0002378
463 Ga0495628_0043226
464 Ga0495665_0334187
465 Ga0495640_0130556
466 Ga0495645_0027000
467 Ga0495667_0134160
468 Ga0495634_0070442
469 Ga0495625_0107929
470 Ga0495599_0013637
471 Ga0495623_0152833
472 Ga0495613_0575519
473 Ga0495600_0035510
474 Ga0495674_0085460
475 Ga0495602_0153413
476 Ga0501298_036933
477 Ga0501041_0288730
478 Ga0501068_0192204
479 Ga0501072_0649457
480 Ga0501073_0500411
481 Ga0501075_0415800
482 Ga0501076_0144460
483 Ga0501079_0137369
484 Ga0501080_0686912
485 Ga0501081_0066215
486 Ga0501045_0032266
487 nmdc:mga05p37_395383_c2
488 nmdc:mga08y16_1030961_c1
489 nmdc:mga08y16_189682_c1
490 nmdc:mga08y16_1981625_c1
491 nmdc:mga08y16_280141_c1
492 nmdc:mga0n895_105334_c1
493 nmdc:mga0n895_14490_c1
494 nmdc:mga0n895_4324_c1
495 nmdc:mga0rr50_34449_c1
496 nmdc:mga0rr50_8491_c1
497 nmdc:mga0rr50_85888_c1
498 nmdc:mga08x19_29194_c1
499 nmdc:mga0a205_1039286_c1
500 nmdc:mga0a205_132_c1
501 nmdc:mga0a205_1847_c1
502 Ga0500556_0098061
503 Ga0501084_0503861
504 Ga0590071_184798
505 Ga0587076_027355
506 Ga0587071_101774
507 Ga0501082_0065516
508 2896088620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

9

128

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.8094 9 136
1ecs-assembly1.cif.gz_B the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 0.8071 11 141
1ecs-assembly1.cif.gz_B the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 0.801 11 141
1mh6-assembly1.cif.gz_B solution structure of the transposon tn5-encoding bleomycin-binding protein, blmt 0.7884 11 136
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.7837 9 136
ID Description Score Start End Superfamily
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8594 88 140 3.30.720.110
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8236 12 69 3.30.720.120
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8038 88 140 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7976 88 136 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7932 88 140 3.30.720.110
ID Description Score Start End GO Terms
AF-Q1IRP2-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9432 8 140
AF-A0A2E8WB18-F1-model_v4 Glyoxalase 0.9359 8 137
AF-A0A0A0DG70-F1-model_v4 VOC domain-containing protein 0.931 8 142
AF-Q1IRP2-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9296 8 140
AF-A0A2Z5FWS5-F1-model_v4 VOC domain-containing protein 0.9293 8 142

Map