F364172

General Info

Members Datasets Scaffolds Average Seq Length
253 164 506 323

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100147022|Ga0307408_1001470222
Length 366
Sequence VVDPPQFPLQEAGTGNDYTCRIRPHQIGPESSRQPDAPYSLYTMTLAHPENWPVLVIKGGVDDELLRDFAALAAAAEESDGNPPLSEQTFVTLRAGESGSHSLLALALYAPDEDSDPATAQDLAGFAVVVEELDGTGVLEVAVHPSYRNQGVADRLVATLKTTRGFDGLTAWSHGNHEAAADLAAKYGYAPVRELWKMRLTTSTAELPDAGLPDQVALRAFVPGQDEEAWLAANKAAFSHHPEQGNMTRQDLDARMAEDWFDPAGFLLAVDPAGRILGFHWTKVHPRHGSHPAIGEVYVVGVTPEAQGMGLGKALTVAGIKYLQDKGLHAVMLYTDADNAPAVSLYRGLGFTRWDADVMYGPKNGG

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
52 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
58 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
59 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
60 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
63 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
64 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
67 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
70 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
71 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
72 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
130 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
131 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
132 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
133 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
134 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
135 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
136 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
137 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
138 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
139 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
140 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
141 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
142 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
143 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
144 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
145 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
146 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
147 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
148 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
149 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
150 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
151 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
152 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
153 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
154 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
155 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
156 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
157 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
158 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
159 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
160 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
161 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
162 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
163 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
164 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.38
Metatranscriptomes 0.4
Isolates 14.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 8.7
Rhizosphere 83.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100147022 3300031548 Bacteria 1856
