F364221

General Info

Members Datasets Scaffolds Average Seq Length
253 138 506 270

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0021524|Ga0373937_0021524_3047_4063
Length 311
Sequence VSSTFRERPLVHDRIRSGCPRALGFSTIALSLNGGTMTTSILRHPAVAGRFYPGVSDDLRAEVHGFLSQARFIDQTPVRALGCIAPHAGYMYSGHVAGAVFSRIEVPRRCIVLCPNHTGVGRSLALMSEGAWQTPLGDVPIDAALAVALKLRFPALHEDSTAHRAEHAAEVELPFLLLRQPKLRFVPIALGTGQFETLDQLGKALADVVAAQSDPILIVASSDMNHYESDAVTRVKDHRAIERILTLDPRGLFDVVTQQDISMCGFGPAVVMLTAARQLGAKAAELVKYATSGDISGDREMVVGYAGVVVV

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
60 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.95
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 26.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0021524 3300036401 Bacteria 5788
2 MBSR1b_contig_6082880 2162886012 Unclassified 1315
3 Ga0065715_10131049 3300005293 Unclassified 2015
4 Ga0070683_100162754 3300005329 Bacteria 2117
5 Ga0068869_100002239 3300005334 Bacteria 11636
6 Ga0070680_100371549 3300005336 Bacteria 1217
7 Ga0068868_100015860 3300005338 Bacteria 5583
8 Ga0070689_100330447 3300005340 Bacteria 1275
9 Ga0070688_100182615 3300005365 Bacteria 1456
10 Ga0070709_10013183 3300005434 Bacteria 4640
11 Ga0070709_10074968 3300005434 Bacteria 2193
12 Ga0070709_10125780 3300005434 Bacteria 1744
13 Ga0070709_10140226 3300005434 Bacteria 1660
14 Ga0070709_10265144 3300005434 Unclassified 1243
15 Ga0070714_100014316 3300005435 Bacteria 6370
16 Ga0070713_100000034 3300005436 Bacteria 86671
17 Ga0070713_100000350 3300005436 Bacteria 30052
18 Ga0070713_100002462 3300005436 Bacteria 12087
19 Ga0070713_100592787 3300005436 Unclassified 1052
20 Ga0070710_10010206 3300005437 Bacteria 4608
21 Ga0070711_100008978 3300005439 Bacteria 6135
22 Ga0070711_100051700 3300005439 Bacteria 2823
23 Ga0070708_100016547 3300005445 Bacteria 6123
24 Ga0070708_100017424 3300005445 Bacteria 5991
25 Ga0070708_100034663 3300005445 Bacteria 4393
26 Ga0070708_100058760 3300005445 Bacteria 3427
27 Ga0070708_100485618 3300005445 Unclassified 1165
28 Ga0070708_100586891 3300005445 Bacteria 1051
29 Ga0070681_10021625 3300005458 Bacteria 6449
30 Ga0070685_10239311 3300005466 Bacteria 1197
31 Ga0070706_100034004 3300005467 Bacteria 4706
32 Ga0070706_100150541 3300005467 Unclassified 2172
33 Ga0070707_100004169 3300005468 Bacteria 13542
34 Ga0070707_100252734 3300005468 Unclassified 1715
35 Ga0070699_100002742 3300005518 Bacteria 15702
36 Ga0070699_100003167 3300005518 Bacteria 14567
37 Ga0070699_100302176 3300005518 Bacteria 1436
38 Ga0070697_100001826 3300005536 Bacteria 16270
39 Ga0070697_100028044 3300005536 Bacteria 4507
40 Ga0068855_100455109 3300005563 Unclassified 1396
41 Ga0068855_100515446 3300005563 Bacteria 1298
42 Ga0068856_100002155 3300005614 Bacteria 20392
43 Ga0068856_100072992 3300005614 Bacteria 3398
44 Ga0068852_100440522 3300005616 Bacteria 1288
45 Ga0068859_100005976 3300005617 Bacteria 12360
