F364413

General Info

Members Datasets Scaffolds Average Seq Length
253 159 506 347

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0170529|Ga0501070_0170529_318_1457
Length 379
Sequence MHVGRGYHGFGSGFLAAVERCIVNKEQKIMRALTVMPGHAGSARLETVPEPEPEEGAVLVRCLAIGICGTDKEIVGGRYGWAPPGAERLILGHESVGKVEKAPAGSGFTAGDLVVGIVRRPDPVPCRFCAAGEWDMCANGRYAERGIKELNGFGSELFRIEPDFALRIDPSLGLLGVLLEPASVVAKAWDHVERIGHRSRAWSPRTLLVTGAGTVGLLAALMGAQRGLAVHVMDRVTDGPKPQLVRDLGGTYHAGRMPDADAFASDIIIECTGAPSVILDALGRSRPSGIVCLAGLSSGQHRIGLDVGALNRNMVLENDAVFGSVNANRTHYESAADALARADRGWLSRVVSRRVPLARWAEAFEPRPDDVKVVLDFTL

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
65 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
68 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
135 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
156 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
157 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
158 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
159 2891562705 Microbispora tritici MT50 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 3.16
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0170529 3300049586 Bacteria 1792
2 Ga0070680_100035981 3300005336 Bacteria 3999
3 Ga0070680_100122151 3300005336 Bacteria 2174
4 Ga0070682_100172083 3300005337 Bacteria 1506
5 Ga0070691_10005209 3300005341 Bacteria 5908
6 Ga0070668_100147665 3300005347 Bacteria 1899
7 Ga0070674_100074161 3300005356 Bacteria 2414
8 Ga0070713_100072148 3300005436 Bacteria 2920
9 Ga0070681_10019076 3300005458 Bacteria 6863
10 Ga0070681_10044165 3300005458 Bacteria 4460
11 Ga0070679_100084524 3300005530 Bacteria 3161
12 Ga0070684_100103245 3300005535 Bacteria 2550
13 Ga0070695_100088594 3300005545 Bacteria 2061
14 Ga0070693_100071133 3300005547 Bacteria 2049
15 Ga0068855_100018008 3300005563 Bacteria 8488
16 Ga0068855_100071677 3300005563 Bacteria 4028
17 Ga0070664_100082333 3300005564 Bacteria 2775
18 Ga0068856_100134880 3300005614 Bacteria 2474
19 Ga0068864_100173284 3300005618 Bacteria 1969
20 Ga0075363_100150765 3300006048 Bacteria 1312
21 Ga0075364_10030703 3300006051 Bacteria 3450
22 Ga0070712_100033192 3300006175 Bacteria 3491
23 Ga0070712_100036599 3300006175 Bacteria 3341
24 Ga0075362_10048340 3300006177 Bacteria 1898
25 Ga0075370_10038311 3300006353 Bacteria 2697
26 Ga0075434_100035988 3300006871 Bacteria 4895
27 Ga0105240_10197846 3300009093 Bacteria 2358
28 Ga0105240_10360301 3300009093 Bacteria 1647
29 Ga0114129_10367665 3300009147 Bacteria 1902
30 Ga0114129_10562818 3300009147 Bacteria 1481
31 Ga0105242_10080725 3300009176 Bacteria 2719
32 Ga0105248_10021034 3300009177 Bacteria 7230
33 Ga0105238_10061371 3300009551 Bacteria 3762
34 Ga0099796_10013093 3300010159 Bacteria 2361
35 Ga0163162_10198004 3300013306 Bacteria 2138
36 Ga0163162_10330612 3300013306 Bacteria 1656
37 Ga0157375_10174014 3300013308 Bacteria 2301
38 Ga0157380_10154726 3300014326 Bacteria 1986
