F364099
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 153 | 253 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10113823|Ga0207695_101138233 |
| Length | 127 |
| Sequence | VTATDTAVQLAQVAGHAAADKLATDIVLIDVSDRLAITDVFVIATGNNERQVEAIVEEKLRLAGSKPLRREGKRDGRWVLLDYSEIVVHIQHAEERVFYALERLWRDCPVINFDPMAAPPVVATPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 61 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 93 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 94 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 95 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 96 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 97 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 98 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 99 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 100 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 101 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 102 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 103 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 104 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 105 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 106 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 107 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 108 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 109 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 110 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 127 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 128 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 129 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 133 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 134 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 137 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 138 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 139 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.65 |
| Metatranscriptomes | 4.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 12.65 |
| Rhizosphere | 83.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c008352 | 3300000041 | Bacteria | 877 |
| 2 | JGI24735J21928_10020712 | 3300002067 | Bacteria | 2013 |
| 3 | Ga0070658_10022842 | 3300005327 | Bacteria | 5020 |
| 4 | Ga0070683_100047356 | 3300005329 | Bacteria | 3972 |
| 5 | Ga0070683_100097855 | 3300005329 | Bacteria | 2760 |
| 6 | Ga0070683_100582800 | 3300005329 | Bacteria | 1070 |
| 7 | Ga0070683_102408506 | 3300005329 | Bacteria | 504 |
| 8 | Ga0068869_100019477 | 3300005334 | Bacteria | 4638 |
| 9 | Ga0070666_10004556 | 3300005335 | Bacteria | 8451 |
| 10 | Ga0070682_100034361 | 3300005337 | Bacteria | 3088 |
| 11 | Ga0068868_100009065 | 3300005338 | Bacteria | 7145 |
| 12 | Ga0068868_100701304 | 3300005338 | Bacteria | 905 |
| 13 | Ga0070660_101179525 | 3300005339 | Bacteria | 649 |
| 14 | Ga0070692_10462687 | 3300005345 | Bacteria | 814 |
| 15 | Ga0070668_100035763 | 3300005347 | Bacteria | 3789 |
| 16 | Ga0070671_100194099 | 3300005355 | Bacteria | 1721 |
| 17 | Ga0070659_100000794 | 3300005366 | Bacteria | 23021 |
| 18 | Ga0070659_101283197 | 3300005366 | Bacteria | 649 |
| 19 | Ga0070703_10249222 | 3300005406 | Bacteria | 720 |
| 20 | Ga0070714_100000050 | 3300005435 | Bacteria | 110823 |
| 21 | Ga0070714_100763674 | 3300005435 | Bacteria | 935 |
| 22 | Ga0070714_101136003 | 3300005435 | Bacteria | 762 |
| 23 | Ga0070714_101543417 | 3300005435 | Bacteria | 649 |
| 24 | Ga0070713_100300850 | 3300005436 | Bacteria | 1477 |
| 25 | Ga0070700_100000117 | 3300005441 | Bacteria | 50446 |
| 26 | Ga0070708_100626329 | 3300005445 | Bacteria | 1014 |
| 27 | Ga0070706_100241925 | 3300005467 | Bacteria | 1685 |
| 28 | Ga0070707_100085363 | 3300005468 | Bacteria | 3052 |
| 29 | Ga0070707_100847120 | 3300005468 | Bacteria | 878 |
| 30 | Ga0070684_100115562 | 3300005535 | Bacteria | 2410 |
| 31 | Ga0070684_100158785 | 3300005535 | Bacteria | 2050 |
| 32 | Ga0070693_100381214 | 3300005547 | Bacteria | 973 |
| 33 | Ga0070665_100002489 | 3300005548 | Bacteria | 20278 |
| 34 | Ga0070665_100256681 | 3300005548 | Bacteria | 1749 |
| 35 | Ga0068855_100572291 | 3300005563 | Bacteria | 1221 |
| 36 | Ga0068854_100135133 | 3300005578 | Bacteria | 1887 |
| 37 | Ga0068854_101593229 | 3300005578 | Bacteria | 595 |
| 38 | Ga0068856_100061297 | 3300005614 | Bacteria | 3716 |
| 39 | Ga0068856_100378513 | 3300005614 | Bacteria | 1435 |
| 40 | Ga0068852_100718990 | 3300005616 | Bacteria | 1010 |
| 41 | Ga0068852_100998102 | 3300005616 | Bacteria | 856 |
| 42 | Ga0068852_101200674 | 3300005616 | Bacteria | 779 |
| 43 | Ga0068859_100007868 | 3300005617 | Bacteria | 10816 |