46 Ga0068863_100122747 3300005841 Bacteria 2478
47 Ga0068858_100002079 3300005842 Bacteria 20356
48 Ga0068858_100524483 3300005842 Bacteria 1146
49 Ga0068860_100038908 3300005843 Bacteria 4550
50 Ga0068862_100289738 3300005844 Bacteria 1503
51 Ga0070717_10004607 3300006028 Bacteria 9989
52 Ga0070717_10019076 3300006028 Bacteria 5371
53 Ga0070717_10046374 3300006028 Bacteria 3556
54 Ga0070717_10051028 3300006028 Unclassified 3403
55 Ga0070717_10057465 3300006028 Bacteria 3216
56 Ga0070717_10088736 3300006028 Unclassified 2607
57 Ga0070717_10203678 3300006028 Unclassified 1734
58 Ga0070717_10248866 3300006028 Bacteria 1569
59 Ga0070715_10002814 3300006163 Bacteria 5417
60 Ga0070716_100000144 3300006173 Bacteria 28499
61 Ga0070716_100003525 3300006173 Bacteria 7378
62 Ga0070716_100013656 3300006173 Bacteria 4144
63 Ga0070716_100091943 3300006173 Bacteria 1838
64 Ga0070716_100184679 3300006173 Bacteria 1372
65 Ga0070712_100000020 3300006175 Bacteria 84120
66 Ga0070712_100000216 3300006175 Bacteria 32440
67 Ga0070712_100001066 3300006175 Bacteria 16570
68 Ga0070712_100001323 3300006175 Bacteria 15013
69 Ga0070712_100036465 3300006175 Bacteria 3346
70 Ga0070712_100142173 3300006175 Bacteria 1833
71 Ga0070712_100203507 3300006175 Unclassified 1557
72 Ga0097621_100398792 3300006237 Unclassified 1231
73 Ga0068871_100020657 3300006358 Bacteria 5049
74 Ga0068871_100125142 3300006358 Bacteria 2175
75 Ga0068871_100330821 3300006358 Bacteria 1344
76 Ga0075428_100306750 3300006844 Bacteria 1706
77 Ga0075431_100129085 3300006847 Bacteria 2608
78 Ga0075434_100001538 3300006871 Bacteria 19521
79 Ga0075434_100005747 3300006871 Bacteria 11326
80 Ga0075434_100070488 3300006871 Bacteria 3486
81 Ga0075434_100144788 3300006871 Unclassified 2396
82 Ga0068865_100034779 3300006881 Bacteria 3383
83 Ga0097620_100005976 3300006931 Bacteria 12360
84 Ga0075435_100007490 3300007076 Bacteria 7786
85 Ga0075435_100061307 3300007076 Bacteria 3051
86 Ga0075435_100448035 3300007076 Unclassified 1113
87 Ga0099795_10110580 3300007788 Bacteria 1088
88 Ga0105240_10102771 3300009093 Unclassified 3473
89 Ga0111539_10546993 3300009094 Unclassified 1349
90 Ga0105245_10104662 3300009098 Bacteria 2624
91 Ga0105245_10612377 3300009098 Unclassified 1116
92 Ga0114129_10001096 3300009147 Bacteria 35569
93 Ga0114129_10037015 3300009147 Bacteria 6889
94 Ga0114129_10042986 3300009147 Bacteria 6360
95 Ga0105242_10515433 3300009176 Bacteria 1140
96 Ga0105237_10052388 3300009545 Unclassified 4097
97 Ga0105237_10198576 3300009545 Unclassified 2005
98 Ga0105237_10952770 3300009545 Unclassified 865
99 Ga0105239_10008862 3300010375 Bacteria 11387
100 Ga0157373_10236173 3300013100 Bacteria 1292
101 Ga0157369_10050350 3300013105 Bacteria 4512
102 Ga0157369_10383903 3300013105 Unclassified 1458
103 Ga0157374_10041013 3300013296 Unclassified 4263
104 Ga0157374_10048113 3300013296 Bacteria 3956