39 Ga0157376_10065311 3300014969 Bacteria 3072
40 Ga0157376_10235362 3300014969 Bacteria 1703
41 Ga0182006_1022483 3300015261 Bacteria 2621
42 Ga0207692_10069832 3300025898 Bacteria 1847
43 Ga0207707_10012571 3300025912 Bacteria 7358
44 Ga0207707_10014586 3300025912 Bacteria 6846
45 Ga0207707_10097078 3300025912 Bacteria 2575
46 Ga0207695_10003937 3300025913 Bacteria 20547
47 Ga0207695_10010665 3300025913 Bacteria 11225
48 Ga0207695_10245743 3300025913 Bacteria 1689
49 Ga0207693_10008324 3300025915 Bacteria 8486
50 Ga0207693_10043023 3300025915 Bacteria 3555
51 Ga0207693_10106539 3300025915 Bacteria 2199
52 Ga0207660_10069906 3300025917 Bacteria 2551
53 Ga0207657_10113610 3300025919 Bacteria 2234
54 Ga0207652_10154668 3300025921 Bacteria 2054
55 Ga0207652_10190188 3300025921 Bacteria 1846
56 Ga0207694_10139704 3300025924 Bacteria 1947
57 Ga0207659_10082108 3300025926 Bacteria 2385
58 Ga0207700_10084519 3300025928 Bacteria 2488
59 Ga0207644_10337044 3300025931 Bacteria 1222
60 Ga0207669_10005923 3300025937 Bacteria 5535
61 Ga0207711_10007683 3300025941 Bacteria 9014
62 Ga0207661_10109292 3300025944 Bacteria 2336
63 Ga0207667_10153160 3300025949 Bacteria 2372
64 Ga0207667_10366380 3300025949 Bacteria 1469
65 Ga0207675_100292025 3300026118 Bacteria 1586
66 Ga0207698_10090830 3300026142 Bacteria 2498
67 Ga0265334_10011773 3300028573 Bacteria 3676
68 Ga0265338_10010507 3300028800 Bacteria 10840
69 Ga0265338_10108329 3300028800 Bacteria 2244
70 Ga0307408_100033631 3300031548 Bacteria 3584
71 Ga0307408_100051898 3300031548 Bacteria 2956
72 Ga0307405_10026012 3300031731 Bacteria 3369
73 Ga0307413_10091576 3300031824 Bacteria 1981
74 Ga0307410_10131160 3300031852 Bacteria 1841
75 Ga0307406_10046961 3300031901 Bacteria 2719
76 Ga0307406_10211220 3300031901 Bacteria 1436
77 Ga0307407_10002376 3300031903 Bacteria 7341
78 Ga0307412_10114348 3300031911 Bacteria 1932
79 Ga0307409_100335197 3300031995 Bacteria 1421
80 Ga0307416_100049341 3300032002 Bacteria 3346
81 Ga0307411_10018176 3300032005 Bacteria 4027
82 Ga0307411_10227629 3300032005 Bacteria 1451
83 Ga0307411_10242830 3300032005 Bacteria 1411
84 Ga0373944_0010884 3300035089 Bacteria 2486
85 Ga0373941_0000127 3300035115 Bacteria 13252
86 Ga0373945_0013094 3300035116 Bacteria 2764
87 Ga0373943_0000069 3300035170 Bacteria 36572
88 Ga0373943_0052534 3300035170 Bacteria 2009
89 Ga0373946_0000991 3300035171 Bacteria 9732
90 Ga0373961_0025957 3300035241 Bacteria 1597
91 Ga0373931_0062228 3300035691 Bacteria 2014
92 Ga0373935_0124739 3300035692 Bacteria 1724
93 Ga0373927_0023711 3300035695 Bacteria 4016
94 Ga0373927_0040672 3300035695 Bacteria 3015
95 Ga0373927_0089809 3300035695 Bacteria 1995
96 Ga0373947_0000446 3300035725 Bacteria 23457
97 Ga0373947_0027932 3300035725 Bacteria 3304
98 Ga0373925_0000377 3300037068 Bacteria 46250
99 Ga0373925_0000883 3300037068 Bacteria 27390
100 Ga0395899_0000666 3300037312 Bacteria 34912
