F364099

General Info

Members Datasets Scaffolds Average Seq Length
253 153 253 129

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10113823|Ga0207695_101138233
Length 127
Sequence VTATDTAVQLAQVAGHAAADKLATDIVLIDVSDRLAITDVFVIATGNNERQVEAIVEEKLRLAGSKPLRREGKRDGRWVLLDYSEIVVHIQHAEERVFYALERLWRDCPVINFDPMAAPPVVATPEA

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 4.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.65
Rhizosphere 83.79
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c008352 3300000041 Bacteria 877
2 JGI24735J21928_10020712 3300002067 Bacteria 2013
3 Ga0070658_10022842 3300005327 Bacteria 5020
4 Ga0070683_100047356 3300005329 Bacteria 3972
5 Ga0070683_100097855 3300005329 Bacteria 2760
6 Ga0070683_100582800 3300005329 Bacteria 1070
7 Ga0070683_102408506 3300005329 Bacteria 504
8 Ga0068869_100019477 3300005334 Bacteria 4638
9 Ga0070666_10004556 3300005335 Bacteria 8451
10 Ga0070682_100034361 3300005337 Bacteria 3088
11 Ga0068868_100009065 3300005338 Bacteria 7145
12 Ga0068868_100701304 3300005338 Bacteria 905
13 Ga0070660_101179525 3300005339 Bacteria 649
14 Ga0070692_10462687 3300005345 Bacteria 814
15 Ga0070668_100035763 3300005347 Bacteria 3789
16 Ga0070671_100194099 3300005355 Bacteria 1721
17 Ga0070659_100000794 3300005366 Bacteria 23021
18 Ga0070659_101283197 3300005366 Bacteria 649
19 Ga0070703_10249222 3300005406 Bacteria 720
20 Ga0070714_100000050 3300005435 Bacteria 110823
21 Ga0070714_100763674 3300005435 Bacteria 935
22 Ga0070714_101136003 3300005435 Bacteria 762
23 Ga0070714_101543417 3300005435 Bacteria 649
24 Ga0070713_100300850 3300005436 Bacteria 1477
25 Ga0070700_100000117 3300005441 Bacteria 50446
26 Ga0070708_100626329 3300005445 Bacteria 1014
27 Ga0070706_100241925 3300005467 Bacteria 1685
28 Ga0070707_100085363 3300005468 Bacteria 3052
29 Ga0070707_100847120 3300005468 Bacteria 878
30 Ga0070684_100115562 3300005535 Bacteria 2410
31 Ga0070684_100158785 3300005535 Bacteria 2050
32 Ga0070693_100381214 3300005547 Bacteria 973
33 Ga0070665_100002489 3300005548 Bacteria 20278
34 Ga0070665_100256681 3300005548 Bacteria 1749
35 Ga0068855_100572291 3300005563 Bacteria 1221
36 Ga0068854_100135133 3300005578 Bacteria 1887
37 Ga0068854_101593229 3300005578 Bacteria 595
38 Ga0068856_100061297 3300005614 Bacteria 3716
39 Ga0068856_100378513 3300005614 Bacteria 1435
40 Ga0068852_100718990 3300005616 Bacteria 1010
41 Ga0068852_100998102 3300005616 Bacteria 856
42 Ga0068852_101200674 3300005616 Bacteria 779
43 Ga0068859_100007868 3300005617 Bacteria 10816
44 Ga0068861_100813886 3300005719 Bacteria 878
45 Ga0068863_100004017 3300005841 Bacteria 14528
46 Ga0068858_100011416 3300005842 Bacteria 8386
47 Ga0068860_100001876 3300005843 Bacteria 22333
48 Ga0081540_1032339 3300005983 Bacteria 2859
49 Ga0070717_10296811 3300006028 Bacteria 1436
50 Ga0070717_10537566 3300006028 Bacteria 1058
51 Ga0070717_10878541 3300006028 Bacteria 816
52 Ga0075432_10510752 3300006058 Bacteria 537
53 Ga0070716_101000558 3300006173 Bacteria 661
54 Ga0097620_100007868 3300006931 Bacteria 10816
55 Ga0099794_10174982 3300007265 Bacteria 1094
56 Ga0105240_10050558 3300009093 Bacteria 5239
57 Ga0105240_10068342 3300009093 Bacteria 4401
58 Ga0105240_12664124 3300009093 Bacteria 516
59 Ga0105245_10347757 3300009098 Bacteria 1468
60 Ga0105247_10004967 3300009101 Bacteria 8456
61 Ga0105248_11096835 3300009177 Bacteria 900
62 Ga0105237_10132924 3300009545 Bacteria 2483
63 Ga0105237_12551431 3300009545 Bacteria 522
64 Ga0105238_10332841 3300009551 Bacteria 1505
65 Ga0105238_12101253 3300009551 Bacteria 599
66 Ga0105239_10047094 3300010375 Bacteria 4725
67 Ga0105239_10342404 3300010375 Bacteria 1687