105 Ga0157374_10269129 3300013296 Bacteria 1680
106 Ga0157378_10056804 3300013297 Bacteria 3488
107 Ga0163162_10005409 3300013306 Bacteria 12337
108 Ga0157372_10166268 3300013307 Bacteria 2551
109 Ga0157375_10076662 3300013308 Bacteria 3371
110 Ga0157375_10586305 3300013308 Unclassified 1275
111 Ga0157379_10249213 3300014968 Bacteria 1612
112 Ga0157379_10425703 3300014968 Bacteria 1223
113 Ga0157376_10018156 3300014969 Bacteria 5384
114 Ga0224569_103756 3300022732 Unclassified 1180
115 Ga0224572_1000115 3300024225 Bacteria 6341
116 Ga0224572_1000858 3300024225 Bacteria 4078
117 Ga0228598_1000117 3300024227 Bacteria 13477
118 Ga0228598_1003361 3300024227 Unclassified 3445
119 Ga0207692_10020269 3300025898 Bacteria 3021
120 Ga0207692_10201251 3300025898 Bacteria 1171
121 Ga0207647_10005105 3300025904 Bacteria 9671
122 Ga0207685_10009430 3300025905 Bacteria 2835
123 Ga0207699_10000982 3300025906 Bacteria 13552
124 Ga0207699_10004301 3300025906 Bacteria 6810
125 Ga0207699_10047733 3300025906 Bacteria 2512
126 Ga0207699_10060922 3300025906 Bacteria 2268
127 Ga0207699_10132856 3300025906 Bacteria 1626
128 Ga0207684_10003338 3300025910 Bacteria 15748
129 Ga0207684_10123360 3300025910 Unclassified 2222
130 Ga0207707_10000209 3300025912 Bacteria 62333
131 Ga0207695_10133400 3300025913 Unclassified 2439
132 Ga0207693_10000080 3300025915 Bacteria 86060
133 Ga0207693_10000458 3300025915 Bacteria 37236
134 Ga0207693_10002698 3300025915 Bacteria 15384
135 Ga0207693_10008218 3300025915 Bacteria 8547
136 Ga0207693_10047417 3300025915 Bacteria 3376
137 Ga0207663_10010694 3300025916 Unclassified 4896
138 Ga0207663_10029786 3300025916 Unclassified 3211
139 Ga0207663_10034364 3300025916 Bacteria 3031
140 Ga0207663_10041178 3300025916 Bacteria 2813
141 Ga0207646_10005902 3300025922 Bacteria 12782
142 Ga0207646_10022810 3300025922 Bacteria 5756
143 Ga0207646_10213556 3300025922 Bacteria 1742
144 Ga0207700_10000352 3300025928 Bacteria 26923
145 Ga0207700_10001059 3300025928 Bacteria 15841
146 Ga0207700_10015708 3300025928 Bacteria 5006
147 Ga0207700_10036331 3300025928 Bacteria 3557
148 Ga0207700_10273200 3300025928 Bacteria 1451
149 Ga0207664_10000438 3300025929 Bacteria 29777
150 Ga0207664_10005811 3300025929 Bacteria 8437
151 Ga0207664_10068398 3300025929 Bacteria 2853
152 Ga0207670_10431705 3300025936 Bacteria 1059
153 Ga0207704_10040840 3300025938 Bacteria 2715
154 Ga0207665_10000348 3300025939 Bacteria 32064
155 Ga0207665_10008511 3300025939 Bacteria 6755
156 Ga0207665_10008546 3300025939 Bacteria 6738
157 Ga0207665_10016441 3300025939 Bacteria 4857
158 Ga0207665_10060982 3300025939 Bacteria 2555
159 Ga0207665_10065278 3300025939 Bacteria 2475
160 Ga0207689_10001816 3300025942 Bacteria 20159
161 Ga0207667_10383424 3300025949 Unclassified 1432
162 Ga0207703_10001518 3300026035 Bacteria 21118
163 Ga0207702_10000425 3300026078 Bacteria 48324
164 Ga0207702_10363069 3300026078 Bacteria 1388