101 Ga0395900_0000016 3300037418 Bacteria 382407
102 Ga0395900_0368797 3300037418 Bacteria 1406
103 Ga0395898_0014679 3300037466 Bacteria 8043
104 Ga0395905_0003448 3300037471 Bacteria 16921
105 Ga0395905_0005028 3300037471 Bacteria 13621
106 Ga0395901_0000022 3300038443 Bacteria 296356
107 Ga0395901_0213886 3300038443 Bacteria 2016
108 Ga0451791_0235826 3300041451 Bacteria 1482
109 Ga0439449_0047350 3300042007 Unclassified 1592
110 Ga0466965_0036964 3300044683 Bacteria 2397
111 Ga0451576_0393156 3300045051 Bacteria 1453
112 Ga0466967_0010848 3300045976 Bacteria 6863
113 Ga0495592_0111377 3300046454 Bacteria 1937
114 Ga0495629_0086664 3300046459 Bacteria 2184
115 Ga0495629_0093191 3300046459 Bacteria 2102
116 Ga0495662_0010437 3300046476 Bacteria 4548
117 Ga0495664_0000262 3300046477 Bacteria 25289
118 Ga0495618_0000259 3300046514 Bacteria 38359
119 Ga0495628_0044997 3300046516 Bacteria 3510
120 Ga0495630_0005629 3300046517 Bacteria 8852
121 Ga0495630_0024066 3300046517 Bacteria 4503
122 Ga0495665_0012194 3300046531 Bacteria 4652
123 Ga0495640_0000979 3300046533 Bacteria 22134
124 Ga0495640_0064002 3300046533 Bacteria 2488
125 Ga0495645_0018175 3300046543 Bacteria 5047
126 Ga0495634_0010542 3300046642 Bacteria 6765
127 Ga0495634_0095665 3300046642 Bacteria 1924
128 Ga0495635_0000280 3300046663 Bacteria 32788
129 Ga0495624_0004560 3300046690 Bacteria 10114
130 Ga0495581_0024148 3300047315 Bacteria 3522
131 Ga0495676_0033179 3300047321 Bacteria 4351
132 Ga0495684_0001987 3300047471 Bacteria 16434
133 Ga0495684_0006495 3300047471 Bacteria 9074
134 Ga0495593_0009762 3300047673 Bacteria 5568
135 Ga0495602_0125822 3300048088 Bacteria 2054
136 Ga0496101_0021230 3300048904 Bacteria 4459
137 Ga0496103_0140899 3300048906 Bacteria 1542
138 Ga0496104_0018770 3300048907 Bacteria 6315
139 Ga0496105_0006195 3300048908 Bacteria 9171
140 Ga0496110_0013005 3300048913 Bacteria 6865
141 Ga0496114_0010955 3300048917 Bacteria 7229
142 Ga0496115_0237159 3300048918 Bacteria 1503
143 Ga0501299_000254 3300049522 Bacteria 6095
144 Ga0501031_0030376 3300049568 Bacteria 3524
145 Ga0501031_0058234 3300049568 Bacteria 2517
146 Ga0501031_0224023 3300049568 Bacteria 1224
147 Ga0501032_0008464 3300049569 Bacteria 7499
148 Ga0501032_0079199 3300049569 Bacteria 2187
149 Ga0501033_0014185 3300049570 Bacteria 6057
150 Ga0501033_0021545 3300049570 Bacteria 4862
151 Ga0501034_0000230 3300049571 Bacteria 105001
152 Ga0501034_0244029 3300049571 Bacteria 1741
153 Ga0501036_0063368 3300049572 Bacteria 3131
154 Ga0501036_0099411 3300049572 Bacteria 2460
155 Ga0501037_0041725 3300049573 Bacteria 3373
156 Ga0501038_0016890 3300049574 Bacteria 6604
157 Ga0501038_0028077 3300049574 Bacteria 4999
158 Ga0501038_0047998 3300049574 Bacteria 3696
159 Ga0501038_0081696 3300049574 Bacteria 2722
160 Ga0501038_0119828 3300049574 Bacteria 2171
161 Ga0501039_0073641 3300049575 Bacteria 2653
