F363982

General Info

Members Datasets Scaffolds Average Seq Length
253 166 506 120

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10003175|Ga0099794_100031752
Length 138
Sequence MPSKRIRVLIAKPGLDGHDRGAKIIARALRDAGMEVIYTGLRQTPEMIASAAVQEDVDVIGLSILSGAHKTLAPQLMGLLQKKGMLDVTVLLGGTIPRNDIPALKKAGIAEVFLPGTSMQDIVDFVRRVTADKPTPTL

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 4.35
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10003175 3300007265 Bacteria 6228
2 Ga0070690_101295353 3300005330 Bacteria 584
3 Ga0070670_100052133 3300005331 Bacteria 3514
4 Ga0070670_100737377 3300005331 Bacteria 887
5 Ga0070670_101044342 3300005331 Bacteria 744
6 Ga0068869_100834977 3300005334 Bacteria 794
7 Ga0070666_10002695 3300005335 Bacteria 10713
8 Ga0068868_100288894 3300005338 Bacteria 1390
9 Ga0070669_100161218 3300005353 Bacteria 1743
10 Ga0070675_100004709 3300005354 Bacteria 10413
11 Ga0070675_100308336 3300005354 Bacteria 1396
12 Ga0070675_101403087 3300005354 Bacteria 644
13 Ga0070671_100607281 3300005355 Bacteria 945
14 Ga0070671_100624146 3300005355 Unclassified 932
15 Ga0070673_100073505 3300005364 Bacteria 2752
16 Ga0070673_100269128 3300005364 Bacteria 1491
17 Ga0070659_100487765 3300005366 Bacteria 1049
18 Ga0070667_100000479 3300005367 Bacteria 40998
19 Ga0070667_100358776 3300005367 Bacteria 1321
20 Ga0070714_100046564 3300005435 Bacteria 3680
21 Ga0070714_100808517 3300005435 Bacteria 908
22 Ga0070713_100313645 3300005436 Bacteria 1447
23 Ga0070705_100160145 3300005440 Bacteria 1503
24 Ga0070705_100496954 3300005440 Bacteria 925
25 Ga0070694_101559049 3300005444 Bacteria 560
26 Ga0070708_100498323 3300005445 Bacteria 1149
27 Ga0070663_100188241 3300005455 Bacteria 1605
28 Ga0070678_100023055 3300005456 Bacteria 4140
29 Ga0068867_100021236 3300005459 Bacteria 4632
30 Ga0068867_100915671 3300005459 Bacteria 790
31 Ga0070685_10058998 3300005466 Bacteria 2239
32 Ga0070706_100037890 3300005467 Bacteria 4451
33 Ga0070706_100068753 3300005467 Bacteria 3275
34 Ga0070706_100072599 3300005467 Bacteria 3184
35 Ga0070706_100250089 3300005467 Bacteria 1655
36 Ga0070706_100980292 3300005467 Bacteria 780
37 Ga0070706_101090688 3300005467 Bacteria 735
38 Ga0070706_101871472 3300005467 Bacteria 545
39 Ga0070707_100002239 3300005468 Bacteria 18472
40 Ga0070707_100026755 3300005468 Bacteria 5480
41 Ga0070707_100204472 3300005468 Bacteria 1925
42 Ga0070707_100654852 3300005468 Bacteria 1013
43 Ga0070698_100008509 3300005471 Bacteria 11077
44 Ga0070698_100145883 3300005471 Bacteria 2316
45 Ga0070698_100269135 3300005471 Bacteria 1635
46 Ga0070699_100115401 3300005518 Bacteria 2360
47 Ga0070699_100602148 3300005518 Bacteria 1002
48 Ga0070699_100824658 3300005518 Bacteria 849
49 Ga0070697_100403666 3300005536 Bacteria 1186
50 Ga0068853_100346683 3300005539 Bacteria 1381
51 Ga0070672_100075087 3300005543 Bacteria 2698