68 Ga0157338_1040005 3300012515 Bacteria 635
69 Ga0157371_10372526 3300013102 Bacteria 1042
70 Ga0157371_10777330 3300013102 Bacteria 720
71 Ga0157370_10020826 3300013104 Bacteria 6543
72 Ga0157369_10071608 3300013105 Bacteria 3721
73 Ga0157369_11535426 3300013105 Bacteria 677
74 Ga0157374_10830818 3300013296 Bacteria 940
75 Ga0157372_10000172 3300013307 Bacteria 71944
76 Ga0157372_10062512 3300013307 Bacteria 4172
77 Ga0157372_10795034 3300013307 Bacteria 1099
78 Ga0157372_12832451 3300013307 Bacteria 556
79 Ga0163163_10650221 3300014325 Bacteria 1118
80 Ga0157380_10881877 3300014326 Bacteria 919
81 Ga0182008_10218154 3300014497 Bacteria 975
82 Ga0182008_10441717 3300014497 Bacteria 706
83 Ga0157379_10009529 3300014968 Bacteria 8455
84 Ga0157379_10948671 3300014968 Bacteria 818
85 Ga0157379_11348950 3300014968 Bacteria 690
86 Ga0197907_10309151 3300020069 Bacteria 1244
87 Ga0197907_11075397 3300020069 Bacteria 1319
88 Ga0206351_10284987 3300020077 Bacteria 538
89 Ga0206354_10246268 3300020081 Bacteria 948
90 Ga0206354_10426536 3300020081 Bacteria 1376
91 Ga0206354_11668439 3300020081 Bacteria 837
92 Ga0206353_10092848 3300020082 Bacteria 1557
93 Ga0206353_10123993 3300020082 Bacteria 1128
94 Ga0206353_10913777 3300020082 Bacteria 2307
95 Ga0206353_11017234 3300020082 Bacteria 1093
96 Ga0206353_11748427 3300020082 Bacteria 1402
97 Ga0213875_10023972 3300021388 Bacteria 2912
98 Ga0207710_10310206 3300025900 Bacteria 798
99 Ga0207688_10199036 3300025901 Bacteria 1200
100 Ga0207680_10010755 3300025903 Bacteria 4591
101 Ga0207705_10208523 3300025909 Bacteria 1482
102 Ga0207705_10464631 3300025909 Bacteria 982
103 Ga0207684_10248825 3300025910 Bacteria 1534
104 Ga0207695_10063215 3300025913 Bacteria 3817
105 Ga0207695_10113823 3300025913 Bacteria 2681
106 Ga0207695_10163635 3300025913 Bacteria 2154
107 Ga0207695_10407897 3300025913 Bacteria 1243
108 Ga0207671_10155345 3300025914 Bacteria 1769
109 Ga0207660_10620558 3300025917 Bacteria 881
110 Ga0207662_10648264 3300025918 Bacteria 737
111 Ga0207646_10004517 3300025922 Bacteria 15065
112 Ga0207646_10040386 3300025922 Bacteria 4195
113 Ga0207646_10185491 3300025922 Bacteria 1879
114 Ga0207646_11725741 3300025922 Bacteria 537
115 Ga0207681_10545547 3300025923 Bacteria 954
116 Ga0207694_10155563 3300025924 Bacteria 1844
117 Ga0207694_10615443 3300025924 Bacteria 914
118 Ga0207687_10414546 3300025927 Bacteria 1110
119 Ga0207664_10000003 3300025929 Bacteria 510966
120 Ga0207664_10041577 3300025929 Bacteria 3582
121 Ga0207664_10480822 3300025929 Bacteria 1111
122 Ga0207664_10601103 3300025929 Bacteria 988
123 Ga0207644_10016546 3300025931 Bacteria 4962
124 Ga0207690_10001077 3300025932 Bacteria 17454
125 Ga0207690_11719354 3300025932 Bacteria 524
126 Ga0207709_10705346 3300025935 Bacteria 808
127 Ga0207689_10028581 3300025942 Bacteria 4663
128 Ga0207661_10099233 3300025944 Bacteria 2442
129 Ga0207661_10373987 3300025944 Bacteria 1289
130 Ga0207667_10412946 3300025949 Bacteria 1374
131 Ga0207640_10344879 3300025981 Bacteria 1194
132 Ga0207640_11155105 3300025981 Bacteria 687
133 Ga0207658_10014518 3300025986 Bacteria 5394
134 Ga0207677_10495116 3300026023 Bacteria 1056
135 Ga0207703_10019021 3300026035 Bacteria 5365
136 Ga0207708_10000178 3300026075 Bacteria 50595
137 Ga0207702_10048333 3300026078 Bacteria 3588
138 Ga0207702_11833994 3300026078 Bacteria 598
139 Ga0207641_10010895 3300026088 Bacteria 7450
140 Ga0207675_100565579 3300026118 Bacteria 1137
141 Ga0207698_10407912 3300026142 Bacteria 1300
142 Ga0268266_10008502 3300028379 Bacteria 9122
143 Ga0268266_10385261 3300028379 Bacteria 1323
144 Ga0268264_10000114 3300028381 Bacteria 203211