2 rootH2_10126035 3300003320 Bacteria 2086
3 Ga0065714_10005033 3300005288 Bacteria 5541
4 Ga0070676_10023078 3300005328 Bacteria 3495
5 Ga0070670_100008842 3300005331 Bacteria 8598
6 Ga0070670_100142974 3300005331 Bacteria 2069
7 Ga0070677_10001080 3300005333 Bacteria 8792
8 Ga0070669_100033504 3300005353 Bacteria 3716
9 Ga0070674_100008293 3300005356 Bacteria 6181
10 Ga0070672_100022503 3300005543 Bacteria 4631
11 Ga0081455_10000954 3300005937 Bacteria 37046
12 Ga0081455_10014888 3300005937 Bacteria 7582
13 Ga0075428_100044757 3300006844 Bacteria 4863
14 Ga0075429_100238504 3300006880 Bacteria 1593
15 Ga0105244_10033464 3300009036 Bacteria 2709
16 Ga0105245_10264439 3300009098 Bacteria 1675
17 Ga0105243_10013760 3300009148 Bacteria 6122
18 Ga0105243_10307020 3300009148 Bacteria 1440
19 Ga0105246_10002960 3300011119 Bacteria 10295
20 Ga0105246_10009827 3300011119 Bacteria 5900
21 Ga0105246_10059252 3300011119 Bacteria 2655
22 Ga0105246_10091620 3300011119 Bacteria 2192
23 Ga0157373_10030758 3300013100 Bacteria 3863
24 Ga0157369_10269809 3300013105 Bacteria 1773
25 Ga0163162_10272525 3300013306 Bacteria 1824
26 Ga0157375_10294034 3300013308 Bacteria 1787
27 Ga0206353_11366877 3300020082 Bacteria 2792
28 Ga0209148_1004751 3300025254 Bacteria 3263
29 Ga0209025_1001093 3300025294 Bacteria 39190
30 Ga0209051_1003336 3300025303 Bacteria 10599
31 Ga0207697_10002399 3300025315 Bacteria 9764
32 Ga0207655_1002350 3300025728 Bacteria 15457
33 Ga0207655_1006184 3300025728 Bacteria 7977
34 Ga0207655_1009332 3300025728 Bacteria 6103
35 Ga0207680_10113840 3300025903 Bacteria 1759
36 Ga0207645_10000903 3300025907 Bacteria 24610
37 Ga0207681_10173641 3300025923 Bacteria 1635
38 Ga0207650_10003570 3300025925 Bacteria 10666
39 Ga0207644_10006174 3300025931 Bacteria 7812
40 Ga0207709_10150408 3300025935 Bacteria 1612
41 Ga0207669_10105950 3300025937 Bacteria 1871
42 Ga0207691_10000137 3300025940 Bacteria 66901
43 Ga0207651_10061963 3300025960 Bacteria 2604
44 Ga0207658_10203784 3300025986 Bacteria 1653
45 Ga0207683_10007029 3300026121 Bacteria 9651
46 Ga0207428_10013536 3300027907 Bacteria 7122
47 Ga0268266_10060138 3300028379 Bacteria 3275
48 Ga0265327_10010431 3300031251 Bacteria 6538
49 Ga0307408_100016521 3300031548 Bacteria 4928
50 Ga0307408_100044326 3300031548 Bacteria 3169
51 Ga0307408_100084626 3300031548 Bacteria 2379
52 Ga0307408_100132033 3300031548 Bacteria 1949
53 Ga0307408_100152000 3300031548 Bacteria 1828
54 Ga0307408_100484442 3300031548 Bacteria 1080
55 Ga0307405_10023192 3300031731 Bacteria 3523
56 Ga0307405_10056358 3300031731 Bacteria 2464
57 Ga0307405_10247427 3300031731 Bacteria 1324
58 Ga0307405_10262205 3300031731 Bacteria 1291
59 Ga0307405_10372896 3300031731 Bacteria 1108
60 Ga0307413_10065124 3300031824 Bacteria 2268
61 Ga0307413_10303826 3300031824 Bacteria 1211
62 Ga0307410_10009395 3300031852 Bacteria 5483
63 Ga0307410_10040171 3300031852 Bacteria 3077
64 Ga0307410_10041758 3300031852 Bacteria 3026
65 Ga0307410_10059278 3300031852 Bacteria 2613
66 Ga0307410_10075377 3300031852 Bacteria 2351
67 Ga0307410_10242693 3300031852 Bacteria 1397
68 Ga0307406_10092973 3300031901 Bacteria 2035
69 Ga0307407_10004893 3300031903 Bacteria 5748
70 Ga0307407_10008405 3300031903 Bacteria 4735
71 Ga0307407_10017059 3300031903 Bacteria 3632
72 Ga0307407_10077319 3300031903 Bacteria 2001
73 Ga0307407_10087994 3300031903 Bacteria 1897
74 Ga0307412_10027144 3300031911 Bacteria 3566