162 Ga0501039_0279434 3300049575 Bacteria 1312
163 Ga0501040_0029586 3300049576 Bacteria 3699
164 Ga0501040_0116989 3300049576 Bacteria 1868
165 Ga0501042_0232458 3300049578 Bacteria 1330
166 Ga0501043_0015397 3300049579 Bacteria 5989
167 Ga0501043_0051389 3300049579 Bacteria 3238
168 Ga0501046_0009009 3300049580 Bacteria 8656
169 Ga0501046_0025489 3300049580 Bacteria 4839
170 Ga0501047_0000066 3300049581 Bacteria 132744
171 Ga0501047_0002523 3300049581 Bacteria 17444
172 Ga0501047_0035557 3300049581 Bacteria 4813
173 Ga0501048_0089813 3300049582 Bacteria 2168
174 Ga0501048_0105531 3300049582 Bacteria 1988
175 Ga0501048_0204429 3300049582 Unclassified 1400
176 Ga0501067_0001254 3300049583 Bacteria 13803
177 Ga0501068_0000060 3300049584 Bacteria 43179
178 Ga0501069_0012221 3300049585 Bacteria 4561
179 Ga0501069_0014416 3300049585 Bacteria 4226
180 Ga0501070_0007235 3300049586 Bacteria 9426
181 Ga0501070_0039592 3300049586 Bacteria 3931
182 Ga0501070_0138897 3300049586 Bacteria 2006
183 Ga0501070_0259083 3300049586 Bacteria 1422
184 Ga0501071_0094811 3300049587 Bacteria 2196
185 Ga0501071_0156578 3300049587 Bacteria 1701
186 Ga0501072_0000024 3300049588 Bacteria 143714
187 Ga0501072_0012054 3300049588 Bacteria 6605
188 Ga0501072_0120774 3300049588 Bacteria 2088
189 Ga0501072_0148627 3300049588 Bacteria 1868
190 Ga0501072_0257669 3300049588 Bacteria 1389
191 Ga0501072_0286212 3300049588 Bacteria 1310
192 Ga0501072_0320870 3300049588 Bacteria 1231
193 Ga0501073_0010741 3300049589 Bacteria 6705
194 Ga0501073_0042820 3300049589 Bacteria 3194
195 Ga0501073_0069561 3300049589 Bacteria 2452
196 Ga0501073_0084433 3300049589 Bacteria 2209
197 Ga0501073_0084859 3300049589 Bacteria 2203
198 Ga0501074_0013114 3300049590 Bacteria 6024
199 Ga0501075_0051153 3300049591 Bacteria 3106
200 Ga0501075_0138664 3300049591 Bacteria 1853
201 Ga0501076_0018564 3300049592 Bacteria 5305
202 Ga0501076_0034628 3300049592 Bacteria 3948
203 Ga0501076_0046961 3300049592 Bacteria 3413
204 Ga0501076_0200375 3300049592 Bacteria 1630
205 Ga0501076_0283037 3300049592 Bacteria 1358
206 Ga0501077_0008337 3300049593 Bacteria 6413
207 Ga0501208_013127 3300049655 Bacteria 1231
208 Ga0501233_031938 3300049668 Bacteria 1194
209 Ga0501235_019361 3300049669 Bacteria 1510
210 Ga0501221_026026 3300049704 Bacteria 1186
211 Ga0501079_0027021 3300049741 Bacteria 4399
212 Ga0501079_0030442 3300049741 Bacteria 4146
213 Ga0501079_0089115 3300049741 Bacteria 2389
214 Ga0501079_0147725 3300049741 Unclassified 1832
215 Ga0501079_0191244 3300049741 Bacteria 1597
216 Ga0501080_0010423 3300049742 Bacteria 8508
217 Ga0501080_0037032 3300049742 Bacteria 4554
218 Ga0501080_0083603 3300049742 Bacteria 2965
219 Ga0501080_0107067 3300049742 Bacteria 2591
220 Ga0501080_0135548 3300049742 Bacteria 2278
221 Ga0501080_0203456 3300049742 Bacteria 1817
222 Ga0501081_0015208 3300049743 Bacteria 5077
223 Ga0501083_0018112 3300049744 Bacteria 4910