| 44 | Ga0068861_100813886 | 3300005719 | Bacteria | 878 |
| 45 | Ga0068863_100004017 | 3300005841 | Bacteria | 14528 |
| 46 | Ga0068858_100011416 | 3300005842 | Bacteria | 8386 |
| 47 | Ga0068860_100001876 | 3300005843 | Bacteria | 22333 |
| 48 | Ga0081540_1032339 | 3300005983 | Bacteria | 2859 |
| 49 | Ga0070717_10296811 | 3300006028 | Bacteria | 1436 |
| 50 | Ga0070717_10537566 | 3300006028 | Bacteria | 1058 |
| 51 | Ga0070717_10878541 | 3300006028 | Bacteria | 816 |
| 52 | Ga0075432_10510752 | 3300006058 | Bacteria | 537 |
| 53 | Ga0070716_101000558 | 3300006173 | Bacteria | 661 |
| 54 | Ga0097620_100007868 | 3300006931 | Bacteria | 10816 |
| 55 | Ga0099794_10174982 | 3300007265 | Bacteria | 1094 |
| 56 | Ga0105240_10050558 | 3300009093 | Bacteria | 5239 |
| 57 | Ga0105240_10068342 | 3300009093 | Bacteria | 4401 |
| 58 | Ga0105240_12664124 | 3300009093 | Bacteria | 516 |
| 59 | Ga0105245_10347757 | 3300009098 | Bacteria | 1468 |
| 60 | Ga0105247_10004967 | 3300009101 | Bacteria | 8456 |
| 61 | Ga0105248_11096835 | 3300009177 | Bacteria | 900 |
| 62 | Ga0105237_10132924 | 3300009545 | Bacteria | 2483 |
| 63 | Ga0105237_12551431 | 3300009545 | Bacteria | 522 |
| 64 | Ga0105238_10332841 | 3300009551 | Bacteria | 1505 |
| 65 | Ga0105238_12101253 | 3300009551 | Bacteria | 599 |
| 66 | Ga0105239_10047094 | 3300010375 | Bacteria | 4725 |
| 67 | Ga0105239_10342404 | 3300010375 | Bacteria | 1687 |
| 68 | Ga0157338_1040005 | 3300012515 | Bacteria | 635 |
| 69 | Ga0157371_10372526 | 3300013102 | Bacteria | 1042 |
| 70 | Ga0157371_10777330 | 3300013102 | Bacteria | 720 |
| 71 | Ga0157370_10020826 | 3300013104 | Bacteria | 6543 |
| 72 | Ga0157369_10071608 | 3300013105 | Bacteria | 3721 |
| 73 | Ga0157369_11535426 | 3300013105 | Bacteria | 677 |
| 74 | Ga0157374_10830818 | 3300013296 | Bacteria | 940 |
| 75 | Ga0157372_10000172 | 3300013307 | Bacteria | 71944 |
| 76 | Ga0157372_10062512 | 3300013307 | Bacteria | 4172 |
| 77 | Ga0157372_10795034 | 3300013307 | Bacteria | 1099 |
| 78 | Ga0157372_12832451 | 3300013307 | Bacteria | 556 |
| 79 | Ga0163163_10650221 | 3300014325 | Bacteria | 1118 |
| 80 | Ga0157380_10881877 | 3300014326 | Bacteria | 919 |
| 81 | Ga0182008_10218154 | 3300014497 | Bacteria | 975 |
| 82 | Ga0182008_10441717 | 3300014497 | Bacteria | 706 |
| 83 | Ga0157379_10009529 | 3300014968 | Bacteria | 8455 |
| 84 | Ga0157379_10948671 | 3300014968 | Bacteria | 818 |
| 85 | Ga0157379_11348950 | 3300014968 | Bacteria | 690 |
| 86 | Ga0197907_10309151 | 3300020069 | Bacteria | 1244 |
| 87 | Ga0197907_11075397 | 3300020069 | Bacteria | 1319 |
| 88 | Ga0206351_10284987 | 3300020077 | Bacteria | 538 |
| 89 | Ga0206354_10246268 | 3300020081 | Bacteria | 948 |
| 90 | Ga0206354_10426536 | 3300020081 | Bacteria | 1376 |
| 91 | Ga0206354_11668439 | 3300020081 | Bacteria | 837 |
| 92 | Ga0206353_10092848 | 3300020082 | Bacteria | 1557 |
| 93 | Ga0206353_10123993 | 3300020082 | Bacteria | 1128 |
| 94 | Ga0206353_10913777 | 3300020082 | Bacteria | 2307 |
| 95 | Ga0206353_11017234 | 3300020082 | Bacteria | 1093 |
| 96 | Ga0206353_11748427 | 3300020082 | Bacteria | 1402 |
| 97 | Ga0213875_10023972 | 3300021388 | Bacteria | 2912 |
| 98 | Ga0207710_10310206 | 3300025900 | Bacteria | 798 |
| 99 | Ga0207688_10199036 | 3300025901 | Bacteria | 1200 |
| 100 | Ga0207680_10010755 | 3300025903 | Bacteria | 4591 |
| 101 | Ga0207705_10208523 | 3300025909 | Bacteria | 1482 |
| 102 | Ga0207705_10464631 | 3300025909 | Bacteria | 982 |
| 103 | Ga0207684_10248825 | 3300025910 | Bacteria | 1534 |
| 104 | Ga0207695_10063215 | 3300025913 | Bacteria | 3817 |
| 105 | Ga0207695_10113823 | 3300025913 | Bacteria | 2681 |
| 106 | Ga0207695_10163635 | 3300025913 | Bacteria | 2154 |
| 107 | Ga0207695_10407897 | 3300025913 | Bacteria | 1243 |
| 108 | Ga0207671_10155345 | 3300025914 | Bacteria | 1769 |
| 109 | Ga0207660_10620558 | 3300025917 | Bacteria | 881 |
| 110 | Ga0207662_10648264 | 3300025918 | Bacteria | 737 |
| 111 | Ga0207646_10004517 | 3300025922 | Bacteria | 15065 |
| 112 | Ga0207646_10040386 | 3300025922 | Bacteria | 4195 |
| 113 | Ga0207646_10185491 | 3300025922 | Bacteria | 1879 |
| 114 | Ga0207646_11725741 | 3300025922 | Bacteria | 537 |
| 115 | Ga0207681_10545547 | 3300025923 | Bacteria | 954 |
| 116 | Ga0207694_10155563 | 3300025924 | Bacteria | 1844 |
| 117 | Ga0207694_10615443 | 3300025924 | Bacteria | 914 |
| 118 | Ga0207687_10414546 | 3300025927 | Bacteria | 1110 |
| 119 | Ga0207664_10000003 | 3300025929 | Bacteria | 510966 |
| 120 | Ga0207664_10041577 | 3300025929 | Bacteria | 3582 |
| 121 | Ga0207664_10480822 | 3300025929 | Bacteria | 1111 |
| 122 | Ga0207664_10601103 | 3300025929 | Bacteria | 988 |