165 Ga0207641_10232736 3300026088 Bacteria 1713
166 Ga0207698_10026420 3300026142 Bacteria 4107
167 Ga0265356_1012708 3300028017 Unclassified 923
168 Ga0268265_10224829 3300028380 Bacteria 1645
169 Ga0268264_10121110 3300028381 Bacteria 2306
170 Ga0265338_10026728 3300028800 Bacteria 5808
171 Ga0265338_10046761 3300028800 Unclassified 3961
172 Ga0265762_1007934 3300030760 Bacteria 1890
173 Ga0265762_1009419 3300030760 Unclassified 1741
174 Ga0265760_10003061 3300031090 Bacteria 4882
175 Ga0265760_10054067 3300031090 Bacteria 1212
176 Ga0265316_10041418 3300031344 Bacteria 3686
177 Ga0265316_10135997 3300031344 Unclassified 1849
178 Ga0265342_10031095 3300031712 Bacteria 3303
179 Ga0316583_10011704 3300032133 Unclassified 3165
180 Ga0373938_0035752 3300034957 Unclassified 1084
181 Ga0373934_0017154 3300035086 Bacteria 2761
182 Ga0373951_0043224 3300035091 Unclassified 1092
183 Ga0373936_0000154 3300035113 Bacteria 23016
184 Ga0373936_0010113 3300035113 Unclassified 3564
185 Ga0373941_0176586 3300035115 Unclassified 799
186 Ga0373945_0006238 3300035116 Bacteria 3839
187 Ga0373945_0077231 3300035116 Unclassified 1270
188 Ga0373954_0158608 3300035118 Unclassified 1106
189 Ga0373956_0020920 3300035119 Unclassified 2789
190 Ga0373943_0000182 3300035170 Bacteria 25116
191 Ga0373943_0026553 3300035170 Bacteria 2714
192 Ga0373924_0004184 3300035410 Bacteria 5026
193 Ga0373935_0000629 3300035692 Bacteria 18513
194 Ga0373935_0005866 3300035692 Bacteria 7276
195 Ga0373927_0007252 3300035695 Bacteria 7521
196 Ga0373927_0279556 3300035695 Unclassified 1098
197 Ga0373947_0001119 3300035725 Bacteria 16473
198 Ga0373947_0190556 3300035725 Unclassified 1338
199 Ga0373937_0367594 3300036401 Unclassified 1364
200 Ga0373937_0369527 3300036401 Bacteria 1360
201 Ga0373937_0390827 3300036401 Unclassified 1319
202 Ga0373925_0002668 3300037068 Bacteria 14165
203 Ga0373925_0072823 3300037068 Bacteria 2599
204 Ga0436365_1051215 3300039437 Unclassified 920
205 Ga0436361_1067636 3300039447 Bacteria 1226
206 Ga0451576_0166907 3300045051 Unclassified 2297
207 Ga0495603_0084225 3300046455 Unclassified 1862
208 Ga0495629_0011586 3300046459 Bacteria 6403
209 Ga0495580_0000262 3300046472 Bacteria 42111
210 Ga0495580_0006573 3300046472 Bacteria 9451
211 Ga0495580_0285383 3300046472 Unclassified 1126
212 Ga0495580_0296823 3300046472 Unclassified 1101
213 Ga0495580_0301578 3300046472 Bacteria 1091
214 Ga0495580_0438041 3300046472 Unclassified 878
215 Ga0495582_0007634 3300046473 Bacteria 5980
216 Ga0495664_0110626 3300046477 Unclassified 1658
217 Ga0495630_0027232 3300046517 Bacteria 4238
218 Ga0495630_0039205 3300046517 Bacteria 3543
219 Ga0495665_0079066 3300046531 Bacteria 1730
220 Ga0495586_0109190 3300046535 Bacteria 1539
221 Ga0495645_0040203 3300046543 Bacteria 3412
222 Ga0495645_0081841 3300046543 Unclassified 2316
223 Ga0495645_0117008 3300046543 Bacteria 1881