52 Ga0070696_100187486 3300005546 Bacteria 1538
53 Ga0070665_100148944 3300005548 Bacteria 2343
54 Ga0070665_100834379 3300005548 Bacteria 935
55 Ga0070704_100024965 3300005549 Bacteria 3928
56 Ga0070704_100065249 3300005549 Bacteria 2620
57 Ga0070664_100016317 3300005564 Bacteria 6088
58 Ga0068857_100103060 3300005577 Bacteria 2562
59 Ga0068857_101775269 3300005577 Bacteria 604
60 Ga0068856_100003374 3300005614 Bacteria 16168
61 Ga0068852_100309402 3300005616 Unclassified 1531
62 Ga0068859_100002201 3300005617 Bacteria 19792
63 Ga0068859_100108683 3300005617 Bacteria 2835
64 Ga0068859_100118288 3300005617 Bacteria 2716
65 Ga0068864_100058284 3300005618 Bacteria 3337
66 Ga0068864_100294792 3300005618 Bacteria 1517
67 Ga0068864_100797288 3300005618 Bacteria 928
68 Ga0068863_100023942 3300005841 Bacteria 5827
69 Ga0068858_100001827 3300005842 Bacteria 21672
70 Ga0068858_100942756 3300005842 Bacteria 845
71 Ga0068860_100000487 3300005843 Bacteria 48973
72 Ga0081455_10093483 3300005937 Bacteria 2431
73 Ga0070717_11567419 3300006028 Bacteria 597
74 Ga0075364_10099688 3300006051 Bacteria 1934
75 Ga0070712_100139191 3300006175 Bacteria 1850
76 Ga0070712_100193319 3300006175 Bacteria 1594
77 Ga0075430_100010989 3300006846 Bacteria 7669
78 Ga0075431_101035992 3300006847 Bacteria 787
79 Ga0075433_10001190 3300006852 Bacteria 18920
80 Ga0075434_100000574 3300006871 Bacteria 28276
81 Ga0075434_100037231 3300006871 Bacteria 4816
82 Ga0075434_102394664 3300006871 Bacteria 530
83 Ga0075429_100748213 3300006880 Bacteria 856
84 Ga0068865_100474426 3300006881 Bacteria 1039
85 Ga0075436_100015979 3300006914 Bacteria 5139
86 Ga0075436_100040698 3300006914 Bacteria 3206
87 Ga0075436_100368691 3300006914 Bacteria 1037
88 Ga0075436_100717802 3300006914 Bacteria 741
89 Ga0097620_100002201 3300006931 Bacteria 19792
90 Ga0097620_100108682 3300006931 Bacteria 2835
91 Ga0097620_100118292 3300006931 Bacteria 2716
92 Ga0075435_100001944 3300007076 Bacteria 13473
93 Ga0099794_10003256 3300007265 Bacteria 6159
94 Ga0099794_10011968 3300007265 Bacteria 3729
95 Ga0099794_10052776 3300007265 Bacteria 1960
96 Ga0099794_10456554 3300007265 Bacteria 670
97 Ga0105240_10010447 3300009093 Bacteria 13043
98 Ga0111539_10054294 3300009094 Bacteria 4768
99 Ga0111539_10158049 3300009094 Bacteria 2652
100 Ga0114129_10051112 3300009147 Bacteria 5803
101 Ga0105242_11671411 3300009176 Bacteria 672
102 Ga0105248_10007283 3300009177 Bacteria 12138
103 Ga0105248_10080347 3300009177 Bacteria 3665
104 Ga0105248_12078795 3300009177 Bacteria 646
105 Ga0105237_10238047 3300009545 Bacteria 1821
106 Ga0105249_11172398 3300009553 Bacteria 839
107 Ga0157371_10812813 3300013102 Bacteria 705
108 Ga0157372_10015820 3300013307 Bacteria 8093
109 Ga0157372_10912037 3300013307 Bacteria 1019
110 Ga0157375_10001888 3300013308 Bacteria 18016
111 Ga0157376_10001472 3300014969 Bacteria 15510
112 Ga0213876_10014798 3300021384 Bacteria 4135