| 123 | Ga0207644_10016546 | 3300025931 | Bacteria | 4962 |
| 124 | Ga0207690_10001077 | 3300025932 | Bacteria | 17454 |
| 125 | Ga0207690_11719354 | 3300025932 | Bacteria | 524 |
| 126 | Ga0207709_10705346 | 3300025935 | Bacteria | 808 |
| 127 | Ga0207689_10028581 | 3300025942 | Bacteria | 4663 |
| 128 | Ga0207661_10099233 | 3300025944 | Bacteria | 2442 |
| 129 | Ga0207661_10373987 | 3300025944 | Bacteria | 1289 |
| 130 | Ga0207667_10412946 | 3300025949 | Bacteria | 1374 |
| 131 | Ga0207640_10344879 | 3300025981 | Bacteria | 1194 |
| 132 | Ga0207640_11155105 | 3300025981 | Bacteria | 687 |
| 133 | Ga0207658_10014518 | 3300025986 | Bacteria | 5394 |
| 134 | Ga0207677_10495116 | 3300026023 | Bacteria | 1056 |
| 135 | Ga0207703_10019021 | 3300026035 | Bacteria | 5365 |
| 136 | Ga0207708_10000178 | 3300026075 | Bacteria | 50595 |
| 137 | Ga0207702_10048333 | 3300026078 | Bacteria | 3588 |
| 138 | Ga0207702_11833994 | 3300026078 | Bacteria | 598 |
| 139 | Ga0207641_10010895 | 3300026088 | Bacteria | 7450 |
| 140 | Ga0207675_100565579 | 3300026118 | Bacteria | 1137 |
| 141 | Ga0207698_10407912 | 3300026142 | Bacteria | 1300 |
| 142 | Ga0268266_10008502 | 3300028379 | Bacteria | 9122 |
| 143 | Ga0268266_10385261 | 3300028379 | Bacteria | 1323 |
| 144 | Ga0268264_10000114 | 3300028381 | Bacteria | 203211 |
| 145 | Ga0307410_10229966 | 3300031852 | Bacteria | 1431 |
| 146 | Ga0307412_11553161 | 3300031911 | Bacteria | 603 |
| 147 | Ga0307414_10711233 | 3300032004 | Bacteria | 910 |
| 148 | Ga0373947_0840607 | 3300035725 | Bacteria | 627 |
| 149 | Ga0395899_0267917 | 3300037312 | Bacteria | 1166 |
| 150 | Ga0436364_0937995 | 3300037853 | Bacteria | 2680 |
| 151 | Ga0436365_0353275 | 3300039437 | Bacteria | 723 |
| 152 | Ga0436365_0523735 | 3300039437 | Bacteria | 2084 |
| 153 | Ga0436365_0723170 | 3300039437 | Bacteria | 913 |
| 154 | Ga0436362_0265570 | 3300039453 | Bacteria | 514 |
| 155 | Ga0466969_0184662 | 3300044656 | Bacteria | 954 |
| 156 | Ga0466972_0017707 | 3300044658 | Bacteria | 3565 |
| 157 | Ga0466965_0439184 | 3300044683 | Bacteria | 725 |
| 158 | Ga0466966_0064301 | 3300044684 | Bacteria | 2310 |
| 159 | Ga0466966_0084453 | 3300044684 | Bacteria | 1975 |
| 160 | Ga0466966_0142198 | 3300044684 | Bacteria | 1466 |
| 161 | Ga0466966_0205852 | 3300044684 | Bacteria | 1190 |
| 162 | Ga0466961_0013748 | 3300044693 | Bacteria | 5188 |
| 163 | Ga0466961_0044624 | 3300044693 | Bacteria | 2837 |
| 164 | Ga0466961_0164304 | 3300044693 | Bacteria | 1383 |
| 165 | Ga0466961_0566399 | 3300044693 | Bacteria | 684 |
| 166 | Ga0466963_0185182 | 3300044694 | Bacteria | 1454 |
| 167 | Ga0466963_0272481 | 3300044694 | Bacteria | 1189 |
| 168 | Ga0466963_0423860 | 3300044694 | Bacteria | 938 |
| 169 | Ga0466963_0909421 | 3300044694 | Bacteria | 620 |
| 170 | Ga0466964_0008715 | 3300044706 | Bacteria | 3814 |
| 171 | Ga0466971_0395206 | 3300044719 | Bacteria | 673 |
| 172 | Ga0466968_0033509 | 3300044735 | Bacteria | 2141 |
| 173 | Ga0466968_0306331 | 3300044735 | Bacteria | 765 |
| 174 | Ga0466970_0252852 | 3300044765 | Bacteria | 988 |
| 175 | Ga0466970_0921794 | 3300044765 | Bacteria | 514 |
| 176 | Ga0466957_0229629 | 3300044842 | Bacteria | 1228 |
| 177 | Ga0466957_1308754 | 3300044842 | Bacteria | 526 |
| 178 | Ga0466959_0021110 | 3300045049 | Bacteria | 4801 |
| 179 | Ga0466959_0115320 | 3300045049 | Bacteria | 1914 |
| 180 | Ga0466959_0447519 | 3300045049 | Bacteria | 876 |
| 181 | Ga0466958_0033388 | 3300045836 | Bacteria | 3066 |
| 182 | Ga0466958_0410364 | 3300045836 | Bacteria | 875 |
| 183 | Ga0466958_0689866 | 3300045836 | Bacteria | 665 |
| 184 | Ga0466967_0150806 | 3300045976 | Bacteria | 2172 |
| 185 | Ga0466967_0374655 | 3300045976 | Bacteria | 1381 |
| 186 | Ga0466967_0536358 | 3300045976 | Bacteria | 1151 |
| 187 | Ga0466967_0597436 | 3300045976 | Bacteria | 1089 |
| 188 | Ga0495603_0048716 | 3300046455 | Bacteria | 2523 |
| 189 | Ga0495603_0801396 | 3300046455 | Bacteria | 537 |
| 190 | Ga0495641_0072762 | 3300046461 | Bacteria | 1542 |
| 191 | Ga0495641_0482495 | 3300046461 | Bacteria | 565 |
| 192 | Ga0495580_0321152 | 3300046472 | Bacteria | 1052 |
| 193 | Ga0495639_0547607 | 3300046475 | Bacteria | 593 |
| 194 | Ga0495658_0171496 | 3300046683 | Bacteria | 1343 |
| 195 | Ga0495581_0292522 | 3300047315 | Bacteria | 952 |
| 196 | Ga0495674_0395254 | 3300047319 | Bacteria | 1117 |
| 197 | Ga0496100_0734612 | 3300048903 | Bacteria | 771 |
| 198 | Ga0496101_0117479 | 3300048904 | Bacteria | 2008 |
| 199 | Ga0496102_0000110 | 3300048905 | Bacteria | 117178 |
| 200 | Ga0496102_0004164 | 3300048905 | Bacteria | 12237 |
| 201 | Ga0496102_0045264 | 3300048905 | Bacteria | 3995 |