224 Ga0495599_0055430 3300046678 Bacteria 2483
225 Ga0495647_0113471 3300046681 Unclassified 1133
226 Ga0495658_0004857 3300046683 Bacteria 6594
227 Ga0495658_0007552 3300046683 Bacteria 5389
228 Ga0495669_0052763 3300046684 Unclassified 1828
229 Ga0495613_0027332 3300046689 Unclassified 4246
230 Ga0495624_0215650 3300046690 Unclassified 1164
231 Ga0495604_0023021 3300047317 Bacteria 4972
232 Ga0495674_0103465 3300047319 Unclassified 2421
233 Ga0495684_0176261 3300047471 Unclassified 1587
234 Ga0495602_0021560 3300048088 Bacteria 6337
235 Ga0495602_0297244 3300048088 Unclassified 1183
236 Ga0496100_0501161 3300048903 Bacteria 935
237 Ga0496105_0120868 3300048908 Bacteria 2160
238 Ga0496109_0227648 3300048912 Bacteria 1754
239 Ga0496110_0948603 3300048913 Bacteria 767
240 Ga0496112_0000854 3300048915 Bacteria 21742
241 Ga0496112_0020073 3300048915 Bacteria 6327
242 Ga0496112_0110384 3300048915 Unclassified 2720
243 Ga0496115_0010821 3300048918 Bacteria 6823
244 Ga0496115_0199193 3300048918 Bacteria 1654
245 Ga0496115_0291922 3300048918 Unclassified 1337
246 nmdc:mga05p37_239417_c1 3300050507 Unclassified 2183
247 nmdc:mga05p37_48941_c1 3300050507 Bacteria 5198
248 nmdc:mga06r32_81845_c1 3300050510 Bacteria 3145
249 nmdc:mga0n895_80709_c1 3300050512 Unclassified 3241
250 nmdc:mga0n895_924321_c1 3300050512 Unclassified 857
251 nmdc:mga0rr50_428076_c1 3300050513 Unclassified 1120
252 nmdc:mga0rr50_5786_c1 3300050513 Bacteria 7424
253 nmdc:mga0a205_137586_c1 3300050515 Bacteria 2343
254 Ga0373937_0021524
255 MBSR1b_contig_6082880
256 Ga0065715_10131049
257 Ga0070683_100162754
258 Ga0068869_100002239
259 Ga0070680_100371549
260 Ga0068868_100015860
261 Ga0070689_100330447
262 Ga0070688_100182615
263 Ga0070709_10013183
264 Ga0070709_10074968
265 Ga0070709_10125780
266 Ga0070709_10140226
267 Ga0070709_10265144
268 Ga0070714_100014316
269 Ga0070713_100000034
270 Ga0070713_100000350
271 Ga0070713_100002462
272 Ga0070713_100592787
273 Ga0070710_10010206
274 Ga0070711_100008978
275 Ga0070711_100051700
276 Ga0070708_100016547
277 Ga0070708_100017424
278 Ga0070708_100034663
279 Ga0070708_100058760
280 Ga0070708_100485618
281 Ga0070708_100586891
282 Ga0070681_10021625
283 Ga0070685_10239311
284 Ga0070706_100034004
285 Ga0070706_100150541
286 Ga0070707_100004169
287 Ga0070707_100252734
288 Ga0070699_100002742
289 Ga0070699_100003167
290 Ga0070699_100302176
291 Ga0070697_100001826
292 Ga0070697_100028044
293 Ga0068855_100455109
294 Ga0068855_100515446
295 Ga0068856_100002155
296 Ga0068856_100072992
297 Ga0068852_100440522
298 Ga0068859_100005976
299 Ga0068863_100122747
300 Ga0068858_100002079
301 Ga0068858_100524483
302 Ga0068860_100038908
303 Ga0068862_100289738
304 Ga0070717_10004607
305 Ga0070717_10019076
306 Ga0070717_10046374
307 Ga0070717_10051028
308 Ga0070717_10057465
309 Ga0070717_10088736
310 Ga0070717_10203678
311 Ga0070717_10248866
312 Ga0070715_10002814