75 Ga0307412_10097351 3300031911 Bacteria 2073
76 Ga0307412_10119947 3300031911 Bacteria 1892
77 Ga0307412_10289066 3300031911 Bacteria 1290
78 Ga0307409_100002076 3300031995 Bacteria 10299
79 Ga0307409_100009072 3300031995 Bacteria 6087
80 Ga0307409_100016595 3300031995 Bacteria 4878
81 Ga0307409_100150209 3300031995 Bacteria 2021
82 Ga0307416_100012603 3300032002 Bacteria 5706
83 Ga0307416_100022431 3300032002 Bacteria 4557
84 Ga0307416_100062496 3300032002 Bacteria 3045
85 Ga0307416_100120250 3300032002 Bacteria 2338
86 Ga0307416_100122325 3300032002 Bacteria 2322
87 Ga0307416_100425714 3300032002 Bacteria 1373
88 Ga0307414_10018754 3300032004 Bacteria 4269
89 Ga0307414_10062492 3300032004 Bacteria 2643
90 Ga0307414_10113669 3300032004 Bacteria 2067
91 Ga0307415_100015313 3300032126 Bacteria 4537
92 Ga0307415_100078105 3300032126 Bacteria 2353
93 Ga0307415_100102393 3300032126 Bacteria 2104
94 Ga0307415_100205681 3300032126 Bacteria 1566
95 Ga0373962_0001801 3300035242 Bacteria 5104
96 Ga0395899_0002972 3300037312 Bacteria 13566
97 Ga0395899_0039553 3300037312 Bacteria 3529
98 Ga0395899_0051770 3300037312 Bacteria 3046
99 Ga0395900_0010538 3300037418 Bacteria 9456
100 Ga0395900_0028430 3300037418 Bacteria 5726
101 Ga0395900_0751631 3300037418 Bacteria 905
102 Ga0395898_0022871 3300037466 Bacteria 6322
103 Ga0395898_0031398 3300037466 Bacteria 5307
104 Ga0395898_0031873 3300037466 Bacteria 5264
105 Ga0395898_0047394 3300037466 Bacteria 4218
106 Ga0395898_0062621 3300037466 Bacteria 3612
107 Ga0395898_0114792 3300037466 Bacteria 2580
108 Ga0395898_0121901 3300037466 Bacteria 2498
109 Ga0436364_0652293 3300037853 Bacteria 8802
110 Ga0395901_0000906 3300038443 Bacteria 32585
111 Ga0395901_0226573 3300038443 Bacteria 1952
112 Ga0439436_0011432 3300041404 Bacteria 2697
113 Ga0439436_0040143 3300041404 Bacteria 1342
114 Ga0439438_032318 3300041405 Bacteria 1388
115 Ga0439466_0007041 3300041411 Bacteria 4260
116 Ga0439466_0020360 3300041411 Bacteria 2364
117 Ga0439466_0026595 3300041411 Bacteria 2010
118 Ga0451797_0262508 3300041453 Bacteria 1258
119 Ga0439433_0007536 3300041999 Bacteria 2350
120 Ga0439433_0014277 3300041999 Bacteria 1748
121 Ga0439442_000050 3300042002 Bacteria 26935
122 Ga0439442_000355 3300042002 Bacteria 10924
123 Ga0439442_000527 3300042002 Bacteria 8486
124 Ga0439442_004882 3300042002 Bacteria 2672
125 Ga0439442_016765 3300042002 Bacteria 1511
126 Ga0439445_0053189 3300042004 Bacteria 1097
127 Ga0439432_012880 3300042006 Bacteria 2848
128 Ga0439449_0007613 3300042007 Bacteria 4116
129 Ga0439449_0009681 3300042007 Bacteria 3647
130 Ga0439454_004601 3300042011 Bacteria 1601
131 Ga0439457_008356 3300042014 Bacteria 2446
132 Ga0439457_034814 3300042014 Bacteria 1119
133 Ga0439462_0029051 3300042015 Bacteria 1462
134 Ga0450919_001050 3300042121 Bacteria 3578
135 Ga0450923_002311 3300042125 Bacteria 2716
136 Ga0450907_000103 3300042146 Bacteria 32604
137 Ga0450909_000023 3300042185 Bacteria 11784
138 Ga0439434_0000050 3300042435 Bacteria 28880
139 Ga0439434_0009417 3300042435 Bacteria 2871
140 Ga0439434_0010951 3300042435 Bacteria 2679
141 Ga0450918_000206 3300042531 Bacteria 13400
142 Ga0450918_001251 3300042531 Bacteria 5159
143 Ga0466972_0110854 3300044658 Bacteria 1297
144 Ga0466965_0024028 3300044683 Bacteria 2947
145 Ga0466966_0076809 3300044684 Bacteria 2085
146 Ga0466961_0186672 3300044693 Bacteria 1286
147 Ga0466970_0051659 3300044765 Bacteria 2194