| 202 | Ga0496102_0047157 | 3300048905 | Bacteria | 3914 |
| 203 | Ga0496103_0000135 | 3300048906 | Bacteria | 77221 |
| 204 | Ga0496103_0020316 | 3300048906 | Bacteria | 3989 |
| 205 | Ga0496103_0065997 | 3300048906 | Bacteria | 2258 |
| 206 | Ga0496104_0048114 | 3300048907 | Bacteria | 4021 |
| 207 | Ga0496105_0123757 | 3300048908 | Bacteria | 2132 |
| 208 | Ga0496105_0607463 | 3300048908 | Bacteria | 848 |
| 209 | Ga0496105_0766056 | 3300048908 | Bacteria | 736 |
| 210 | Ga0496106_0021255 | 3300048909 | Bacteria | 4818 |
| 211 | Ga0496106_0791915 | 3300048909 | Bacteria | 752 |
| 212 | Ga0496107_0349481 | 3300048910 | Bacteria | 1100 |
| 213 | Ga0496108_0008257 | 3300048911 | Bacteria | 8446 |
| 214 | Ga0496108_0200787 | 3300048911 | Bacteria | 1731 |
| 215 | Ga0496108_0569541 | 3300048911 | Bacteria | 987 |
| 216 | Ga0496109_0021420 | 3300048912 | Bacteria | 5715 |
| 217 | Ga0496109_0031721 | 3300048912 | Bacteria | 4745 |
| 218 | Ga0496109_0777959 | 3300048912 | Bacteria | 895 |
| 219 | Ga0496109_1292022 | 3300048912 | Bacteria | 666 |
| 220 | Ga0496110_0073872 | 3300048913 | Bacteria | 3026 |
| 221 | Ga0496111_0293566 | 3300048914 | Bacteria | 1205 |
| 222 | Ga0496111_0546626 | 3300048914 | Bacteria | 850 |
| 223 | Ga0496112_0163241 | 3300048915 | Bacteria | 2194 |
| 224 | Ga0496112_0238834 | 3300048915 | Bacteria | 1770 |
| 225 | Ga0496112_0801098 | 3300048915 | Bacteria | 867 |
| 226 | Ga0496113_0094704 | 3300048916 | Bacteria | 2307 |
| 227 | Ga0496113_0194779 | 3300048916 | Bacteria | 1609 |
| 228 | Ga0496114_0151373 | 3300048917 | Bacteria | 2013 |
| 229 | Ga0496118_0007310 | 3300048921 | Bacteria | 11749 |
| 230 | Ga0496121_0016104 | 3300048924 | Bacteria | 7748 |
| 231 | Ga0496126_0156906 | 3300048929 | Bacteria | 1947 |
| 232 | Ga0496126_0957480 | 3300048929 | Bacteria | 645 |
| 233 | Ga0501031_0568485 | 3300049568 | Bacteria | 730 |
| 234 | Ga0501038_0581912 | 3300049574 | Bacteria | 849 |
| 235 | Ga0501039_0289063 | 3300049575 | Bacteria | 1289 |
| 236 | Ga0501041_0193940 | 3300049577 | Bacteria | 1273 |
| 237 | Ga0501041_0570593 | 3300049577 | Bacteria | 722 |
| 238 | Ga0501042_0242009 | 3300049578 | Bacteria | 1302 |
| 239 | Ga0501042_0962249 | 3300049578 | Bacteria | 622 |
| 240 | Ga0501048_0424414 | 3300049582 | Bacteria | 951 |
| 241 | Ga0501069_0048666 | 3300049585 | Bacteria | 2355 |
| 242 | Ga0501069_0059586 | 3300049585 | Bacteria | 2130 |
| 243 | Ga0501069_0160732 | 3300049585 | Bacteria | 1293 |
| 244 | Ga0501070_0009842 | 3300049586 | Bacteria | 8084 |
| 245 | Ga0501071_0028868 | 3300049587 | Bacteria | 3911 |
| 246 | Ga0501076_1143879 | 3300049592 | Bacteria | 641 |
| 247 | Ga0501079_0402322 | 3300049741 | Bacteria | 1074 |
| 248 | Ga0501079_1006104 | 3300049741 | Bacteria | 657 |
| 249 | Ga0501045_0149143 | 3300049824 | Bacteria | 1740 |
| 250 | Ga0495595_0494409 | 3300053084 | Bacteria | 623 |
| 251 | Ga0501082_1694540 | 3300060353 | Bacteria | 552 |
| 252 | Ga0530510_0018900 | 3300061734 | Bacteria | 4887 |
| 253 | Ga0530510_0535395 | 3300061734 | Bacteria | 889 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031852 | Ga0307410_10229966 | Ga0307410_102299662 | 115 |
| 2 | 3300032004 | Ga0307414_10711233 | Ga0307414_107112331 | 115 |
| 3 | 3300025913 | Ga0207695_10113823 | Ga0207695_101138233 | 118 |
| 4 | 3300048912 | Ga0496109_0777959 | Ga0496109_0777959_363_854 | 118 |
| 5 | 3300048915 | Ga0496112_0801098 | Ga0496112_0801098_10_501 | 118 |
| 6 | 3300005441 | Ga0070700_100000117 | Ga0070700_10000011728 | 119 |
| 7 | 3300025922 | Ga0207646_11725741 | Ga0207646_117257411 | 119 |
| 8 | 3300026075 | Ga0207708_10000178 | Ga0207708_1000017819 | 119 |
| 9 | 3300005327 | Ga0070658_10022842 | Ga0070658_100228424 | 120 |
| 10 | 3300005329 | Ga0070683_100047356 | Ga0070683_1000473563 | 120 |
| 11 | 3300005329 | Ga0070683_102408506 | Ga0070683_1024085061 | 120 |
| 12 | 3300005535 | Ga0070684_100158785 | Ga0070684_1001587852 | 120 |
| 13 | 3300005563 | Ga0068855_100572291 | Ga0068855_1005722912 | 120 |
| 14 | 3300009093 | Ga0105240_12664124 | Ga0105240_126641241 | 120 |
| 15 | 3300013105 | Ga0157369_11535426 | Ga0157369_115354261 | 120 |
| 16 | 3300020069 | Ga0197907_11075397 | Ga0197907_110753972 | 120 |
| 17 | 3300020081 | Ga0206354_10246268 | Ga0206354_102462682 | 120 |
| 18 | 3300020082 | Ga0206353_10123993 | Ga0206353_101239932 | 120 |
| 19 | 3300020082 | Ga0206353_11748427 | Ga0206353_117484273 | 120 |
| 20 | 3300025917 | Ga0207660_10620558 | Ga0207660_106205582 | 120 |
| 21 | 3300025949 | Ga0207667_10412946 | Ga0207667_104129463 | 120 |
| 22 | 3300005329 | Ga0070683_100582800 | Ga0070683_1005828001 | 121 |