313 Ga0070716_100000144
314 Ga0070716_100003525
315 Ga0070716_100013656
316 Ga0070716_100091943
317 Ga0070716_100184679
318 Ga0070712_100000020
319 Ga0070712_100000216
320 Ga0070712_100001066
321 Ga0070712_100001323
322 Ga0070712_100036465
323 Ga0070712_100142173
324 Ga0070712_100203507
325 Ga0097621_100398792
326 Ga0068871_100020657
327 Ga0068871_100125142
328 Ga0068871_100330821
329 Ga0075428_100306750
330 Ga0075431_100129085
331 Ga0075434_100001538
332 Ga0075434_100005747
333 Ga0075434_100070488
334 Ga0075434_100144788
335 Ga0068865_100034779
336 Ga0097620_100005976
337 Ga0075435_100007490
338 Ga0075435_100061307
339 Ga0075435_100448035
340 Ga0099795_10110580
341 Ga0105240_10102771
342 Ga0111539_10546993
343 Ga0105245_10104662
344 Ga0105245_10612377
345 Ga0114129_10001096
346 Ga0114129_10037015
347 Ga0114129_10042986
348 Ga0105242_10515433
349 Ga0105237_10052388
350 Ga0105237_10198576
351 Ga0105237_10952770
352 Ga0105239_10008862
353 Ga0157373_10236173
354 Ga0157369_10050350
355 Ga0157369_10383903
356 Ga0157374_10041013
357 Ga0157374_10048113
358 Ga0157374_10269129
359 Ga0157378_10056804
360 Ga0163162_10005409
361 Ga0157372_10166268
362 Ga0157375_10076662
363 Ga0157375_10586305
364 Ga0157379_10249213
365 Ga0157379_10425703
366 Ga0157376_10018156
367 Ga0224569_103756
368 Ga0224572_1000115
369 Ga0224572_1000858
370 Ga0228598_1000117
371 Ga0228598_1003361
372 Ga0207692_10020269
373 Ga0207692_10201251
374 Ga0207647_10005105
375 Ga0207685_10009430
376 Ga0207699_10000982
377 Ga0207699_10004301
378 Ga0207699_10047733
379 Ga0207699_10060922
380 Ga0207699_10132856
381 Ga0207684_10003338
382 Ga0207684_10123360
383 Ga0207707_10000209
384 Ga0207695_10133400
385 Ga0207693_10000080
386 Ga0207693_10000458
387 Ga0207693_10002698
388 Ga0207693_10008218
389 Ga0207693_10047417
390 Ga0207663_10010694
391 Ga0207663_10029786
392 Ga0207663_10034364
393 Ga0207663_10041178
394 Ga0207646_10005902
395 Ga0207646_10022810
396 Ga0207646_10213556
397 Ga0207700_10000352
398 Ga0207700_10001059
399 Ga0207700_10015708
400 Ga0207700_10036331
401 Ga0207700_10273200
402 Ga0207664_10000438
403 Ga0207664_10005811
404 Ga0207664_10068398
405 Ga0207670_10431705
406 Ga0207704_10040840
407 Ga0207665_10000348
408 Ga0207665_10008511
409 Ga0207665_10008546
410 Ga0207665_10016441
411 Ga0207665_10060982
412 Ga0207665_10065278
413 Ga0207689_10001816
414 Ga0207667_10383424
415 Ga0207703_10001518
416 Ga0207702_10000425
417 Ga0207702_10363069
418 Ga0207641_10232736
419 Ga0207698_10026420
420 Ga0265356_1012708
421 Ga0268265_10224829
422 Ga0268264_10121110
423 Ga0265338_10026728
424 Ga0265338_10046761
425 Ga0265762_1007934
426 Ga0265762_1009419
427 Ga0265760_10003061
428 Ga0265760_10054067
429 Ga0265316_10041418
430 Ga0265316_10135997
431 Ga0265342_10031095
432 Ga0316583_10011704
433 Ga0373938_0035752
434 Ga0373934_0017154
435 Ga0373951_0043224
436 Ga0373936_0000154
437 Ga0373936_0010113
438 Ga0373941_0176586