224 Ga0501083_0073653 3300049744 Bacteria 2270
225 Ga0501083_0104508 3300049744 Bacteria 1866
226 Ga0501083_0145148 3300049744 Bacteria 1553
227 Ga0501035_0004713 3300049822 Bacteria 12950
228 Ga0501035_0150944 3300049822 Bacteria 2016
229 Ga0501044_0022796 3300049823 Bacteria 6668
230 Ga0501044_0092754 3300049823 Bacteria 3045
231 Ga0501045_0023510 3300049824 Bacteria 4419
232 nmdc:mga00v17_84684_c1 3300050491 Bacteria 1985
233 nmdc:mga05p37_428890_c1 3300050507 Bacteria 1536
234 nmdc:mga0qj67_98975_c1 3300050509 Bacteria 2349
235 Ga0495601_0005668 3300053077 Bacteria 7283
236 Ga0495601_0031374 3300053077 Bacteria 3302
237 Ga0495612_0075142 3300053078 Bacteria 1414
238 Ga0495595_0020204 3300053084 Bacteria 2897
239 Ga0495619_0045765 3300053085 Bacteria 2875
240 Ga0495619_0084481 3300053085 Bacteria 2142
241 Ga0501084_0000041 3300054114 Bacteria 103074
242 Ga0501084_0045032 3300054114 Bacteria 3695
243 Ga0501084_0376286 3300054114 Bacteria 1200
244 Ga0501084_0408966 3300054114 Bacteria 1147
245 Ga0501082_0000849 3300060353 Bacteria 26972
246 Ga0501082_0429331 3300060353 Unclassified 1154
247 Ga0530510_0085160 3300061734 Bacteria 2303
248 Ga0530510_0234852 3300061734 Bacteria 1364
249 2554260937 2554235005 Bacteria 6457341
250 2856747663 2856741275 Bacteria 8096094
251 2891404049 2891395885 Bacteria 9251614
252 2891557742 2891554331 Bacteria 8812224
253 2891565206 2891562705 Bacteria 8039471
254 Ga0501070_0170529
255 Ga0070680_100035981
256 Ga0070680_100122151
257 Ga0070682_100172083
258 Ga0070691_10005209
259 Ga0070668_100147665
260 Ga0070674_100074161
261 Ga0070713_100072148
262 Ga0070681_10019076
263 Ga0070681_10044165
264 Ga0070679_100084524
265 Ga0070684_100103245
266 Ga0070695_100088594
267 Ga0070693_100071133
268 Ga0068855_100018008
269 Ga0068855_100071677
270 Ga0070664_100082333
271 Ga0068856_100134880
272 Ga0068864_100173284
273 Ga0075363_100150765
274 Ga0075364_10030703
275 Ga0070712_100033192
276 Ga0070712_100036599
277 Ga0075362_10048340
278 Ga0075370_10038311
279 Ga0075434_100035988
280 Ga0105240_10197846
281 Ga0105240_10360301
282 Ga0114129_10367665
283 Ga0114129_10562818
284 Ga0105242_10080725
285 Ga0105248_10021034
286 Ga0105238_10061371
287 Ga0099796_10013093
288 Ga0163162_10198004
289 Ga0163162_10330612
290 Ga0157375_10174014
291 Ga0157380_10154726
292 Ga0157376_10065311
293 Ga0157376_10235362
294 Ga0182006_1022483
295 Ga0207692_10069832
296 Ga0207707_10012571
297 Ga0207707_10014586
298 Ga0207707_10097078
299 Ga0207695_10003937
300 Ga0207695_10010665
301 Ga0207695_10245743
302 Ga0207693_10008324
303 Ga0207693_10043023
304 Ga0207693_10106539
305 Ga0207660_10069906
306 Ga0207657_10113610
307 Ga0207652_10154668
308 Ga0207652_10190188
309 Ga0207694_10139704
310 Ga0207659_10082108
311 Ga0207700_10084519
312 Ga0207644_10337044
313 Ga0207669_10005923
314 Ga0207711_10007683
315 Ga0207661_10109292
316 Ga0207667_10153160
317 Ga0207667_10366380