| 23 | 3300005335 | Ga0070666_10004556 | Ga0070666_100045564 | 121 |
| 24 | 3300005347 | Ga0070668_100035763 | Ga0070668_1000357632 | 121 |
| 25 | 3300005355 | Ga0070671_100194099 | Ga0070671_1001940992 | 121 |
| 26 | 3300005435 | Ga0070714_101136003 | Ga0070714_1011360032 | 121 |
| 27 | 3300005435 | Ga0070714_101543417 | Ga0070714_1015434171 | 121 |
| 28 | 3300005436 | Ga0070713_100300850 | Ga0070713_1003008502 | 121 |
| 29 | 3300005548 | Ga0070665_100002489 | Ga0070665_1000024895 | 121 |
| 30 | 3300005548 | Ga0070665_100256681 | Ga0070665_1002566812 | 121 |
| 31 | 3300005616 | Ga0068852_101200674 | Ga0068852_1012006741 | 121 |
| 32 | 3300005841 | Ga0068863_100004017 | Ga0068863_1000040176 | 121 |
| 33 | 3300005842 | Ga0068858_100011416 | Ga0068858_1000114167 | 121 |
| 34 | 3300005843 | Ga0068860_100001876 | Ga0068860_10000187615 | 121 |
| 35 | 3300005983 | Ga0081540_1032339 | Ga0081540_10323394 | 121 |
| 36 | 3300006028 | Ga0070717_10878541 | Ga0070717_108785412 | 121 |
| 37 | 3300009177 | Ga0105248_11096835 | Ga0105248_110968351 | 121 |
| 38 | 3300013307 | Ga0157372_12832451 | Ga0157372_128324512 | 121 |
| 39 | 3300014325 | Ga0163163_10650221 | Ga0163163_106502211 | 121 |
| 40 | 3300014968 | Ga0157379_10009529 | Ga0157379_100095297 | 121 |
| 41 | 3300025903 | Ga0207680_10010755 | Ga0207680_100107554 | 121 |
| 42 | 3300025931 | Ga0207644_10016546 | Ga0207644_100165463 | 121 |
| 43 | 3300026035 | Ga0207703_10019021 | Ga0207703_100190215 | 121 |
| 44 | 3300026088 | Ga0207641_10010895 | Ga0207641_100108954 | 121 |
| 45 | 3300028379 | Ga0268266_10008502 | Ga0268266_100085029 | 121 |
| 46 | 3300028381 | Ga0268264_10000114 | Ga0268264_10000114192 | 121 |
| 47 | 3300013296 | Ga0157374_10830818 | Ga0157374_108308181 | 122 |
| 48 | 3300025944 | Ga0207661_10373987 | Ga0207661_103739872 | 122 |
| 49 | 3300044706 | Ga0466964_0008715 | Ga0466964_0008715_1040_1414 | 122 |
| 50 | 3300045976 | Ga0466967_0150806 | Ga0466967_0150806_497_871 | 122 |
| 51 | 3300045976 | Ga0466967_0374655 | Ga0466967_0374655_961_1335 | 122 |
| 52 | 3300047319 | Ga0495674_0395254 | Ga0495674_0395254_653_1033 | 122 |
| 53 | 3300048905 | Ga0496102_0004164 | Ga0496102_0004164_5506_5889 | 122 |
| 54 | 3300048905 | Ga0496102_0047157 | Ga0496102_0047157_797_1186 | 122 |
| 55 | 3300048906 | Ga0496103_0020316 | Ga0496103_0020316_2785_3168 | 122 |
| 56 | 3300048907 | Ga0496104_0048114 | Ga0496104_0048114_3052_3426 | 122 |
| 57 | 3300048908 | Ga0496105_0607463 | Ga0496105_0607463_28_402 | 122 |
| 58 | 3300048911 | Ga0496108_0008257 | Ga0496108_0008257_7242_7616 | 122 |
| 59 | 3300048912 | Ga0496109_0021420 | Ga0496109_0021420_3057_3431 | 122 |
| 60 | 3300048914 | Ga0496111_0546626 | Ga0496111_0546626_393_767 | 122 |
| 61 | 3300048915 | Ga0496112_0163241 | Ga0496112_0163241_1803_2177 | 122 |
| 62 | 3300048916 | Ga0496113_0094704 | Ga0496113_0094704_1637_2011 | 122 |
| 63 | 3300048924 | Ga0496121_0016104 | Ga0496121_0016104_5591_5980 | 122 |
| 64 | 3300053084 | Ga0495595_0494409 | Ga0495595_0494409_144_524 | 122 |
| 65 | 3300005578 | Ga0068854_100135133 | Ga0068854_1001351333 | 123 |
| 66 | 3300005614 | Ga0068856_100061297 | Ga0068856_1000612973 | 123 |
| 67 | 3300009093 | Ga0105240_10050558 | Ga0105240_100505583 | 123 |
| 68 | 3300009093 | Ga0105240_10068342 | Ga0105240_100683423 | 123 |
| 69 | 3300009545 | Ga0105237_10132924 | Ga0105237_101329243 | 123 |
| 70 | 3300009551 | Ga0105238_10332841 | Ga0105238_103328411 | 123 |
| 71 | 3300009551 | Ga0105238_12101253 | Ga0105238_121012532 | 123 |
| 72 | 3300010375 | Ga0105239_10047094 | Ga0105239_100470944 | 123 |
| 73 | 3300020069 | Ga0197907_10309151 | Ga0197907_103091512 | 123 |
| 74 | 3300025913 | Ga0207695_10063215 | Ga0207695_100632152 | 123 |
| 75 | 3300025913 | Ga0207695_10163635 | Ga0207695_101636353 | 123 |
| 76 | 3300025913 | Ga0207695_10407897 | Ga0207695_104078972 | 123 |
| 77 | 3300025914 | Ga0207671_10155345 | Ga0207671_101553453 | 123 |
| 78 | 3300025924 | Ga0207694_10155563 | Ga0207694_101555633 | 123 |
| 79 | 3300025981 | Ga0207640_10344879 | Ga0207640_103448792 | 123 |
| 80 | 3300025986 | Ga0207658_10014518 | Ga0207658_100145183 | 123 |
| 81 | 3300026078 | Ga0207702_10048333 | Ga0207702_100483333 | 123 |
| 82 | 3300044684 | Ga0466966_0084453 | Ga0466966_0084453_1477_1854 | 123 |
| 83 | 3300044765 | Ga0466970_0252852 | Ga0466970_0252852_255_632 | 123 |
| 84 | 3300045049 | Ga0466959_0115320 | Ga0466959_0115320_1456_1833 | 123 |
| 85 | 3300048929 | Ga0496126_0957480 | Ga0496126_0957480_160_537 | 123 |
| 86 | 3300005345 | Ga0070692_10462687 | Ga0070692_104626872 | 124 |
| 87 | 3300005445 | Ga0070708_100626329 | Ga0070708_1006263291 | 124 |