113 Ga0207653_10114888 3300025885 Bacteria 964
114 Ga0207684_10101986 3300025910 Bacteria 2453
115 Ga0207684_10640023 3300025910 Bacteria 906
116 Ga0207684_10715796 3300025910 Bacteria 850
117 Ga0207684_11222616 3300025910 Bacteria 621
118 Ga0207707_10031215 3300025912 Bacteria 4661
119 Ga0207671_10143609 3300025914 Bacteria 1840
120 Ga0207693_10140793 3300025915 Bacteria 1897
121 Ga0207663_10009299 3300025916 Bacteria 5186
122 Ga0207652_10063045 3300025921 Bacteria 3205
123 Ga0207646_10000012 3300025922 Bacteria 367049
124 Ga0207646_10053857 3300025922 Bacteria 3599
125 Ga0207646_10619749 3300025922 Bacteria 970
126 Ga0207646_10686993 3300025922 Bacteria 916
127 Ga0207681_10057809 3300025923 Bacteria 2653
128 Ga0207650_10191050 3300025925 Bacteria 1636
129 Ga0207650_10210954 3300025925 Bacteria 1559
130 Ga0207659_10067753 3300025926 Bacteria 2594
131 Ga0207659_10141673 3300025926 Bacteria 1867
132 Ga0207700_10188579 3300025928 Bacteria 1731
133 Ga0207664_10662807 3300025929 Bacteria 938
134 Ga0207644_11280477 3300025931 Bacteria 616
135 Ga0207690_11543596 3300025932 Bacteria 555
136 Ga0207706_10073197 3300025933 Bacteria 3013
137 Ga0207706_10452505 3300025933 Bacteria 1110
138 Ga0207686_10743862 3300025934 Bacteria 782
139 Ga0207665_10591672 3300025939 Bacteria 865
140 Ga0207711_10001494 3300025941 Bacteria 21777
141 Ga0207711_10226218 3300025941 Bacteria 1713
142 Ga0207689_10015000 3300025942 Bacteria 6572
143 Ga0207658_10018216 3300025986 Bacteria 4845
144 Ga0207677_10035109 3300026023 Bacteria 3253
145 Ga0207703_10011071 3300026035 Bacteria 7027
146 Ga0207639_10187606 3300026041 Bacteria 1764
147 Ga0207678_10012460 3300026067 Bacteria 7467
148 Ga0207678_10128832 3300026067 Bacteria 2158
149 Ga0207702_10008300 3300026078 Bacteria 8777
150 Ga0207641_10060426 3300026088 Bacteria 3230
151 Ga0207641_10354023 3300026088 Bacteria 1400
152 Ga0207648_10115536 3300026089 Bacteria 2358
153 Ga0207676_10115257 3300026095 Bacteria 2256
154 Ga0207674_10931478 3300026116 Bacteria 837
155 Ga0207683_10003888 3300026121 Bacteria 12954
156 Ga0209588_1009993 3300027671 Bacteria 2847
157 Ga0209588_1025140 3300027671 Bacteria 1882
158 Ga0209588_1029645 3300027671 Bacteria 1746
159 Ga0209588_1049016 3300027671 Bacteria 1367
160 Ga0209588_1191104 3300027671 Bacteria 640
161 Ga0207428_10019880 3300027907 Bacteria 5719
162 Ga0268266_10332363 3300028379 Bacteria 1424
163 Ga0268264_10002018 3300028381 Bacteria 18231
164 Ga0316577_10165904 3300031733 Bacteria 1246
165 Ga0373926_0011065 3300035083 Bacteria 3031
166 Ga0373940_0062358 3300035088 Bacteria 1069
167 Ga0373945_0481596 3300035116 Bacteria 551
168 Ga0373954_0048877 3300035118 Bacteria 1982
169 Ga0373954_0128286 3300035118 Bacteria 1234
170 Ga0373946_0016325 3300035171 Bacteria 2828
171 Ga0373927_0000796 3300035695 Bacteria 24077
172 Ga0373947_0023332 3300035725 Bacteria 3597