145 Ga0307410_10229966 3300031852 Bacteria 1431
146 Ga0307412_11553161 3300031911 Bacteria 603
147 Ga0307414_10711233 3300032004 Bacteria 910
148 Ga0373947_0840607 3300035725 Bacteria 627
149 Ga0395899_0267917 3300037312 Bacteria 1166
150 Ga0436364_0937995 3300037853 Bacteria 2680
151 Ga0436365_0353275 3300039437 Bacteria 723
152 Ga0436365_0523735 3300039437 Bacteria 2084
153 Ga0436365_0723170 3300039437 Bacteria 913
154 Ga0436362_0265570 3300039453 Bacteria 514
155 Ga0466969_0184662 3300044656 Bacteria 954
156 Ga0466972_0017707 3300044658 Bacteria 3565
157 Ga0466965_0439184 3300044683 Bacteria 725
158 Ga0466966_0064301 3300044684 Bacteria 2310
159 Ga0466966_0084453 3300044684 Bacteria 1975
160 Ga0466966_0142198 3300044684 Bacteria 1466
161 Ga0466966_0205852 3300044684 Bacteria 1190
162 Ga0466961_0013748 3300044693 Bacteria 5188
163 Ga0466961_0044624 3300044693 Bacteria 2837
164 Ga0466961_0164304 3300044693 Bacteria 1383
165 Ga0466961_0566399 3300044693 Bacteria 684
166 Ga0466963_0185182 3300044694 Bacteria 1454
167 Ga0466963_0272481 3300044694 Bacteria 1189
168 Ga0466963_0423860 3300044694 Bacteria 938
169 Ga0466963_0909421 3300044694 Bacteria 620
170 Ga0466964_0008715 3300044706 Bacteria 3814
171 Ga0466971_0395206 3300044719 Bacteria 673
172 Ga0466968_0033509 3300044735 Bacteria 2141
173 Ga0466968_0306331 3300044735 Bacteria 765
174 Ga0466970_0252852 3300044765 Bacteria 988
175 Ga0466970_0921794 3300044765 Bacteria 514
176 Ga0466957_0229629 3300044842 Bacteria 1228
177 Ga0466957_1308754 3300044842 Bacteria 526
178 Ga0466959_0021110 3300045049 Bacteria 4801
179 Ga0466959_0115320 3300045049 Bacteria 1914
180 Ga0466959_0447519 3300045049 Bacteria 876
181 Ga0466958_0033388 3300045836 Bacteria 3066
182 Ga0466958_0410364 3300045836 Bacteria 875
183 Ga0466958_0689866 3300045836 Bacteria 665
184 Ga0466967_0150806 3300045976 Bacteria 2172
185 Ga0466967_0374655 3300045976 Bacteria 1381
186 Ga0466967_0536358 3300045976 Bacteria 1151
187 Ga0466967_0597436 3300045976 Bacteria 1089
188 Ga0495603_0048716 3300046455 Bacteria 2523
189 Ga0495603_0801396 3300046455 Bacteria 537
190 Ga0495641_0072762 3300046461 Bacteria 1542
191 Ga0495641_0482495 3300046461 Bacteria 565
192 Ga0495580_0321152 3300046472 Bacteria 1052
193 Ga0495639_0547607 3300046475 Bacteria 593
194 Ga0495658_0171496 3300046683 Bacteria 1343
195 Ga0495581_0292522 3300047315 Bacteria 952
196 Ga0495674_0395254 3300047319 Bacteria 1117
197 Ga0496100_0734612 3300048903 Bacteria 771
198 Ga0496101_0117479 3300048904 Bacteria 2008
199 Ga0496102_0000110 3300048905 Bacteria 117178
200 Ga0496102_0004164 3300048905 Bacteria 12237
201 Ga0496102_0045264 3300048905 Bacteria 3995
202 Ga0496102_0047157 3300048905 Bacteria 3914
203 Ga0496103_0000135 3300048906 Bacteria 77221
204 Ga0496103_0020316 3300048906 Bacteria 3989
205 Ga0496103_0065997 3300048906 Bacteria 2258
206 Ga0496104_0048114 3300048907 Bacteria 4021
207 Ga0496105_0123757 3300048908 Bacteria 2132
208 Ga0496105_0607463 3300048908 Bacteria 848
209 Ga0496105_0766056 3300048908 Bacteria 736
210 Ga0496106_0021255 3300048909 Bacteria 4818
211 Ga0496106_0791915 3300048909 Bacteria 752
212 Ga0496107_0349481 3300048910 Bacteria 1100
213 Ga0496108_0008257 3300048911 Bacteria 8446
214 Ga0496108_0200787 3300048911 Bacteria 1731
215 Ga0496108_0569541 3300048911 Bacteria 987
216 Ga0496109_0021420 3300048912 Bacteria 5715
217 Ga0496109_0031721 3300048912 Bacteria 4745
218 Ga0496109_0777959 3300048912 Bacteria 895
219 Ga0496109_1292022 3300048912 Bacteria 666
220 Ga0496110_0073872 3300048913 Bacteria 3026
221 Ga0496111_0293566 3300048914 Bacteria 1205
222 Ga0496111_0546626 3300048914 Bacteria 850