| 88 | 3300005467 | Ga0070706_100241925 | Ga0070706_1002419252 | 124 |
| 89 | 3300005468 | Ga0070707_100847120 | Ga0070707_1008471202 | 124 |
| 90 | 3300020082 | Ga0206353_10092848 | Ga0206353_100928483 | 124 |
| 91 | 3300039437 | Ga0436365_0353275 | Ga0436365_0353275_51_431 | 124 |
| 92 | 3300039437 | Ga0436365_0523735 | Ga0436365_0523735_818_1198 | 124 |
| 93 | 3300039437 | Ga0436365_0723170 | Ga0436365_0723170_338_718 | 124 |
| 94 | 3300039453 | Ga0436362_0265570 | Ga0436362_0265570_117_497 | 124 |
| 95 | 3300044735 | Ga0466968_0033509 | Ga0466968_0033509_905_1288 | 124 |
| 96 | 3300048929 | Ga0496126_0156906 | Ga0496126_0156906_570_953 | 124 |
| 97 | 3300002067 | JGI24735J21928_10020712 | JGI24735J21928_100207122 | 125 |
| 98 | 3300005339 | Ga0070660_101179525 | Ga0070660_1011795251 | 125 |
| 99 | 3300005366 | Ga0070659_101283197 | Ga0070659_1012831972 | 125 |
| 100 | 3300005435 | Ga0070714_100000050 | Ga0070714_10000005021 | 125 |
| 101 | 3300005435 | Ga0070714_100763674 | Ga0070714_1007636741 | 125 |
| 102 | 3300005578 | Ga0068854_101593229 | Ga0068854_1015932291 | 125 |
| 103 | 3300005617 | Ga0068859_100007868 | Ga0068859_1000078689 | 125 |
| 104 | 3300006931 | Ga0097620_100007868 | Ga0097620_1000078689 | 125 |
| 105 | 3300009101 | Ga0105247_10004967 | Ga0105247_100049679 | 125 |
| 106 | 3300013104 | Ga0157370_10020826 | Ga0157370_100208264 | 125 |
| 107 | 3300013307 | Ga0157372_10000172 | Ga0157372_1000017242 | 125 |
| 108 | 3300014968 | Ga0157379_11348950 | Ga0157379_113489502 | 125 |
| 109 | 3300020077 | Ga0206351_10284987 | Ga0206351_102849871 | 125 |
| 110 | 3300020081 | Ga0206354_11668439 | Ga0206354_116684392 | 125 |
| 111 | 3300020082 | Ga0206353_10913777 | Ga0206353_109137772 | 125 |
| 112 | 3300025900 | Ga0207710_10310206 | Ga0207710_103102062 | 125 |
| 113 | 3300025909 | Ga0207705_10464631 | Ga0207705_104646311 | 125 |
| 114 | 3300025927 | Ga0207687_10414546 | Ga0207687_104145462 | 125 |
| 115 | 3300025929 | Ga0207664_10000003 | Ga0207664_10000003293 | 125 |
| 116 | 3300025929 | Ga0207664_10601103 | Ga0207664_106011032 | 125 |
| 117 | 3300025932 | Ga0207690_11719354 | Ga0207690_117193541 | 125 |
| 118 | 3300025981 | Ga0207640_11155105 | Ga0207640_111551052 | 125 |
| 119 | 3300028379 | Ga0268266_10385261 | Ga0268266_103852612 | 125 |
| 120 | 3300031911 | Ga0307412_11553161 | Ga0307412_115531612 | 125 |
| 121 | 3300044656 | Ga0466969_0184662 | Ga0466969_0184662_112_516 | 125 |
| 122 | 3300044658 | Ga0466972_0017707 | Ga0466972_0017707_2760_3164 | 125 |
| 123 | 3300044684 | Ga0466966_0064301 | Ga0466966_0064301_1584_1970 | 125 |
| 124 | 3300044684 | Ga0466966_0205852 | Ga0466966_0205852_310_705 | 125 |
| 125 | 3300044693 | Ga0466961_0013748 | Ga0466961_0013748_3673_4077 | 125 |
| 126 | 3300044693 | Ga0466961_0044624 | Ga0466961_0044624_613_1008 | 125 |
| 127 | 3300044693 | Ga0466961_0164304 | Ga0466961_0164304_654_1040 | 125 |
| 128 | 3300044694 | Ga0466963_0272481 | Ga0466963_0272481_539_916 | 125 |
| 129 | 3300044694 | Ga0466963_0423860 | Ga0466963_0423860_80_466 | 125 |
| 130 | 3300044694 | Ga0466963_0909421 | Ga0466963_0909421_146_544 | 125 |
| 131 | 3300044842 | Ga0466957_1308754 | Ga0466957_1308754_44_445 | 125 |
| 132 | 3300045049 | Ga0466959_0021110 | Ga0466959_0021110_2909_3295 | 125 |
| 133 | 3300045049 | Ga0466959_0447519 | Ga0466959_0447519_215_619 | 125 |
| 134 | 3300045836 | Ga0466958_0410364 | Ga0466958_0410364_344_739 | 125 |
| 135 | 3300045976 | Ga0466967_0597436 | Ga0466967_0597436_378_776 | 125 |
| 136 | 3300046472 | Ga0495580_0321152 | Ga0495580_0321152_568_960 | 125 |
| 137 | 3300047315 | Ga0495581_0292522 | Ga0495581_0292522_288_680 | 125 |
| 138 | 3300048905 | Ga0496102_0000110 | Ga0496102_0000110_60320_60730 | 125 |
| 139 | 3300048906 | Ga0496103_0000135 | Ga0496103_0000135_33632_34042 | 125 |
| 140 | 3300048909 | Ga0496106_0791915 | Ga0496106_0791915_221_631 | 125 |
| 141 | 3300048921 | Ga0496118_0007310 | Ga0496118_0007310_5551_5961 | 125 |
| 142 | 3300049577 | Ga0501041_0193940 | Ga0501041_0193940_584_961 | 125 |
| 143 | 3300049578 | Ga0501042_0242009 | Ga0501042_0242009_52_429 | 125 |
| 144 | 3300049741 | Ga0501079_0402322 | Ga0501079_0402322_317_694 | 125 |
| 145 | 3300000041 | ARcpr5oldR_c008352 | ARcpr5oldR_0083521 | 126 |
| 146 | 3300005329 | Ga0070683_100097855 | Ga0070683_1000978555 | 126 |
| 147 | 3300005334 | Ga0068869_100019477 | Ga0068869_1000194772 | 126 |
| 148 | 3300005337 | Ga0070682_100034361 | Ga0070682_1000343615 | 126 |
| 149 | 3300005338 | Ga0068868_100009065 | Ga0068868_1000090655 | 126 |
| 150 | 3300005338 | Ga0068868_100701304 | Ga0068868_1007013042 | 126 |
| 151 | 3300005366 | Ga0070659_100000794 | Ga0070659_10000079410 | 126 |