439 Ga0373945_0006238
440 Ga0373945_0077231
441 Ga0373954_0158608
442 Ga0373956_0020920
443 Ga0373943_0000182
444 Ga0373943_0026553
445 Ga0373924_0004184
446 Ga0373935_0000629
447 Ga0373935_0005866
448 Ga0373927_0007252
449 Ga0373927_0279556
450 Ga0373947_0001119
451 Ga0373947_0190556
452 Ga0373937_0367594
453 Ga0373937_0369527
454 Ga0373937_0390827
455 Ga0373925_0002668
456 Ga0373925_0072823
457 Ga0436365_1051215
458 Ga0436361_1067636
459 Ga0451576_0166907
460 Ga0495603_0084225
461 Ga0495629_0011586
462 Ga0495580_0000262
463 Ga0495580_0006573
464 Ga0495580_0285383
465 Ga0495580_0296823
466 Ga0495580_0301578
467 Ga0495580_0438041
468 Ga0495582_0007634
469 Ga0495664_0110626
470 Ga0495630_0027232
471 Ga0495630_0039205
472 Ga0495665_0079066
473 Ga0495586_0109190
474 Ga0495645_0040203
475 Ga0495645_0081841
476 Ga0495645_0117008
477 Ga0495599_0055430
478 Ga0495647_0113471
479 Ga0495658_0004857
480 Ga0495658_0007552
481 Ga0495669_0052763
482 Ga0495613_0027332
483 Ga0495624_0215650
484 Ga0495604_0023021
485 Ga0495674_0103465
486 Ga0495684_0176261
487 Ga0495602_0021560
488 Ga0495602_0297244
489 Ga0496100_0501161
490 Ga0496105_0120868
491 Ga0496109_0227648
492 Ga0496110_0948603
493 Ga0496112_0000854
494 Ga0496112_0020073
495 Ga0496112_0110384
496 Ga0496115_0010821
497 Ga0496115_0199193
498 Ga0496115_0291922
499 nmdc:mga05p37_239417_c1
500 nmdc:mga05p37_48941_c1
501 nmdc:mga06r32_81845_c1
502 nmdc:mga0n895_80709_c1
503 nmdc:mga0n895_924321_c1
504 nmdc:mga0rr50_428076_c1
505 nmdc:mga0rr50_5786_c1
506 nmdc:mga0a205_137586_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01875

Memo

Memo-like protein

44

309

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8912 1 267
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8848 1 267
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.8836 1 267
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.8774 1 267
3vsh-assembly1.cif.gz_C crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase 0.7019 38 267
ID Description Score Start End Superfamily
af_Q57846_3_287_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.938 1 268 3.40.830.10
af_Q57846_3_287_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9346 1 268 3.40.830.10
af_Q54NZ1_1_286_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9091 1 266 3.40.830.10
af_Q9VG04_2_293_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9009 1 268 3.40.830.10
af_C0H4B1_3_295_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8999 1 267 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A3B9VDK3-F1-model_v4 AmmeMemoRadiSam system protein B 1.001 178 268
AF-A0A2V9N004-F1-model_v4 AmmeMemoRadiSam system protein B 0.9998 176 268
AF-A0A3M1FZJ9-F1-model_v4 AmmeMemoRadiSam system protein B 0.9972 184 268
AF-A0A3D4P0X3-F1-model_v4 AmmeMemoRadiSam system protein B 0.9967 177 268
AF-A0A6N9TR13-F1-model_v4 AmmeMemoRadiSam system protein B 0.9958 179 268

Map