148 Ga0466960_0139372 3300044901 Bacteria 1287
149 Ga0495629_0043078 3300046459 Bacteria 3170
150 Ga0495653_0004336 3300046463 Bacteria 11475
151 Ga0495650_0009629 3300046471 Bacteria 5478
152 Ga0495580_0025477 3300046472 Bacteria 4323
153 Ga0495580_0042210 3300046472 Bacteria 3250
154 Ga0495582_0054453 3300046473 Bacteria 2205
155 Ga0495582_0072781 3300046473 Bacteria 1902
156 Ga0495639_0012022 3300046475 Bacteria 3732
157 Ga0495639_0090940 3300046475 Bacteria 1432
158 Ga0495664_0005892 3300046477 Bacteria 6744
159 Ga0495643_0093865 3300046522 Bacteria 1545
160 Ga0495665_0029605 3300046531 Bacteria 2933
161 Ga0495586_0002636 3300046535 Bacteria 9702
162 Ga0495586_0011070 3300046535 Bacteria 4792
163 Ga0495586_0052022 3300046535 Bacteria 2217
164 Ga0495586_0061154 3300046535 Bacteria 2049
165 Ga0495587_0020066 3300046536 Bacteria 4129
166 Ga0495645_0003079 3300046543 Bacteria 11297
167 Ga0495667_0003775 3300046559 Bacteria 10175
168 Ga0495656_0001203 3300046615 Bacteria 8433
169 Ga0495668_0075040 3300046616 Bacteria 1857
170 Ga0495635_0025052 3300046663 Bacteria 4157
171 Ga0495659_0085188 3300046664 Bacteria 1205
172 Ga0495588_0012795 3300046674 Bacteria 3978
173 Ga0495588_0126844 3300046674 Bacteria 1346
174 Ga0495657_0039781 3300046675 Bacteria 3229
175 Ga0495670_0000473 3300046691 Bacteria 19093
176 Ga0495670_0060154 3300046691 Bacteria 1908
177 Ga0495649_0139115 3300046694 Bacteria 1279
178 Ga0495600_0003927 3300046809 Bacteria 8832
179 Ga0495600_0112268 3300046809 Bacteria 1775
180 Ga0495581_0003977 3300047315 Bacteria 8515
181 Ga0495581_0008036 3300047315 Bacteria 6109
182 Ga0495581_0008505 3300047315 Bacteria 5952
183 Ga0495581_0066312 3300047315 Bacteria 2087
184 Ga0495680_0035354 3300047322 Bacteria 4025
185 Ga0495675_0009576 3300047444 Bacteria 6034
186 Ga0495677_0016839 3300047445 Bacteria 2651
187 Ga0495677_0036916 3300047445 Bacteria 1785
188 Ga0495593_0094347 3300047673 Bacteria 1539
189 Ga0496101_0141238 3300048904 Bacteria 1835
190 Ga0496101_0335519 3300048904 Bacteria 1187
191 Ga0496102_0061771 3300048905 Bacteria 3430
192 Ga0496102_0362550 3300048905 Bacteria 1364
193 Ga0496103_0140235 3300048906 Bacteria 1545
194 Ga0496103_0227591 3300048906 Bacteria 1199
195 Ga0496104_0119895 3300048907 Bacteria 2526
196 Ga0496105_0114199 3300048908 Bacteria 2227
197 Ga0496106_0008783 3300048909 Bacteria 7467
198 Ga0496107_0005422 3300048910 Bacteria 8731
199 Ga0496107_0258556 3300048910 Bacteria 1296
200 Ga0496108_0060333 3300048911 Bacteria 3191
201 Ga0496108_0110597 3300048911 Bacteria 2349
202 Ga0496110_0096468 3300048913 Bacteria 2649
203 Ga0496111_0202977 3300048914 Bacteria 1473
204 Ga0496112_0020941 3300048915 Bacteria 6209
205 Ga0496112_0112904 3300048915 Bacteria 2688
206 Ga0496114_0065501 3300048917 Bacteria 3044
207 Ga0496114_0288168 3300048917 Bacteria 1448
208 Ga0496114_0327149 3300048917 Bacteria 1355
209 Ga0496115_0026651 3300048918 Bacteria 4513
210 Ga0496125_0022726 3300048928 Bacteria 5814
211 Ga0501032_0001602 3300049569 Bacteria 18047
212 Ga0501034_0000328 3300049571 Bacteria 83532
213 Ga0501043_0007890 3300049579 Bacteria 8414
214 Ga0501070_0019618 3300049586 Bacteria 5669
215 Ga0501073_0136507 3300049589 Bacteria 1700
216 Ga0501044_0052949 3300049823 Bacteria 4178
217 Ga0495601_0133382 3300053077 Bacteria 1618
218 2537900112 2537561592 Bacteria 4348607
219 2555228861 2554235227 Bacteria 3637389
220 2655033326 2654587600 Bacteria 3911798
221 2775654796 2775506735 Bacteria 4556596
222 2808827974 2808606357 Bacteria 4466944
223 2808853330 2808606360 Bacteria 4404006
224 2808878173 2808606366 Bacteria 4415912
225 2808892224 2808606370 Bacteria 4942454
226 2808897323 2808606371 Bacteria 4251511
227 2812320260 2811994871 Bacteria 4497550
228 2816509951 2816332139 Bacteria 9138787
229 2837268822 2837268691 Bacteria 7850704
230 2857741047 2857740372 Bacteria 4782044
231 2884996640 2884994152 Bacteria 4492978
232 2904500281 2904497146 Bacteria 4731781
233 2904776923 2904776348 Bacteria 4658726
234 2910810989 2910809715 Bacteria 4982797
235 2919036461 2919034639 Bacteria 4763403
236 2919052578 2919051321 Bacteria 4210889
237 2919059526 2919059106 Bacteria 4991624
238 2919392897 2919391150 Bacteria 4884741
239 2919540920 2919538618 Bacteria 4677069
240 2932427055 2932426870 Bacteria 4547726
241 2933419685 2933418574 Bacteria 4476724
242 2939598945 2939598168 Bacteria 4687164
243 2939649916 2939647034 Bacteria 4681660
244 2939677365 2939674588 Bacteria 4844420
245 2945918007 2945916053 Bacteria 4555517
246 2945921704 2945920336 Bacteria 4501603
247 2945942080 2945941187 Bacteria 4682474
248 2945960135 2945956166 Bacteria 5110334
249 2946038062 2946037020 Bacteria 4900426
250 2946061847 2946059875 Bacteria 4386623
251 2953999339 2953998280 Bacteria 4812144
252 2974306046 2974302888 Bacteria 4369871
253 8054110653 8054107350 Bacteria 5022511
254 Ga0307408_100147022
255 rootH2_10126035
256 Ga0065714_10005033
257 Ga0070676_10023078
258 Ga0070670_100008842
259 Ga0070670_100142974
260 Ga0070677_10001080
261 Ga0070669_100033504
262 Ga0070674_100008293
263 Ga0070672_100022503
264 Ga0081455_10000954
265 Ga0081455_10014888
266 Ga0075428_100044757
267 Ga0075429_100238504
268 Ga0105244_10033464
269 Ga0105245_10264439
270 Ga0105243_10013760
271 Ga0105243_10307020
272 Ga0105246_10002960
273 Ga0105246_10009827
274 Ga0105246_10059252
275 Ga0105246_10091620
276 Ga0157373_10030758
277 Ga0157369_10269809
278 Ga0163162_10272525
279 Ga0157375_10294034
280 Ga0206353_11366877
281 Ga0209148_1004751
282 Ga0209025_1001093
283 Ga0209051_1003336
284 Ga0207697_10002399
285 Ga0207655_1002350
286 Ga0207655_1006184
287 Ga0207655_1009332
288 Ga0207680_10113840
289 Ga0207645_10000903
290 Ga0207681_10173641
291 Ga0207650_10003570
292 Ga0207644_10006174
293 Ga0207709_10150408
294 Ga0207669_10105950
295 Ga0207691_10000137
296 Ga0207651_10061963
297 Ga0207658_10203784
298 Ga0207683_10007029
299 Ga0207428_10013536
300 Ga0268266_10060138
301 Ga0265327_10010431
302 Ga0307408_100016521
303 Ga0307408_100044326
304 Ga0307408_100084626
305 Ga0307408_100132033
306 Ga0307408_100152000
307 Ga0307408_100484442
308 Ga0307405_10023192
309 Ga0307405_10056358
310 Ga0307405_10247427
311 Ga0307405_10262205
312 Ga0307405_10372896
313 Ga0307413_10065124
314 Ga0307413_10303826
315 Ga0307410_10009395
316 Ga0307410_10040171
317 Ga0307410_10041758
318 Ga0307410_10059278
319 Ga0307410_10075377
320 Ga0307410_10242693
321 Ga0307406_10092973
322 Ga0307407_10004893
323 Ga0307407_10008405
324 Ga0307407_10017059
325 Ga0307407_10077319
326 Ga0307407_10087994
327 Ga0307412_10027144
328 Ga0307412_10097351
329 Ga0307412_10119947
330 Ga0307412_10289066
331 Ga0307409_100002076
332 Ga0307409_100009072
333 Ga0307409_100016595
334 Ga0307409_100150209
335 Ga0307416_100012603
336 Ga0307416_100022431
337 Ga0307416_100062496
338 Ga0307416_100120250
339 Ga0307416_100122325
340 Ga0307416_100425714
341 Ga0307414_10018754
342 Ga0307414_10062492
343 Ga0307414_10113669
344 Ga0307415_100015313
345 Ga0307415_100078105
346 Ga0307415_100102393
347 Ga0307415_100205681
348 Ga0373962_0001801
349 Ga0395899_0002972
350 Ga0395899_0039553
351 Ga0395899_0051770
352 Ga0395900_0010538
353 Ga0395900_0028430
354 Ga0395900_0751631
355 Ga0395898_0022871
356 Ga0395898_0031398
357 Ga0395898_0031873
358 Ga0395898_0047394
359 Ga0395898_0062621
360 Ga0395898_0114792
361 Ga0395898_0121901
362 Ga0436364_0652293
363 Ga0395901_0000906
364 Ga0395901_0226573
365 Ga0439436_0011432
366 Ga0439436_0040143
367 Ga0439438_032318
368 Ga0439466_0007041
369 Ga0439466_0020360
370 Ga0439466_0026595
371 Ga0451797_0262508
372 Ga0439433_0007536
373 Ga0439433_0014277
374 Ga0439442_000050
375 Ga0439442_000355
376 Ga0439442_000527
377 Ga0439442_004882
378 Ga0439442_016765
379 Ga0439445_0053189
380 Ga0439432_012880
381 Ga0439449_0007613
382 Ga0439449_0009681
383 Ga0439454_004601
384 Ga0439457_008356
385 Ga0439457_034814
386 Ga0439462_0029051
387 Ga0450919_001050
388 Ga0450923_002311
389 Ga0450907_000103
390 Ga0450909_000023
391 Ga0439434_0000050
392 Ga0439434_0009417
393 Ga0439434_0010951
394 Ga0450918_000206
395 Ga0450918_001251
396 Ga0466972_0110854
397 Ga0466965_0024028
398 Ga0466966_0076809
399 Ga0466961_0186672
400 Ga0466970_0051659
401 Ga0466960_0139372
402 Ga0495629_0043078
403 Ga0495653_0004336
404 Ga0495650_0009629
405 Ga0495580_0025477
406 Ga0495580_0042210
407 Ga0495582_0054453
408 Ga0495582_0072781
409 Ga0495639_0012022
410 Ga0495639_0090940
411 Ga0495664_0005892
412 Ga0495643_0093865
413 Ga0495665_0029605
414 Ga0495586_0002636
415 Ga0495586_0011070
416 Ga0495586_0052022
417 Ga0495586_0061154
418 Ga0495587_0020066
419 Ga0495645_0003079
420 Ga0495667_0003775
421 Ga0495656_0001203
422 Ga0495668_0075040
423 Ga0495635_0025052
424 Ga0495659_0085188
425 Ga0495588_0012795
426 Ga0495588_0126844
427 Ga0495657_0039781
428 Ga0495670_0000473
429 Ga0495670_0060154
430 Ga0495649_0139115
431 Ga0495600_0003927
432 Ga0495600_0112268
433 Ga0495581_0003977
434 Ga0495581_0008036
435 Ga0495581_0008505
436 Ga0495581_0066312
437 Ga0495680_0035354
438 Ga0495675_0009576
439 Ga0495677_0016839
440 Ga0495677_0036916
441 Ga0495593_0094347
442 Ga0496101_0141238
443 Ga0496101_0335519
444 Ga0496102_0061771
445 Ga0496102_0362550
446 Ga0496103_0140235
447 Ga0496103_0227591
448 Ga0496104_0119895
449 Ga0496105_0114199
450 Ga0496106_0008783
451 Ga0496107_0005422
452 Ga0496107_0258556
453 Ga0496108_0060333
454 Ga0496108_0110597
455 Ga0496110_0096468
456 Ga0496111_0202977
457 Ga0496112_0020941
458 Ga0496112_0112904
459 Ga0496114_0065501
460 Ga0496114_0288168
461 Ga0496114_0327149
462 Ga0496115_0026651
463 Ga0496125_0022726
464 Ga0501032_0001602
465 Ga0501034_0000328
466 Ga0501043_0007890
467 Ga0501070_0019618
468 Ga0501073_0136507
469 Ga0501044_0052949
470 Ga0495601_0133382
471 2537900112
472 2555228861
473 2655033326
474 2775654796
475 2808827974
476 2808853330
477 2808878173
478 2808892224
479 2808897323
480 2812320260
481 2816509951
482 2837268822
483 2857741047
484 2884996640
485 2904500281
486 2904776923
487 2910810989
488 2919036461
489 2919052578
490 2919059526
491 2919392897
492 2919540920
493 2932427055
494 2933419685
495 2939598945
496 2939649916
497 2939677365
498 2945918007
499 2945921704
500 2945942080
501 2945960135
502 2946038062
503 2946061847
504 2953999339
505 2974306046
506 8054110653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