| 152 | 3300005406 | Ga0070703_10249222 | Ga0070703_102492221 | 126 |
| 153 | 3300005468 | Ga0070707_100085363 | Ga0070707_1000853634 | 126 |
| 154 | 3300005535 | Ga0070684_100115562 | Ga0070684_1001155625 | 126 |
| 155 | 3300005547 | Ga0070693_100381214 | Ga0070693_1003812142 | 126 |
| 156 | 3300005614 | Ga0068856_100378513 | Ga0068856_1003785132 | 126 |
| 157 | 3300005616 | Ga0068852_100718990 | Ga0068852_1007189901 | 126 |
| 158 | 3300005616 | Ga0068852_100998102 | Ga0068852_1009981022 | 126 |
| 159 | 3300005719 | Ga0068861_100813886 | Ga0068861_1008138862 | 126 |
| 160 | 3300006028 | Ga0070717_10296811 | Ga0070717_102968112 | 126 |
| 161 | 3300006028 | Ga0070717_10537566 | Ga0070717_105375662 | 126 |
| 162 | 3300006058 | Ga0075432_10510752 | Ga0075432_105107522 | 126 |
| 163 | 3300006173 | Ga0070716_101000558 | Ga0070716_1010005582 | 126 |
| 164 | 3300007265 | Ga0099794_10174982 | Ga0099794_101749822 | 126 |
| 165 | 3300009098 | Ga0105245_10347757 | Ga0105245_103477572 | 126 |
| 166 | 3300009545 | Ga0105237_12551431 | Ga0105237_125514311 | 126 |
| 167 | 3300010375 | Ga0105239_10342404 | Ga0105239_103424042 | 126 |
| 168 | 3300012515 | Ga0157338_1040005 | Ga0157338_10400052 | 126 |
| 169 | 3300013102 | Ga0157371_10372526 | Ga0157371_103725262 | 126 |
| 170 | 3300013102 | Ga0157371_10777330 | Ga0157371_107773302 | 126 |
| 171 | 3300013105 | Ga0157369_10071608 | Ga0157369_100716084 | 126 |
| 172 | 3300013307 | Ga0157372_10062512 | Ga0157372_100625125 | 126 |
| 173 | 3300013307 | Ga0157372_10795034 | Ga0157372_107950342 | 126 |
| 174 | 3300014326 | Ga0157380_10881877 | Ga0157380_108818772 | 126 |
| 175 | 3300014497 | Ga0182008_10218154 | Ga0182008_102181542 | 126 |
| 176 | 3300014497 | Ga0182008_10441717 | Ga0182008_104417172 | 126 |
| 177 | 3300014968 | Ga0157379_10948671 | Ga0157379_109486711 | 126 |
| 178 | 3300020081 | Ga0206354_10426536 | Ga0206354_104265363 | 126 |
| 179 | 3300020082 | Ga0206353_11017234 | Ga0206353_110172341 | 126 |
| 180 | 3300021388 | Ga0213875_10023972 | Ga0213875_100239725 | 126 |
| 181 | 3300025901 | Ga0207688_10199036 | Ga0207688_101990363 | 126 |
| 182 | 3300025909 | Ga0207705_10208523 | Ga0207705_102085233 | 126 |
| 183 | 3300025910 | Ga0207684_10248825 | Ga0207684_102488253 | 126 |
| 184 | 3300025918 | Ga0207662_10648264 | Ga0207662_106482642 | 126 |
| 185 | 3300025922 | Ga0207646_10004517 | Ga0207646_100045178 | 126 |
| 186 | 3300025922 | Ga0207646_10040386 | Ga0207646_100403861 | 126 |
| 187 | 3300025922 | Ga0207646_10185491 | Ga0207646_101854912 | 126 |
| 188 | 3300025923 | Ga0207681_10545547 | Ga0207681_105455472 | 126 |
| 189 | 3300025924 | Ga0207694_10615443 | Ga0207694_106154431 | 126 |
| 190 | 3300025929 | Ga0207664_10041577 | Ga0207664_100415775 | 126 |
| 191 | 3300025929 | Ga0207664_10480822 | Ga0207664_104808222 | 126 |
| 192 | 3300025932 | Ga0207690_10001077 | Ga0207690_100010773 | 126 |
| 193 | 3300025935 | Ga0207709_10705346 | Ga0207709_107053462 | 126 |
| 194 | 3300025942 | Ga0207689_10028581 | Ga0207689_100285815 | 126 |
| 195 | 3300025944 | Ga0207661_10099233 | Ga0207661_100992332 | 126 |
| 196 | 3300026023 | Ga0207677_10495116 | Ga0207677_104951162 | 126 |
| 197 | 3300026078 | Ga0207702_11833994 | Ga0207702_118339941 | 126 |
| 198 | 3300026118 | Ga0207675_100565579 | Ga0207675_1005655792 | 126 |
| 199 | 3300026142 | Ga0207698_10407912 | Ga0207698_104079122 | 126 |
| 200 | 3300035725 | Ga0373947_0840607 | Ga0373947_0840607_233_613 | 126 |
| 201 | 3300037312 | Ga0395899_0267917 | Ga0395899_0267917_321_701 | 126 |
| 202 | 3300037853 | Ga0436364_0937995 | Ga0436364_0937995_1613_1993 | 126 |
| 203 | 3300044683 | Ga0466965_0439184 | Ga0466965_0439184_262_642 | 126 |
| 204 | 3300044684 | Ga0466966_0142198 | Ga0466966_0142198_502_903 | 126 |
| 205 | 3300044693 | Ga0466961_0566399 | Ga0466961_0566399_185_598 | 126 |
| 206 | 3300044694 | Ga0466963_0185182 | Ga0466963_0185182_734_1120 | 126 |
| 207 | 3300044719 | Ga0466971_0395206 | Ga0466971_0395206_142_555 | 126 |
| 208 | 3300044735 | Ga0466968_0306331 | Ga0466968_0306331_153_605 | 126 |
| 209 | 3300044765 | Ga0466970_0921794 | Ga0466970_0921794_30_443 | 126 |
| 210 | 3300044842 | Ga0466957_0229629 | Ga0466957_0229629_639_1025 | 126 |
| 211 | 3300045836 | Ga0466958_0033388 | Ga0466958_0033388_631_1032 | 126 |
| 212 | 3300045836 | Ga0466958_0689866 | Ga0466958_0689866_226_639 | 126 |
| 213 | 3300045976 | Ga0466967_0536358 | Ga0466967_0536358_59_439 | 126 |
| 214 | 3300046455 | Ga0495603_0048716 | Ga0495603_0048716_1034_1414 | 126 |
| 215 | 3300046455 | Ga0495603_0801396 | Ga0495603_0801396_26_406 | 126 |
| 216 | 3300046461 | Ga0495641_0072762 | Ga0495641_0072762_805_1185 | 126 |