173 Ga0373925_0001385 3300037068 Bacteria 21098
174 Ga0395905_1453171 3300037471 Bacteria 590
175 Ga0316581_0134269 3300037588 Bacteria 763
176 Ga0436365_0444411 3300039437 Bacteria 2556
177 Ga0436365_1230736 3300039437 Bacteria 1174
178 Ga0436361_0893483 3300039447 Bacteria 1295
179 Ga0451577_0023036 3300042876 Bacteria 5684
180 Ga0453683_0027201 3300044673 Bacteria 3630
181 Ga0453683_0237892 3300044673 Bacteria 1159
182 Ga0453684_0024626 3300044712 Bacteria 8784
183 Ga0453684_0097157 3300044712 Bacteria 3616
184 Ga0466971_0547529 3300044719 Unclassified 574
185 Ga0451576_0343988 3300045051 Bacteria 1562
186 Ga0466967_2130866 3300045976 Bacteria 557
187 Ga0495603_0024073 3300046455 Bacteria 3683
188 Ga0495629_0140045 3300046459 Bacteria 1683
189 Ga0495580_0096195 3300046472 Bacteria 2059
190 Ga0495580_0209261 3300046472 Bacteria 1342
191 Ga0495639_0001946 3300046475 Bacteria 9158
192 Ga0495628_0013020 3300046516 Bacteria 7006
193 Ga0495666_0112831 3300046526 Bacteria 1276
194 Ga0495665_0028582 3300046531 Bacteria 2989
195 Ga0495587_0003414 3300046536 Bacteria 10596
196 Ga0495587_0058756 3300046536 Bacteria 2259
197 Ga0495645_0006097 3300046543 Bacteria 8342
198 Ga0495646_0400615 3300046680 Bacteria 713
199 Ga0495647_0101435 3300046681 Bacteria 1192
200 Ga0495658_0003444 3300046683 Bacteria 7826
201 Ga0495613_0180849 3300046689 Bacteria 1493
202 Ga0495613_0386722 3300046689 Bacteria 956
203 Ga0495624_0063889 3300046690 Bacteria 2301
204 Ga0495581_0024281 3300047315 Bacteria 3513
205 Ga0495604_0252886 3300047317 Bacteria 1200
206 Ga0495674_0176220 3300047319 Bacteria 1782
207 Ga0495676_0006405 3300047321 Bacteria 10846
208 Ga0495675_0122938 3300047444 Bacteria 1615
209 Ga0495602_0085976 3300048088 Bacteria 2626
210 Ga0496101_0003269 3300048904 Bacteria 10071
211 Ga0496107_0002105 3300048910 Bacteria 12748
212 Ga0496107_0628651 3300048910 Bacteria 792
213 Ga0496108_0374272 3300048911 Bacteria 1243
214 Ga0496110_0029599 3300048913 Bacteria 4715
215 Ga0496112_0056046 3300048915 Bacteria 3878
216 Ga0496112_0222779 3300048915 Bacteria 1842
217 Ga0496112_0674778 3300048915 Bacteria 962
218 Ga0496112_0753749 3300048915 Bacteria 900
219 Ga0496115_0199682 3300048918 Bacteria 1652
220 Ga0496115_0778127 3300048918 Bacteria 746
221 Ga0501032_1069022 3300049569 Bacteria 506
222 Ga0501041_0711354 3300049577 Bacteria 643
223 Ga0501042_0517142 3300049578 Bacteria 867
224 Ga0501042_0611193 3300049578 Bacteria 793
225 Ga0501067_0157488 3300049583 Bacteria 1265
226 Ga0501070_0866757 3300049586 Bacteria 706
227 Ga0501071_0052712 3300049587 Bacteria 2934
228 Ga0501076_0193324 3300049592 Bacteria 1661
229 Ga0501077_0221751 3300049593 Bacteria 1202
230 Ga0501079_1102771 3300049741 Bacteria 625
231 Ga0501081_0439756 3300049743 Bacteria 968
232 nmdc:mga05p37_518_c1 3300050507 Bacteria 17205
233 nmdc:mga0qj67_4482_c1 3300050509 Bacteria 10116
234 nmdc:mga06r32_966046_c1 3300050510 Bacteria 806
235 nmdc:mga08y16_29012_c1 3300050511 Bacteria 5832
236 nmdc:mga08y16_46220_c1 3300050511 Bacteria 4558
237 nmdc:mga0n895_1911240_c1 3300050512 Bacteria 552
238 nmdc:mga0n895_294_c1 3300050512 Bacteria 32959
239 nmdc:mga0n895_6036_c1 3300050512 Bacteria 10211
240 nmdc:mga0rr50_18309_c1 3300050513 Bacteria 4701
241 nmdc:mga0rr50_184650_c1 3300050513 Bacteria 1706
242 nmdc:mga0rr50_491_c1 3300050513 Bacteria 21035
243 nmdc:mga08x19_1215286_c1 3300050514 Bacteria 534
244 nmdc:mga08x19_234071_c1 3300050514 Bacteria 1265
245 nmdc:mga08x19_38099_c1 3300050514 Bacteria 3053
246 nmdc:mga08x19_389_c1 3300050514 Bacteria 30909
247 nmdc:mga08x19_393150_c1 3300050514 Bacteria 972
248 nmdc:mga08x19_509504_c1 3300050514 Bacteria 850
249 nmdc:mga0a205_165053_c1 3300050515 Bacteria 2110
250 nmdc:mga0a205_565_c1 3300050515 Bacteria 29440
251 Ga0495601_0016915 3300053077 Bacteria 4424
252 Ga0495619_0175747 3300053085 Bacteria 1481
253 Ga0500643_000698 3300053087 Bacteria 22326
254 Ga0099794_10003175
255 Ga0070690_101295353
256 Ga0070670_100052133
257 Ga0070670_100737377
258 Ga0070670_101044342
259 Ga0068869_100834977
260 Ga0070666_10002695
261 Ga0068868_100288894
262 Ga0070669_100161218
263 Ga0070675_100004709
264 Ga0070675_100308336
265 Ga0070675_101403087
266 Ga0070671_100607281
267 Ga0070671_100624146
268 Ga0070673_100073505
269 Ga0070673_100269128
270 Ga0070659_100487765
271 Ga0070667_100000479
272 Ga0070667_100358776
273 Ga0070714_100046564
274 Ga0070714_100808517
275 Ga0070713_100313645
276 Ga0070705_100160145
277 Ga0070705_100496954
278 Ga0070694_101559049
279 Ga0070708_100498323
280 Ga0070663_100188241
281 Ga0070678_100023055
282 Ga0068867_100021236
283 Ga0068867_100915671
284 Ga0070685_10058998
285 Ga0070706_100037890
286 Ga0070706_100068753
287 Ga0070706_100072599
288 Ga0070706_100250089
289 Ga0070706_100980292
290 Ga0070706_101090688
291 Ga0070706_101871472
292 Ga0070707_100002239
293 Ga0070707_100026755
294 Ga0070707_100204472
295 Ga0070707_100654852
296 Ga0070698_100008509
297 Ga0070698_100145883
298 Ga0070698_100269135
299 Ga0070699_100115401
300 Ga0070699_100602148
301 Ga0070699_100824658
302 Ga0070697_100403666
303 Ga0068853_100346683
304 Ga0070672_100075087
305 Ga0070696_100187486
306 Ga0070665_100148944
307 Ga0070665_100834379
308 Ga0070704_100024965
309 Ga0070704_100065249
310 Ga0070664_100016317
311 Ga0068857_100103060
312 Ga0068857_101775269
313 Ga0068856_100003374
314 Ga0068852_100309402
315 Ga0068859_100002201
316 Ga0068859_100108683
317 Ga0068859_100118288
318 Ga0068864_100058284
319 Ga0068864_100294792
320 Ga0068864_100797288
321 Ga0068863_100023942
322 Ga0068858_100001827
323 Ga0068858_100942756
324 Ga0068860_100000487
325 Ga0081455_10093483
326 Ga0070717_11567419
327 Ga0075364_10099688
328 Ga0070712_100139191
329 Ga0070712_100193319
330 Ga0075430_100010989
331 Ga0075431_101035992
332 Ga0075433_10001190
333 Ga0075434_100000574
334 Ga0075434_100037231
335 Ga0075434_102394664
336 Ga0075429_100748213
337 Ga0068865_100474426
338 Ga0075436_100015979
339 Ga0075436_100040698
340 Ga0075436_100368691
341 Ga0075436_100717802
342 Ga0097620_100002201
343 Ga0097620_100108682
344 Ga0097620_100118292
345 Ga0075435_100001944
346 Ga0099794_10003256
347 Ga0099794_10011968
348 Ga0099794_10052776
349 Ga0099794_10456554
350 Ga0105240_10010447
351 Ga0111539_10054294
352 Ga0111539_10158049
353 Ga0114129_10051112
354 Ga0105242_11671411
355 Ga0105248_10007283
356 Ga0105248_10080347
357 Ga0105248_12078795
358 Ga0105237_10238047
359 Ga0105249_11172398
360 Ga0157371_10812813
361 Ga0157372_10015820
362 Ga0157372_10912037
363 Ga0157375_10001888
364 Ga0157376_10001472
365 Ga0213876_10014798
366 Ga0207653_10114888
367 Ga0207684_10101986
368 Ga0207684_10640023
369 Ga0207684_10715796
370 Ga0207684_11222616
371 Ga0207707_10031215
372 Ga0207671_10143609
373 Ga0207693_10140793
374 Ga0207663_10009299
375 Ga0207652_10063045
376 Ga0207646_10000012
377 Ga0207646_10053857
378 Ga0207646_10619749
379 Ga0207646_10686993
380 Ga0207681_10057809
381 Ga0207650_10191050
382 Ga0207650_10210954
383 Ga0207659_10067753
384 Ga0207659_10141673
385 Ga0207700_10188579
386 Ga0207664_10662807
387 Ga0207644_11280477
388 Ga0207690_11543596
389 Ga0207706_10073197
390 Ga0207706_10452505
391 Ga0207686_10743862
392 Ga0207665_10591672
393 Ga0207711_10001494
394 Ga0207711_10226218
395 Ga0207689_10015000
396 Ga0207658_10018216
397 Ga0207677_10035109
398 Ga0207703_10011071
399 Ga0207639_10187606
400 Ga0207678_10012460
401 Ga0207678_10128832
402 Ga0207702_10008300
403 Ga0207641_10060426
404 Ga0207641_10354023
405 Ga0207648_10115536
406 Ga0207676_10115257
407 Ga0207674_10931478
408 Ga0207683_10003888
409 Ga0209588_1009993
410 Ga0209588_1025140
411 Ga0209588_1029645
412 Ga0209588_1049016
413 Ga0209588_1191104
414 Ga0207428_10019880
415 Ga0268266_10332363
416 Ga0268264_10002018
417 Ga0316577_10165904
418 Ga0373926_0011065
419 Ga0373940_0062358
420 Ga0373945_0481596
421 Ga0373954_0048877
422 Ga0373954_0128286
423 Ga0373946_0016325
424 Ga0373927_0000796
425 Ga0373947_0023332
426 Ga0373925_0001385
427 Ga0395905_1453171
428 Ga0316581_0134269
429 Ga0436365_0444411
430 Ga0436365_1230736
431 Ga0436361_0893483
432 Ga0451577_0023036
433 Ga0453683_0027201
434 Ga0453683_0237892
435 Ga0453684_0024626
436 Ga0453684_0097157
437 Ga0466971_0547529
438 Ga0451576_0343988
439 Ga0466967_2130866
440 Ga0495603_0024073
441 Ga0495629_0140045
442 Ga0495580_0096195
443 Ga0495580_0209261
444 Ga0495639_0001946
445 Ga0495628_0013020
446 Ga0495666_0112831
447 Ga0495665_0028582
448 Ga0495587_0003414
449 Ga0495587_0058756
450 Ga0495645_0006097
451 Ga0495646_0400615
452 Ga0495647_0101435
453 Ga0495658_0003444
454 Ga0495613_0180849
455 Ga0495613_0386722
456 Ga0495624_0063889
457 Ga0495581_0024281