223 Ga0496112_0163241 3300048915 Bacteria 2194
224 Ga0496112_0238834 3300048915 Bacteria 1770
225 Ga0496112_0801098 3300048915 Bacteria 867
226 Ga0496113_0094704 3300048916 Bacteria 2307
227 Ga0496113_0194779 3300048916 Bacteria 1609
228 Ga0496114_0151373 3300048917 Bacteria 2013
229 Ga0496118_0007310 3300048921 Bacteria 11749
230 Ga0496121_0016104 3300048924 Bacteria 7748
231 Ga0496126_0156906 3300048929 Bacteria 1947
232 Ga0496126_0957480 3300048929 Bacteria 645
233 Ga0501031_0568485 3300049568 Bacteria 730
234 Ga0501038_0581912 3300049574 Bacteria 849
235 Ga0501039_0289063 3300049575 Bacteria 1289
236 Ga0501041_0193940 3300049577 Bacteria 1273
237 Ga0501041_0570593 3300049577 Bacteria 722
238 Ga0501042_0242009 3300049578 Bacteria 1302
239 Ga0501042_0962249 3300049578 Bacteria 622
240 Ga0501048_0424414 3300049582 Bacteria 951
241 Ga0501069_0048666 3300049585 Bacteria 2355
242 Ga0501069_0059586 3300049585 Bacteria 2130
243 Ga0501069_0160732 3300049585 Bacteria 1293
244 Ga0501070_0009842 3300049586 Bacteria 8084
245 Ga0501071_0028868 3300049587 Bacteria 3911
246 Ga0501076_1143879 3300049592 Bacteria 641
247 Ga0501079_0402322 3300049741 Bacteria 1074
248 Ga0501079_1006104 3300049741 Bacteria 657
249 Ga0501045_0149143 3300049824 Bacteria 1740
250 Ga0495595_0494409 3300053084 Bacteria 623
251 Ga0501082_1694540 3300060353 Bacteria 552
252 Ga0530510_0018900 3300061734 Bacteria 4887
253 Ga0530510_0535395 3300061734 Bacteria 889

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10229966 Ga0307410_102299662 115
2 3300032004 Ga0307414_10711233 Ga0307414_107112331 115
3 3300025913 Ga0207695_10113823 Ga0207695_101138233 118
4 3300048912 Ga0496109_0777959 Ga0496109_0777959_363_854 118
5 3300048915 Ga0496112_0801098 Ga0496112_0801098_10_501 118
6 3300005441 Ga0070700_100000117 Ga0070700_10000011728 119
7 3300025922 Ga0207646_11725741 Ga0207646_117257411 119
8 3300026075 Ga0207708_10000178 Ga0207708_1000017819 119
9 3300005327 Ga0070658_10022842 Ga0070658_100228424 120
10 3300005329 Ga0070683_100047356 Ga0070683_1000473563 120
11 3300005329 Ga0070683_102408506 Ga0070683_1024085061 120
12 3300005535 Ga0070684_100158785 Ga0070684_1001587852 120
13 3300005563 Ga0068855_100572291 Ga0068855_1005722912 120
14 3300009093 Ga0105240_12664124 Ga0105240_126641241 120
15 3300013105 Ga0157369_11535426 Ga0157369_115354261 120
16 3300020069 Ga0197907_11075397 Ga0197907_110753972 120
17 3300020081 Ga0206354_10246268 Ga0206354_102462682 120
18 3300020082 Ga0206353_10123993 Ga0206353_101239932 120
19 3300020082 Ga0206353_11748427 Ga0206353_117484273 120
20 3300025917 Ga0207660_10620558 Ga0207660_106205582 120
21 3300025949 Ga0207667_10412946 Ga0207667_104129463 120
22 3300005329 Ga0070683_100582800 Ga0070683_1005828001 121
23 3300005335 Ga0070666_10004556 Ga0070666_100045564 121
24 3300005347 Ga0070668_100035763 Ga0070668_1000357632 121
25 3300005355 Ga0070671_100194099 Ga0070671_1001940992 121
26 3300005435 Ga0070714_101136003 Ga0070714_1011360032 121
27 3300005435 Ga0070714_101543417 Ga0070714_1015434171 121
28 3300005436 Ga0070713_100300850 Ga0070713_1003008502 121
29 3300005548 Ga0070665_100002489 Ga0070665_1000024895 121
30 3300005548 Ga0070665_100256681 Ga0070665_1002566812 121
31 3300005616 Ga0068852_101200674 Ga0068852_1012006741 121
32 3300005841 Ga0068863_100004017 Ga0068863_1000040176 121
33 3300005842 Ga0068858_100011416 Ga0068858_1000114167 121
34 3300005843 Ga0068860_100001876 Ga0068860_10000187615 121
35 3300005983 Ga0081540_1032339 Ga0081540_10323394 121
36 3300006028 Ga0070717_10878541 Ga0070717_108785412 121
37 3300009177 Ga0105248_11096835 Ga0105248_110968351 121
38 3300013307 Ga0157372_12832451 Ga0157372_128324512 121