289

359

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

230

351

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

75

189

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

112

191

0.79

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

262

353

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c27-assembly1.cif.gz_A the structure of mycothiol synthase in complex with des- acetylmycothiol and coenzymea. 0.8761 1 301
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8674 157 292
2c27-assembly1.cif.gz_A the structure of mycothiol synthase in complex with des- acetylmycothiol and coenzymea. 0.8538 1 301
2pdo-assembly1.cif.gz_A crystal structure of the putative acetyltransferase of gnat family from shigella flexneri 0.8527 156 292
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8467 157 292
ID Description Score Start End Superfamily
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9312 234 292 3.40.630.30
af_I1MRQ6_38_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8964 206 288 3.40.630.30
af_K7MYK9_1_69_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8963 203 262 3.40.630.30
af_Q54LZ9_6_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8798 156 292 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8659 214 266 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A353ZX11-F1-model_v4 Mycothiol synthase 0.9537 1 90
AF-A0A7X7K8L4-F1-model_v4 Mycothiol acetyltransferase (MSH acetyltransferase) (EC 2.3.1.189) (Mycothiol synthase) 0.9498 1 301 GO:0010125
GO:0035447
AF-A0A1C6N5R4-F1-model_v4 Mycothiol acetyltransferase (MSH acetyltransferase) (EC 2.3.1.189) (Mycothiol synthase) 0.9478 1 300 GO:0010125
GO:0035447
AF-A0A2G7AQA8-F1-model_v4 deleted 0.9455 1 300
AF-A0A4Z1CY81-F1-model_v4 Mycothiol acetyltransferase (MSH acetyltransferase) (EC 2.3.1.189) (Mycothiol synthase) 0.9442 1 300 GO:0010125
GO:0035447

Map