318 Ga0207675_100292025
319 Ga0207698_10090830
320 Ga0265334_10011773
321 Ga0265338_10010507
322 Ga0265338_10108329
323 Ga0307408_100033631
324 Ga0307408_100051898
325 Ga0307405_10026012
326 Ga0307413_10091576
327 Ga0307410_10131160
328 Ga0307406_10046961
329 Ga0307406_10211220
330 Ga0307407_10002376
331 Ga0307412_10114348
332 Ga0307409_100335197
333 Ga0307416_100049341
334 Ga0307411_10018176
335 Ga0307411_10227629
336 Ga0307411_10242830
337 Ga0373944_0010884
338 Ga0373941_0000127
339 Ga0373945_0013094
340 Ga0373943_0000069
341 Ga0373943_0052534
342 Ga0373946_0000991
343 Ga0373961_0025957
344 Ga0373931_0062228
345 Ga0373935_0124739
346 Ga0373927_0023711
347 Ga0373927_0040672
348 Ga0373927_0089809
349 Ga0373947_0000446
350 Ga0373947_0027932
351 Ga0373925_0000377
352 Ga0373925_0000883
353 Ga0395899_0000666
354 Ga0395900_0000016
355 Ga0395900_0368797
356 Ga0395898_0014679
357 Ga0395905_0003448
358 Ga0395905_0005028
359 Ga0395901_0000022
360 Ga0395901_0213886
361 Ga0451791_0235826
362 Ga0439449_0047350
363 Ga0466965_0036964
364 Ga0451576_0393156
365 Ga0466967_0010848
366 Ga0495592_0111377
367 Ga0495629_0086664
368 Ga0495629_0093191
369 Ga0495662_0010437
370 Ga0495664_0000262
371 Ga0495618_0000259
372 Ga0495628_0044997
373 Ga0495630_0005629
374 Ga0495630_0024066
375 Ga0495665_0012194
376 Ga0495640_0000979
377 Ga0495640_0064002
378 Ga0495645_0018175
379 Ga0495634_0010542
380 Ga0495634_0095665
381 Ga0495635_0000280
382 Ga0495624_0004560
383 Ga0495581_0024148
384 Ga0495676_0033179
385 Ga0495684_0001987
386 Ga0495684_0006495
387 Ga0495593_0009762
388 Ga0495602_0125822
389 Ga0496101_0021230
390 Ga0496103_0140899
391 Ga0496104_0018770
392 Ga0496105_0006195
393 Ga0496110_0013005
394 Ga0496114_0010955
395 Ga0496115_0237159
396 Ga0501299_000254
397 Ga0501031_0030376
398 Ga0501031_0058234
399 Ga0501031_0224023
400 Ga0501032_0008464
401 Ga0501032_0079199
402 Ga0501033_0014185
403 Ga0501033_0021545
404 Ga0501034_0000230
405 Ga0501034_0244029
406 Ga0501036_0063368
407 Ga0501036_0099411
408 Ga0501037_0041725
409 Ga0501038_0016890
410 Ga0501038_0028077
411 Ga0501038_0047998
412 Ga0501038_0081696
413 Ga0501038_0119828
414 Ga0501039_0073641
415 Ga0501039_0279434
416 Ga0501040_0029586
417 Ga0501040_0116989
418 Ga0501042_0232458
419 Ga0501043_0015397
420 Ga0501043_0051389
421 Ga0501046_0009009
422 Ga0501046_0025489
423 Ga0501047_0000066
424 Ga0501047_0002523
425 Ga0501047_0035557
426 Ga0501048_0089813
427 Ga0501048_0105531
428 Ga0501048_0204429
429 Ga0501067_0001254
430 Ga0501068_0000060
431 Ga0501069_0012221
432 Ga0501069_0014416
433 Ga0501070_0007235
434 Ga0501070_0039592
435 Ga0501070_0138897
436 Ga0501070_0259083
437 Ga0501071_0094811
438 Ga0501071_0156578
439 Ga0501072_0000024
440 Ga0501072_0012054
441 Ga0501072_0120774
442 Ga0501072_0148627
443 Ga0501072_0257669
444 Ga0501072_0286212
445 Ga0501072_0320870
446 Ga0501073_0010741
447 Ga0501073_0042820
448 Ga0501073_0069561