39 3300014325 Ga0163163_10650221 Ga0163163_106502211 121
40 3300014968 Ga0157379_10009529 Ga0157379_100095297 121
41 3300025903 Ga0207680_10010755 Ga0207680_100107554 121
42 3300025931 Ga0207644_10016546 Ga0207644_100165463 121
43 3300026035 Ga0207703_10019021 Ga0207703_100190215 121
44 3300026088 Ga0207641_10010895 Ga0207641_100108954 121
45 3300028379 Ga0268266_10008502 Ga0268266_100085029 121
46 3300028381 Ga0268264_10000114 Ga0268264_10000114192 121
47 3300013296 Ga0157374_10830818 Ga0157374_108308181 122
48 3300025944 Ga0207661_10373987 Ga0207661_103739872 122
49 3300044706 Ga0466964_0008715 Ga0466964_0008715_1040_1414 122
50 3300045976 Ga0466967_0150806 Ga0466967_0150806_497_871 122
51 3300045976 Ga0466967_0374655 Ga0466967_0374655_961_1335 122
52 3300047319 Ga0495674_0395254 Ga0495674_0395254_653_1033 122
53 3300048905 Ga0496102_0004164 Ga0496102_0004164_5506_5889 122
54 3300048905 Ga0496102_0047157 Ga0496102_0047157_797_1186 122
55 3300048906 Ga0496103_0020316 Ga0496103_0020316_2785_3168 122
56 3300048907 Ga0496104_0048114 Ga0496104_0048114_3052_3426 122
57 3300048908 Ga0496105_0607463 Ga0496105_0607463_28_402 122
58 3300048911 Ga0496108_0008257 Ga0496108_0008257_7242_7616 122
59 3300048912 Ga0496109_0021420 Ga0496109_0021420_3057_3431 122
60 3300048914 Ga0496111_0546626 Ga0496111_0546626_393_767 122
61 3300048915 Ga0496112_0163241 Ga0496112_0163241_1803_2177 122
62 3300048916 Ga0496113_0094704 Ga0496113_0094704_1637_2011 122
63 3300048924 Ga0496121_0016104 Ga0496121_0016104_5591_5980 122
64 3300053084 Ga0495595_0494409 Ga0495595_0494409_144_524 122
65 3300005578 Ga0068854_100135133 Ga0068854_1001351333 123
66 3300005614 Ga0068856_100061297 Ga0068856_1000612973 123
67 3300009093 Ga0105240_10050558 Ga0105240_100505583 123
68 3300009093 Ga0105240_10068342 Ga0105240_100683423 123
69 3300009545 Ga0105237_10132924 Ga0105237_101329243 123
70 3300009551 Ga0105238_10332841 Ga0105238_103328411 123
71 3300009551 Ga0105238_12101253 Ga0105238_121012532 123
72 3300010375 Ga0105239_10047094 Ga0105239_100470944 123
73 3300020069 Ga0197907_10309151 Ga0197907_103091512 123
74 3300025913 Ga0207695_10063215 Ga0207695_100632152 123
75 3300025913 Ga0207695_10163635 Ga0207695_101636353 123
76 3300025913 Ga0207695_10407897 Ga0207695_104078972 123
77 3300025914 Ga0207671_10155345 Ga0207671_101553453 123
78 3300025924 Ga0207694_10155563 Ga0207694_101555633 123
79 3300025981 Ga0207640_10344879 Ga0207640_103448792 123
80 3300025986 Ga0207658_10014518 Ga0207658_100145183 123
81 3300026078 Ga0207702_10048333 Ga0207702_100483333 123
82 3300044684 Ga0466966_0084453 Ga0466966_0084453_1477_1854 123
83 3300044765 Ga0466970_0252852 Ga0466970_0252852_255_632 123
84 3300045049 Ga0466959_0115320 Ga0466959_0115320_1456_1833 123
85 3300048929 Ga0496126_0957480 Ga0496126_0957480_160_537 123
86 3300005345 Ga0070692_10462687 Ga0070692_104626872 124
87 3300005445 Ga0070708_100626329 Ga0070708_1006263291 124
88 3300005467 Ga0070706_100241925 Ga0070706_1002419252 124
89 3300005468 Ga0070707_100847120 Ga0070707_1008471202 124
90 3300020082 Ga0206353_10092848 Ga0206353_100928483 124
91 3300039437 Ga0436365_0353275 Ga0436365_0353275_51_431 124
92 3300039437 Ga0436365_0523735 Ga0436365_0523735_818_1198 124
93 3300039437 Ga0436365_0723170 Ga0436365_0723170_338_718 124
94 3300039453 Ga0436362_0265570 Ga0436362_0265570_117_497 124
95 3300044735 Ga0466968_0033509 Ga0466968_0033509_905_1288 124
96 3300048929 Ga0496126_0156906 Ga0496126_0156906_570_953 124
97 3300002067 JGI24735J21928_10020712 JGI24735J21928_100207122 125
98 3300005339 Ga0070660_101179525 Ga0070660_1011795251 125
99 3300005366 Ga0070659_101283197 Ga0070659_1012831972 125
100 3300005435 Ga0070714_100000050 Ga0070714_10000005021 125
101 3300005435 Ga0070714_100763674 Ga0070714_1007636741 125
102 3300005578 Ga0068854_101593229 Ga0068854_1015932291 125
103 3300005617 Ga0068859_100007868 Ga0068859_1000078689 125
104 3300006931 Ga0097620_100007868 Ga0097620_1000078689 125
105 3300009101 Ga0105247_10004967 Ga0105247_100049679 125
106 3300013104 Ga0157370_10020826 Ga0157370_100208264 125
107 3300013307 Ga0157372_10000172 Ga0157372_1000017242 125
108 3300014968 Ga0157379_11348950 Ga0157379_113489502 125
109 3300020077 Ga0206351_10284987 Ga0206351_102849871 125
110 3300020081 Ga0206354_11668439 Ga0206354_116684392 125
111 3300020082 Ga0206353_10913777 Ga0206353_109137772 125
112 3300025900 Ga0207710_10310206 Ga0207710_103102062 125
113 3300025909 Ga0207705_10464631 Ga0207705_104646311 125
114 3300025927 Ga0207687_10414546 Ga0207687_104145462 125
115 3300025929 Ga0207664_10000003 Ga0207664_10000003293 125
116 3300025929 Ga0207664_10601103 Ga0207664_106011032 125
117 3300025932 Ga0207690_11719354 Ga0207690_117193541 125
118 3300025981 Ga0207640_11155105 Ga0207640_111551052 125
119 3300028379 Ga0268266_10385261 Ga0268266_103852612 125
120 3300031911 Ga0307412_11553161 Ga0307412_115531612 125
121 3300044656 Ga0466969_0184662 Ga0466969_0184662_112_516 125
122 3300044658 Ga0466972_0017707 Ga0466972_0017707_2760_3164 125
123 3300044684 Ga0466966_0064301 Ga0466966_0064301_1584_1970 125
124 3300044684 Ga0466966_0205852 Ga0466966_0205852_310_705 125
125 3300044693 Ga0466961_0013748 Ga0466961_0013748_3673_4077 125
126 3300044693 Ga0466961_0044624 Ga0466961_0044624_613_1008 125
127 3300044693 Ga0466961_0164304 Ga0466961_0164304_654_1040 125
128 3300044694 Ga0466963_0272481 Ga0466963_0272481_539_916 125
129 3300044694 Ga0466963_0423860 Ga0466963_0423860_80_466 125
130 3300044694 Ga0466963_0909421 Ga0466963_0909421_146_544 125
131 3300044842 Ga0466957_1308754 Ga0466957_1308754_44_445 125
132 3300045049 Ga0466959_0021110 Ga0466959_0021110_2909_3295 125
133 3300045049 Ga0466959_0447519 Ga0466959_0447519_215_619 125
134 3300045836 Ga0466958_0410364 Ga0466958_0410364_344_739 125
135 3300045976 Ga0466967_0597436 Ga0466967_0597436_378_776 125
136 3300046472 Ga0495580_0321152 Ga0495580_0321152_568_960 125
137 3300047315 Ga0495581_0292522 Ga0495581_0292522_288_680 125
138 3300048905 Ga0496102_0000110 Ga0496102_0000110_60320_60730 125
139 3300048906 Ga0496103_0000135 Ga0496103_0000135_33632_34042 125
140 3300048909 Ga0496106_0791915 Ga0496106_0791915_221_631 125
141 3300048921 Ga0496118_0007310 Ga0496118_0007310_5551_5961 125
142 3300049577 Ga0501041_0193940 Ga0501041_0193940_584_961 125
143 3300049578 Ga0501042_0242009 Ga0501042_0242009_52_429 125
144 3300049741 Ga0501079_0402322 Ga0501079_0402322_317_694 125
145 3300000041 ARcpr5oldR_c008352 ARcpr5oldR_0083521 126
146 3300005329 Ga0070683_100097855 Ga0070683_1000978555 126
147 3300005334 Ga0068869_100019477 Ga0068869_1000194772 126
148 3300005337 Ga0070682_100034361 Ga0070682_1000343615 126
149 3300005338 Ga0068868_100009065 Ga0068868_1000090655 126
150 3300005338 Ga0068868_100701304 Ga0068868_1007013042 126
151 3300005366 Ga0070659_100000794 Ga0070659_10000079410 126
152 3300005406 Ga0070703_10249222 Ga0070703_102492221 126
153 3300005468 Ga0070707_100085363 Ga0070707_1000853634 126
154 3300005535 Ga0070684_100115562 Ga0070684_1001155625 126
155 3300005547 Ga0070693_100381214 Ga0070693_1003812142 126
156 3300005614 Ga0068856_100378513 Ga0068856_1003785132 126
157 3300005616 Ga0068852_100718990 Ga0068852_1007189901 126
158 3300005616 Ga0068852_100998102 Ga0068852_1009981022 126
159 3300005719 Ga0068861_100813886 Ga0068861_1008138862 126
160 3300006028 Ga0070717_10296811 Ga0070717_102968112 126
161 3300006028 Ga0070717_10537566 Ga0070717_105375662 126
162 3300006058 Ga0075432_10510752 Ga0075432_105107522 126
163 3300006173 Ga0070716_101000558 Ga0070716_1010005582 126
164 3300007265 Ga0099794_10174982 Ga0099794_101749822 126
165 3300009098 Ga0105245_10347757 Ga0105245_103477572 126
166 3300009545 Ga0105237_12551431 Ga0105237_125514311 126
167 3300010375 Ga0105239_10342404 Ga0105239_103424042 126
168 3300012515 Ga0157338_1040005 Ga0157338_10400052 126
169 3300013102 Ga0157371_10372526 Ga0157371_103725262 126
170 3300013102 Ga0157371_10777330 Ga0157371_107773302 126
171 3300013105 Ga0157369_10071608 Ga0157369_100716084 126
172 3300013307 Ga0157372_10062512 Ga0157372_100625125 126
173 3300013307 Ga0157372_10795034 Ga0157372_107950342 126
174 3300014326 Ga0157380_10881877 Ga0157380_108818772 126
175 3300014497 Ga0182008_10218154 Ga0182008_102181542 126
176 3300014497 Ga0182008_10441717 Ga0182008_104417172 126
177 3300014968 Ga0157379_10948671 Ga0157379_109486711 126
178 3300020081 Ga0206354_10426536 Ga0206354_104265363 126
179 3300020082 Ga0206353_11017234 Ga0206353_110172341 126
180 3300021388 Ga0213875_10023972 Ga0213875_100239725 126
181 3300025901 Ga0207688_10199036 Ga0207688_101990363 126
182 3300025909 Ga0207705_10208523 Ga0207705_102085233 126
183 3300025910 Ga0207684_10248825 Ga0207684_102488253 126
184 3300025918 Ga0207662_10648264 Ga0207662_106482642 126
185 3300025922 Ga0207646_10004517 Ga0207646_100045178 126
186 3300025922 Ga0207646_10040386 Ga0207646_100403861 126
187 3300025922 Ga0207646_10185491 Ga0207646_101854912 126
188 3300025923 Ga0207681_10545547 Ga0207681_105455472 126
189 3300025924 Ga0207694_10615443 Ga0207694_106154431 126
190 3300025929 Ga0207664_10041577 Ga0207664_100415775 126
191 3300025929 Ga0207664_10480822 Ga0207664_104808222 126
192 3300025932 Ga0207690_10001077 Ga0207690_100010773 126
193 3300025935 Ga0207709_10705346 Ga0207709_107053462 126
194 3300025942 Ga0207689_10028581 Ga0207689_100285815 126
195 3300025944 Ga0207661_10099233 Ga0207661_100992332 126
196 3300026023 Ga0207677_10495116 Ga0207677_104951162 126
197 3300026078 Ga0207702_11833994 Ga0207702_118339941 126
198 3300026118 Ga0207675_100565579 Ga0207675_1005655792 126
199 3300026142 Ga0207698_10407912 Ga0207698_104079122 126
200 3300035725 Ga0373947_0840607 Ga0373947_0840607_233_613 126
201 3300037312 Ga0395899_0267917 Ga0395899_0267917_321_701 126
202 3300037853 Ga0436364_0937995 Ga0436364_0937995_1613_1993 126
203 3300044683 Ga0466965_0439184 Ga0466965_0439184_262_642 126
204 3300044684 Ga0466966_0142198 Ga0466966_0142198_502_903 126
205 3300044693 Ga0466961_0566399 Ga0466961_0566399_185_598 126
206 3300044694 Ga0466963_0185182 Ga0466963_0185182_734_1120 126
207 3300044719 Ga0466971_0395206 Ga0466971_0395206_142_555 126
208 3300044735 Ga0466968_0306331 Ga0466968_0306331_153_605 126
209 3300044765 Ga0466970_0921794 Ga0466970_0921794_30_443 126
210 3300044842 Ga0466957_0229629 Ga0466957_0229629_639_1025 126
211 3300045836 Ga0466958_0033388 Ga0466958_0033388_631_1032 126
212 3300045836 Ga0466958_0689866 Ga0466958_0689866_226_639 126
213 3300045976 Ga0466967_0536358 Ga0466967_0536358_59_439 126
214 3300046455 Ga0495603_0048716 Ga0495603_0048716_1034_1414 126
215 3300046455 Ga0495603_0801396 Ga0495603_0801396_26_406 126
216 3300046461 Ga0495641_0072762 Ga0495641_0072762_805_1185 126
217 3300046461 Ga0495641_0482495 Ga0495641_0482495_169_549 126
218 3300046475 Ga0495639_0547607 Ga0495639_0547607_74_454 126
219 3300046683 Ga0495658_0171496 Ga0495658_0171496_44_424 126
220 3300048903 Ga0496100_0734612 Ga0496100_0734612_227_607 126