458 Ga0495604_0252886
459 Ga0495674_0176220
460 Ga0495676_0006405
461 Ga0495675_0122938
462 Ga0495602_0085976
463 Ga0496101_0003269
464 Ga0496107_0002105
465 Ga0496107_0628651
466 Ga0496108_0374272
467 Ga0496110_0029599
468 Ga0496112_0056046
469 Ga0496112_0222779
470 Ga0496112_0674778
471 Ga0496112_0753749
472 Ga0496115_0199682
473 Ga0496115_0778127
474 Ga0501032_1069022
475 Ga0501041_0711354
476 Ga0501042_0517142
477 Ga0501042_0611193
478 Ga0501067_0157488
479 Ga0501070_0866757
480 Ga0501071_0052712
481 Ga0501076_0193324
482 Ga0501077_0221751
483 Ga0501079_1102771
484 Ga0501081_0439756
485 nmdc:mga05p37_518_c1
486 nmdc:mga0qj67_4482_c1
487 nmdc:mga06r32_966046_c1
488 nmdc:mga08y16_29012_c1
489 nmdc:mga08y16_46220_c1
490 nmdc:mga0n895_1911240_c1
491 nmdc:mga0n895_294_c1
492 nmdc:mga0n895_6036_c1
493 nmdc:mga0rr50_18309_c1
494 nmdc:mga0rr50_184650_c1
495 nmdc:mga0rr50_491_c1
496 nmdc:mga08x19_1215286_c1
497 nmdc:mga08x19_234071_c1
498 nmdc:mga08x19_38099_c1
499 nmdc:mga08x19_389_c1
500 nmdc:mga08x19_393150_c1
501 nmdc:mga08x19_509504_c1
502 nmdc:mga0a205_165053_c1
503 nmdc:mga0a205_565_c1
504 Ga0495601_0016915
505 Ga0495619_0175747
506 Ga0500643_000698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02310

B12-binding

B12 binding domain

6

124

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxb-assembly1.cif.gz_A crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix 0.7505 6 117
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.7467 7 108
3ku4-assembly2.cif.gz_C trapping of an oxocarbenium ion intermediate in up crystals 0.7446 7 70
5req-assembly1.cif.gz_A methylmalonyl-coa mutase, y89f mutant, substrate complex 0.7328 2 111
2yxb-assembly1.cif.gz_A crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix 0.7147 6 117
ID Description Score Start End Superfamily
af_Q6LA43_30_146_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7797 8 113 3.40.50.2300
af_Q9VBA0_32_337_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.7505 8 68 3.40.50.1580
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.7436 7 107 3.40.50.280
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.7392 3 110 3.40.50.280
af_P53912_158_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7014 8 91 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A831NPL1-F1-model_v4 B12-binding domain-containing protein 0.9769 49 108 GO:0004494
GO:0005737
GO:0019678
GO:0031419
GO:0046872
AF-A0A2M7JWZ6-F1-model_v4 Methylmalonyl-CoA mutase 0.9659 42 104 GO:0016853
GO:0031419
GO:0046872
AF-A0A7W1H6W3-F1-model_v4 B12-binding domain-containing protein 0.9647 42 104 GO:0016853
GO:0031419
GO:0046872
AF-A0A3D3BMR0-F1-model_v4 B12-binding domain-containing protein 0.9629 45 108 GO:0004494
GO:0005737
GO:0019678
GO:0031419
GO:0046872
AF-A0A2N2WBB2-F1-model_v4 B12-binding domain-containing protein 0.9605 49 108 GO:0004494
GO:0005737
GO:0019678
GO:0031419
GO:0046872

Map