449 Ga0501073_0084433
450 Ga0501073_0084859
451 Ga0501074_0013114
452 Ga0501075_0051153
453 Ga0501075_0138664
454 Ga0501076_0018564
455 Ga0501076_0034628
456 Ga0501076_0046961
457 Ga0501076_0200375
458 Ga0501076_0283037
459 Ga0501077_0008337
460 Ga0501208_013127
461 Ga0501233_031938
462 Ga0501235_019361
463 Ga0501221_026026
464 Ga0501079_0027021
465 Ga0501079_0030442
466 Ga0501079_0089115
467 Ga0501079_0147725
468 Ga0501079_0191244
469 Ga0501080_0010423
470 Ga0501080_0037032
471 Ga0501080_0083603
472 Ga0501080_0107067
473 Ga0501080_0135548
474 Ga0501080_0203456
475 Ga0501081_0015208
476 Ga0501083_0018112
477 Ga0501083_0073653
478 Ga0501083_0104508
479 Ga0501083_0145148
480 Ga0501035_0004713
481 Ga0501035_0150944
482 Ga0501044_0022796
483 Ga0501044_0092754
484 Ga0501045_0023510
485 nmdc:mga00v17_84684_c1
486 nmdc:mga05p37_428890_c1
487 nmdc:mga0qj67_98975_c1
488 Ga0495601_0005668
489 Ga0495601_0031374
490 Ga0495612_0075142
491 Ga0495595_0020204
492 Ga0495619_0045765
493 Ga0495619_0084481
494 Ga0501084_0000041
495 Ga0501084_0045032
496 Ga0501084_0376286
497 Ga0501084_0408966
498 Ga0501082_0000849
499 Ga0501082_0429331
500 Ga0530510_0085160
501 Ga0530510_0234852
502 2554260937
503 2856747663
504 2891404049
505 2891557742
506 2891565206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

173

377

0.97

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

54

170

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wie-assembly1.cif.gz_B structure of a glucose dehydrogenase t277f mutant in complex with d-glucose and naadp 0.9346 2 347
3wic-assembly1.cif.gz_C structure of a substrate/cofactor-unbound glucose dehydrogenase 0.9261 2 347
2vwg-assembly1.cif.gz_A haloferax mediterranei glucose dehydrogenase in complex with nadp, zn and gluconolactone. 0.9209 1 348
2b5w-assembly1.cif.gz_A-2 crystal structure of d38c glucose dehydrogenase mutant from haloferax mediterranei 0.9169 1 348
2b5v-assembly1.cif.gz_A-2 crystal structure of glucose dehydrogenase from haloferax mediterranei 0.9126 1 348
ID Description Score Start End Superfamily
af_A0A0P0V2P7_13_181_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9423 177 209 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9373 177 208 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9353 176 209 3.50.50.60
af_Q5I0K1_8_223_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9309 177 208 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9298 176 209 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2B8AGF3-F1-model_v4 2-deoxy-scyllo-inosamine dehydrogenase (EC 1.1.1.329) 0.9859 1 167 GO:0016491
AF-A0A4S8P3C3-F1-model_v4 Theronine dehydrogenase 0.9829 1 350 GO:0016491
AF-A0A366LQ45-F1-model_v4 Theronine dehydrogenase 0.9804 1 347 GO:0016491
AF-A0A1C6RSF4-F1-model_v4 Threonine dehydrogenase 0.9801 2 348 GO:0016491
AF-A0A2N8TLP8-F1-model_v4 Theronine dehydrogenase 0.9801 1 347 GO:0016491

Map