221 3300048904 Ga0496101_0117479 Ga0496101_0117479_887_1267 126
222 3300048905 Ga0496102_0045264 Ga0496102_0045264_816_1196 126
223 3300048906 Ga0496103_0065997 Ga0496103_0065997_784_1164 126
224 3300048908 Ga0496105_0123757 Ga0496105_0123757_1609_1989 126
225 3300048908 Ga0496105_0766056 Ga0496105_0766056_183_563 126
226 3300048909 Ga0496106_0021255 Ga0496106_0021255_2594_2974 126
227 3300048910 Ga0496107_0349481 Ga0496107_0349481_233_613 126
228 3300048911 Ga0496108_0200787 Ga0496108_0200787_955_1341 126
229 3300048911 Ga0496108_0569541 Ga0496108_0569541_295_675 126
230 3300048912 Ga0496109_0031721 Ga0496109_0031721_910_1377 126
231 3300048912 Ga0496109_1292022 Ga0496109_1292022_85_471 126
232 3300048913 Ga0496110_0073872 Ga0496110_0073872_794_1174 126
233 3300048914 Ga0496111_0293566 Ga0496111_0293566_372_752 126
234 3300048915 Ga0496112_0238834 Ga0496112_0238834_1372_1752 126
235 3300048916 Ga0496113_0194779 Ga0496113_0194779_585_965 126
236 3300048917 Ga0496114_0151373 Ga0496114_0151373_24_404 126
237 3300049568 Ga0501031_0568485 Ga0501031_0568485_188_568 126
238 3300049574 Ga0501038_0581912 Ga0501038_0581912_90_470 126
239 3300049575 Ga0501039_0289063 Ga0501039_0289063_335_715 126
240 3300049577 Ga0501041_0570593 Ga0501041_0570593_219_599 126
241 3300049578 Ga0501042_0962249 Ga0501042_0962249_41_424 126
242 3300049582 Ga0501048_0424414 Ga0501048_0424414_393_773 126
243 3300049585 Ga0501069_0048666 Ga0501069_0048666_516_896 126
244 3300049585 Ga0501069_0059586 Ga0501069_0059586_1585_1986 126
245 3300049585 Ga0501069_0160732 Ga0501069_0160732_429_809 126
246 3300049586 Ga0501070_0009842 Ga0501070_0009842_1445_1846 126
247 3300049587 Ga0501071_0028868 Ga0501071_0028868_100_483 126
248 3300049592 Ga0501076_1143879 Ga0501076_1143879_46_453 126
249 3300049741 Ga0501079_1006104 Ga0501079_1006104_31_411 126
250 3300049824 Ga0501045_0149143 Ga0501045_0149143_325_705 126
251 3300060353 Ga0501082_1694540 Ga0501082_1694540_57_437 126
252 3300061734 Ga0530510_0018900 Ga0530510_0018900_2841_3221 126
253 3300061734 Ga0530510_0535395 Ga0530510_0535395_70_450 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

12

105

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2id1-assembly2.cif.gz_B x-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5. 0.9559 9 109
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9462 2 117
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9434 2 112
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9307 2 117
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9273 2 112
ID Description Score Start End Superfamily
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9503 9 108 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9499 9 108 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9465 2 112 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9383 2 112 3.30.460.10
2o5aB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9124 9 108 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A3C1P1Q4-F1-model_v4 Ribosome silencing factor 0.9906 1 100 GO:0017148
GO:0043023
GO:0090071
AF-A0A6L6EXU6-F1-model_v4 Ribosomal silencing factor RsfS 0.9844 1 120 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A0B2B662-F1-model_v4 Ribosomal silencing factor RsfS 0.9839 1 119 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A1G9DMX0-F1-model_v4 Ribosomal silencing factor RsfS 0.9837 1 122 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A7K0Q5X6-F1-model_v4 Ribosomal silencing factor RsfS 0.9834 1 120 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Feature Viewer

pLDDT pTM Quality
84.43 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map