| 217 | 3300046461 | Ga0495641_0482495 | Ga0495641_0482495_169_549 | 126 |
| 218 | 3300046475 | Ga0495639_0547607 | Ga0495639_0547607_74_454 | 126 |
| 219 | 3300046683 | Ga0495658_0171496 | Ga0495658_0171496_44_424 | 126 |
| 220 | 3300048903 | Ga0496100_0734612 | Ga0496100_0734612_227_607 | 126 |
| 221 | 3300048904 | Ga0496101_0117479 | Ga0496101_0117479_887_1267 | 126 |
| 222 | 3300048905 | Ga0496102_0045264 | Ga0496102_0045264_816_1196 | 126 |
| 223 | 3300048906 | Ga0496103_0065997 | Ga0496103_0065997_784_1164 | 126 |
| 224 | 3300048908 | Ga0496105_0123757 | Ga0496105_0123757_1609_1989 | 126 |
| 225 | 3300048908 | Ga0496105_0766056 | Ga0496105_0766056_183_563 | 126 |
| 226 | 3300048909 | Ga0496106_0021255 | Ga0496106_0021255_2594_2974 | 126 |
| 227 | 3300048910 | Ga0496107_0349481 | Ga0496107_0349481_233_613 | 126 |
| 228 | 3300048911 | Ga0496108_0200787 | Ga0496108_0200787_955_1341 | 126 |
| 229 | 3300048911 | Ga0496108_0569541 | Ga0496108_0569541_295_675 | 126 |
| 230 | 3300048912 | Ga0496109_0031721 | Ga0496109_0031721_910_1377 | 126 |
| 231 | 3300048912 | Ga0496109_1292022 | Ga0496109_1292022_85_471 | 126 |
| 232 | 3300048913 | Ga0496110_0073872 | Ga0496110_0073872_794_1174 | 126 |
| 233 | 3300048914 | Ga0496111_0293566 | Ga0496111_0293566_372_752 | 126 |
| 234 | 3300048915 | Ga0496112_0238834 | Ga0496112_0238834_1372_1752 | 126 |
| 235 | 3300048916 | Ga0496113_0194779 | Ga0496113_0194779_585_965 | 126 |
| 236 | 3300048917 | Ga0496114_0151373 | Ga0496114_0151373_24_404 | 126 |
| 237 | 3300049568 | Ga0501031_0568485 | Ga0501031_0568485_188_568 | 126 |
| 238 | 3300049574 | Ga0501038_0581912 | Ga0501038_0581912_90_470 | 126 |
| 239 | 3300049575 | Ga0501039_0289063 | Ga0501039_0289063_335_715 | 126 |
| 240 | 3300049577 | Ga0501041_0570593 | Ga0501041_0570593_219_599 | 126 |
| 241 | 3300049578 | Ga0501042_0962249 | Ga0501042_0962249_41_424 | 126 |
| 242 | 3300049582 | Ga0501048_0424414 | Ga0501048_0424414_393_773 | 126 |
| 243 | 3300049585 | Ga0501069_0048666 | Ga0501069_0048666_516_896 | 126 |
| 244 | 3300049585 | Ga0501069_0059586 | Ga0501069_0059586_1585_1986 | 126 |
| 245 | 3300049585 | Ga0501069_0160732 | Ga0501069_0160732_429_809 | 126 |
| 246 | 3300049586 | Ga0501070_0009842 | Ga0501070_0009842_1445_1846 | 126 |
| 247 | 3300049587 | Ga0501071_0028868 | Ga0501071_0028868_100_483 | 126 |
| 248 | 3300049592 | Ga0501076_1143879 | Ga0501076_1143879_46_453 | 126 |
| 249 | 3300049741 | Ga0501079_1006104 | Ga0501079_1006104_31_411 | 126 |
| 250 | 3300049824 | Ga0501045_0149143 | Ga0501045_0149143_325_705 | 126 |
| 251 | 3300060353 | Ga0501082_1694540 | Ga0501082_1694540_57_437 | 126 |
| 252 | 3300061734 | Ga0530510_0018900 | Ga0530510_0018900_2841_3221 | 126 |
| 253 | 3300061734 | Ga0530510_0535395 | Ga0530510_0535395_70_450 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2id1-assembly2.cif.gz_B | x-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5. | 0.9559 | 9 | 109 |
| 4wcw-assembly2.cif.gz_C | ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis | 0.9462 | 2 | 117 |
| 4wcw-assembly1.cif.gz_B | ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis | 0.9434 | 2 | 112 |
| 4wcw-assembly2.cif.gz_C | ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis | 0.9307 | 2 | 117 |
| 4wcw-assembly1.cif.gz_B | ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis | 0.9273 | 2 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAT6_2_105_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9503 | 9 | 108 | 3.30.460.10 |
| 2id1B01 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9499 | 9 | 108 | 3.30.460.10 |
| 4wcwD01 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9465 | 2 | 112 | 3.30.460.10 |
| 4wcwD01 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9383 | 2 | 112 | 3.30.460.10 |
| 2o5aB01 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9124 | 9 | 108 | 3.30.460.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1P1Q4-F1-model_v4 | Ribosome silencing factor | 0.9906 | 1 | 100 |
GO:0017148
GO:0043023 GO:0090071 |
| AF-A0A6L6EXU6-F1-model_v4 | Ribosomal silencing factor RsfS | 0.9844 | 1 | 120 |
GO:0005737
GO:0017148 GO:0042256 GO:0043023 GO:0090071 |
| AF-A0A0B2B662-F1-model_v4 | Ribosomal silencing factor RsfS | 0.9839 | 1 | 119 |
GO:0005737
GO:0017148 GO:0042256 GO:0043023 GO:0090071 |
| AF-A0A1G9DMX0-F1-model_v4 | Ribosomal silencing factor RsfS | 0.9837 | 1 | 122 |
GO:0005737
GO:0017148 GO:0042256 GO:0043023 GO:0090071 |
| AF-A0A7K0Q5X6-F1-model_v4 | Ribosomal silencing factor RsfS | 0.9834 | 1 | 120 |
GO:0005737
GO:0017148 GO:0042256 GO:0043023 GO:0090071 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar