F363966

General Info

Members Datasets Scaffolds Average Seq Length
253 169 252 367

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100335467|Ga0075431_1003354672
Length 397
Sequence VVPFAFRGTDLVLADAPTLDFLPSSVQHSDNAMLRIINVVGARPNFMKIAPVIDEMRRRPSRIEPILVHTGQHYDESMSDSFFEDLQIPRPDINLEVGSGSHSEQTARVMIAFEQVLLKHRADWVVVVGDVNSTMAAAIVAAKQLVRVAHVEAGLRSGDRTMPEEINRVVTDALADLLLTPSRDANQNLLREGVASEKIRFVGNVMIDSLYRNLERARASQVLERLRLEPGKFCAITLHRPSNVDAKETLSGILDALAAIGERLPIVFPIHPRTRDRLEQFGLRDRVRSQPSLVLIEPLGYLDFLKLYSNSRLVLTDSGGVQEETTALGIPCLTLRHNTERPITVTEGTNRVVGSDPEIIKLEALAALERPSPAARAPELWDGHAAARIVDAIEETS

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0
Rhizoplane 0.4
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001072 3300000549 Bacteria 4168
2 JGI24751J29686_10000013 3300002459 Bacteria 113565
3 Ga0055538_1000020 3300003751 Bacteria 264193
4 Ga0055539_1000025 3300003752 Bacteria 264193
5 Ga0055533_1000034 3300003756 Bacteria 264193
6 Ga0055525_1000044 3300003759 Bacteria 264193
7 Ga0055541_1000019 3300003841 Bacteria 264193
8 Ga0070683_100232669 3300005329 Bacteria 1752
9 Ga0070690_100017847 3300005330 Bacteria 4278
10 Ga0070690_100123138 3300005330 Bacteria 1743
11 Ga0070670_100000129 3300005331 Bacteria 71325
12 Ga0070670_100001081 3300005331 Bacteria 21612
13 Ga0070670_100013080 3300005331 Bacteria 7108
14 Ga0070666_10050843 3300005335 Bacteria 2789
15 Ga0070680_100040076 3300005336 Bacteria 3791
16 Ga0070687_100033930 3300005343 Bacteria 2523
17 Ga0070668_100005489 3300005347 Bacteria 9407
18 Ga0070669_100000895 3300005353 Bacteria 21689
19 Ga0070675_100178041 3300005354 Bacteria 1837
20 Ga0070671_100002755 3300005355 Bacteria 13650
21 Ga0070673_100101695 3300005364 Bacteria 2368
22 Ga0070673_100169174 3300005364 Unclassified 1864
23 Ga0070667_100080777 3300005367 Bacteria 2782
24 Ga0070703_10000437 3300005406 Bacteria 16968
25 Ga0070709_10000012 3300005434 Bacteria 163026
26 Ga0070709_10080584 3300005434 Bacteria 2123
27 Ga0070713_100018396 3300005436 Bacteria 5311
28 Ga0070713_100116983 3300005436 Unclassified 2332
29 Ga0070710_10055557 3300005437 Bacteria 2238
30 Ga0070711_100000035 3300005439 Bacteria 88475
31 Ga0070705_100000107 3300005440 Bacteria 47341
32 Ga0070694_100019944 3300005444 Bacteria 4269
33 Ga0070694_100071483 3300005444 Bacteria 2392
34 Ga0070662_100000964 3300005457 Bacteria 17651
35 Ga0070662_100014255 3300005457 Bacteria 5306
36 Ga0070685_10000403 3300005466 Bacteria 25952
37 Ga0070706_100002365 3300005467 Bacteria 19038
38 Ga0070706_100004478 3300005467 Bacteria 13473
39 Ga0070706_100015801 3300005467 Bacteria 6969
40 Ga0070706_100024708 3300005467 Bacteria 5532
41 Ga0070706_100134791 3300005467 Bacteria 2305
42 Ga0070707_100000898 3300005468 Bacteria 29541
43 Ga0070698_100001365 3300005471 Bacteria 27171
44 Ga0070698_100119377 3300005471 Bacteria 2597
45 Ga0070698_100225736 3300005471 Bacteria 1806
46 Ga0070699_100000129 3300005518 Bacteria 69764
47 Ga0070699_100025253 3300005518 Bacteria 5123
48 Ga0070697_100070115 3300005536 Bacteria 2873
49 Ga0070697_100081167 3300005536 Bacteria 2672
50 Ga0070672_100113875 3300005543 Bacteria 2208
51 Ga0070686_100000483 3300005544 Bacteria 24107
52 Ga0070686_100086499 3300005544 Bacteria 2087
53 Ga0070696_100001116 3300005546 Bacteria 17376
54 Ga0070696_100022549 3300005546 Bacteria 4278
55 Ga0070696_100046900 3300005546 Bacteria 2997
56 Ga0070665_100141697 3300005548 Unclassified 2407
57 Ga0070704_100027982 3300005549 Unclassified 3745
58 Ga0070704_100033212 3300005549 Bacteria 3487
59 Ga0070704_100357493 3300005549 Bacteria 1235
60 Ga0070664_100177935 3300005564 Bacteria 1889
61 Ga0068859_100001956 3300005617 Bacteria 21008
62 Ga0068859_100393661 3300005617 Unclassified 1481
63 Ga0068861_100091552 3300005719 Unclassified 2401
64 Ga0068861_100095837 3300005719 Bacteria 2351
65 Ga0068858_100033667 3300005842 Bacteria 4753
66 Ga0068858_100084311 3300005842 Bacteria 2956
67 Ga0068862_100023796 3300005844 Bacteria 5134
68 Ga0070715_10000004 3300006163 Bacteria 305411
69 Ga0070716_100041999 3300006173 Bacteria 2551
70 Ga0070716_100050718 3300006173 Bacteria 2357
71 Ga0075428_100016805 3300006844 Bacteria 8080
72 Ga0075428_100131666 3300006844 Bacteria 2720
73 Ga0075431_100202855 3300006847 Bacteria 2029
74 Ga0075431_100335467 3300006847 Unclassified 1522
75 Ga0075433_10010772 3300006852 Bacteria 7353
76 Ga0075433_10315009 3300006852 Bacteria 1384
77 Ga0075434_100194980 3300006871 Bacteria 2045
78 Ga0075429_100259428 3300006880 Bacteria 1521
79 Ga0075436_100000141 3300006914 Bacteria 43568
80 Ga0075436_100000354 3300006914 Bacteria 29304
81 Ga0075436_100018652 3300006914 Bacteria 4749
82 Ga0075436_100126476 3300006914 Bacteria 1791
83 Ga0097620_100001956 3300006931 Bacteria 21008
84 Ga0097620_100393675 3300006931 Unclassified 1481
85 Ga0105240_10104412 3300009093 Unclassified 3441
86 Ga0105240_10149670 3300009093 Bacteria 2782
87 Ga0114129_10048408 3300009147 Bacteria 5973
88 Ga0105242_10002694 3300009176 Bacteria 13895
89 Ga0105242_10153831 3300009176 Bacteria 2007
90 Ga0105248_10020688 3300009177 Bacteria 7292
91 Ga0105248_10035501 3300009177 Bacteria 5577
92 Ga0105248_10128559 3300009177 Bacteria 2858
93 Ga0105248_10570668 3300009177 Bacteria 1277
94 Ga0105238_10000035 3300009551 Bacteria 165866
95 Ga0105238_10027289 3300009551 Bacteria 5817
96 Ga0105249_10000044 3300009553 Bacteria 184637
97 Ga0105249_10080456 3300009553 Bacteria 3026
98 Ga0105246_10271500 3300011119 Bacteria 1356
99 Ga0157373_10039709 3300013100 Unclassified 3368
100 Ga0163162_10000025 3300013306 Bacteria 184648
101 Ga0163162_10018599 3300013306 Bacteria 6808
102 Ga0163162_10034639 3300013306 Bacteria 5026
103 Ga0163162_10055377 3300013306 Bacteria 3992
104 Ga0163162_10115495 3300013306 Unclassified 2784
105 Ga0157375_10014193 3300013308 Bacteria 7102
106 Ga0157375_10033482 3300013308 Bacteria 4884
107 Ga0163163_10000536 3300014325 Bacteria 33560
108 Ga0163163_10020034 3300014325 Bacteria 6294
109 Ga0163163_10027068 3300014325 Bacteria 5487
110 Ga0163163_10209450 3300014325 Unclassified 1998
111 Ga0157380_10015309 3300014326 Bacteria 5636
112 Ga0157380_10034593 3300014326 Bacteria 3898
113 Ga0157380_10554474 3300014326 Bacteria 1128
114 Ga0157376_10065672 3300014969 Bacteria 3065
115 Ga0163161_10000627 3300017792 Bacteria 28166
116 Ga0213872_10016501 3300021361 Bacteria 3426
117 Ga0213876_10000006 3300021384 Bacteria 700803
118 Ga0213876_10000196 3300021384 Bacteria 62628
119 Ga0228598_1004948 3300024227 Bacteria 2803
120 Ga0209784_100002 3300025224 Bacteria 1753105
121 Ga0209566_100003 3300025225 Bacteria 1753105
122 Ga0209674_100004 3300025226 Bacteria 1753105
123 Ga0209563_100006 3300025230 Bacteria 1753105
124 Ga0209677_100003 3300025253 Bacteria 1753105
125 Ga0207653_10000212 3300025885 Bacteria 39081
126 Ga0207685_10000004 3300025905 Bacteria 305368
127 Ga0207699_10000007 3300025906 Bacteria 405928
128 Ga0207699_10039473 3300025906 Unclassified 2713
129 Ga0207643_10010247 3300025908 Bacteria 5043
130 Ga0207684_10000611 3300025910 Bacteria 42502
131 Ga0207684_10090419 3300025910 Bacteria 2608
132 Ga0207695_10460260 3300025913 Unclassified 1155
133 Ga0207663_10000037 3300025916 Bacteria 85962
134 Ga0207662_10046915 3300025918 Bacteria 2558
135 Ga0207662_10077993 3300025918 Bacteria 2016
136 Ga0207646_10000086 3300025922 Bacteria 125294
137 Ga0207681_10001635 3300025923 Bacteria 14449
138 Ga0207694_10000045 3300025924 Bacteria 165875
139 Ga0207694_10072286 3300025924 Bacteria 2697
140 Ga0207650_10000001 3300025925 Bacteria 1545726
141 Ga0207650_10000511 3300025925 Bacteria 32409
142 Ga0207650_10005142 3300025925 Bacteria 8932
143 Ga0207659_10010495 3300025926 Bacteria 5821
144 Ga0207700_10221079 3300025928 Unclassified 1605
145 Ga0207644_10143956 3300025931 Bacteria 1838
146 Ga0207706_10000352 3300025933 Bacteria 49647
147 Ga0207706_10060360 3300025933 Bacteria 3339
148 Ga0207686_10001521 3300025934 Bacteria 13071
149 Ga0207704_10080482 3300025938 Bacteria 2103
150 Ga0207665_10020501 3300025939 Bacteria 4344
151 Ga0207691_10056300 3300025940 Bacteria 3582
152 Ga0207679_10086940 3300025945 Bacteria 2406
153 Ga0207651_10050291 3300025960 Bacteria 2829
154 Ga0207712_10000039 3300025961 Bacteria 182548
155 Ga0207668_10011390 3300025972 Bacteria 5401
156 Ga0207703_10026961 3300026035 Bacteria 4526
157 Ga0207674_10128343 3300026116 Bacteria 2500
158 Ga0207675_100227089 3300026118 Unclassified 1800
159 Ga0268265_10061252 3300028380 Bacteria 2887
160 Ga0268265_10072971 3300028380 Bacteria 2679
161 Ga0268264_10001544 3300028381 Bacteria 21399
162 Ga0265319_1000470 3300028563 Bacteria 28544
163 Ga0265318_10000099 3300028577 Bacteria 80487
164 Ga0265338_10181362 3300028800 Bacteria 1605
165 Ga0265330_10014855 3300031235 Bacteria 3609
166 Ga0265330_10057941 3300031235 Bacteria 1689
167 Ga0265332_10073681 3300031238 Bacteria 1453
168 Ga0265320_10000181 3300031240 Bacteria 53202
169 Ga0265329_10004083 3300031242 Bacteria 6200
170 Ga0265340_10000296 3300031247 Bacteria 26080
171 Ga0265340_10000810 3300031247 Bacteria 17756
172 Ga0265331_10000112 3300031250 Bacteria 107928
173 Ga0265316_10004953 3300031344 Bacteria 13091
174 Ga0265316_10005147 3300031344 Bacteria 12809
175 Ga0265316_10231309 3300031344 Bacteria 1361
176 Ga0307408_100295807 3300031548 Unclassified 1354
177 Ga0265314_10017628 3300031711 Bacteria 5598
178 Ga0265314_10020333 3300031711 Bacteria 5125
179 Ga0265314_10021462 3300031711 Bacteria 4964
180 Ga0265342_10010902 3300031712 Bacteria 6251
181 Ga0307405_10034888 3300031731 Bacteria 2999
182 Ga0307413_10226289 3300031824 Bacteria 1370
183 Ga0307409_100091626 3300031995 Bacteria 2492
184 Ga0307416_100221212 3300032002 Unclassified 1816
185 Ga0307415_100048329 3300032126 Unclassified 2870
186 Ga0307415_100063416 3300032126 Bacteria 2568
187 Ga0373959_0000049 3300034820 Bacteria 27086
188 Ga0373943_0021401 3300035170 Bacteria 2987
189 Ga0373955_0180961 3300035172 Bacteria 1251
190 Ga0373931_0056739 3300035691 Bacteria 2099
191 Ga0373927_0001605 3300035695 Bacteria 16969
192 Ga0373933_0074611 3300035724 Bacteria 2069
193 Ga0373947_0002395 3300035725 Bacteria 11330
194 Ga0373925_0001084 3300037068 Bacteria 24460
195 Ga0436364_0555582 3300037853 Bacteria 4042
196 Ga0436365_0676892 3300039437 Bacteria 5366
197 Ga0436365_0695157 3300039437 Bacteria 511493
198 Ga0436365_1753418 3300039437 Bacteria 95553
199 Ga0436361_0519738 3300039447 Bacteria 9169
200 Ga0439434_0032341 3300042435 Bacteria 1592
201 Ga0451577_0020550 3300042876 Bacteria 6056
202 Ga0451577_0127239 3300042876 Bacteria 2283
203 Ga0466972_0028198 3300044658 Bacteria 2772
204 Ga0453683_0001721 3300044673 Bacteria 18169
205 Ga0453683_0003711 3300044673 Bacteria 11160
206 Ga0453683_0162383 3300044673 Bacteria 1414
207 Ga0466961_0017069 3300044693 Bacteria 4662
208 Ga0453684_0001118 3300044712 Bacteria 84057
209 Ga0453684_0002640 3300044712 Bacteria 42842
210 Ga0453684_0007813 3300044712 Bacteria 19504
211 Ga0453684_0519285 3300044712 Bacteria 1316
212 Ga0451576_0026565 3300045051 Bacteria 6226
213 Ga0451576_0336966 3300045051 Bacteria 1579
214 Ga0466967_0020166 3300045976 Bacteria 5379
215 Ga0466967_0147153 3300045976 Bacteria 2198
216 Ga0495651_0037330 3300046462 Bacteria 3782
217 Ga0495664_0033244 3300046477 Bacteria 3031
218 Ga0495632_0056821 3300046519 Bacteria 1912
219 Ga0495643_0000071 3300046522 Bacteria 168991
220 Ga0495621_0004181 3300046539 Bacteria 4033
221 Ga0495667_0031358 3300046559 Bacteria 3568
222 Ga0495657_0096298 3300046675 Bacteria 1891
223 Ga0495624_0075607 3300046690 Bacteria 2091
224 Ga0495604_0078571 3300047317 Bacteria 2476
225 Ga0495636_0022036 3300047318 Bacteria 2575
226 Ga0495674_0015843 3300047319 Bacteria 7038
227 Ga0495672_0159538 3300047320 Bacteria 1161
228 Ga0495680_0003571 3300047322 Bacteria 15237
229 Ga0495602_0003963 3300048088 Bacteria 15427
230 Ga0495615_0001182 3300048090 Bacteria 3790
231 Ga0495615_0003851 3300048090 Bacteria 2556
232 Ga0496114_0084674 3300048917 Bacteria 2685
233 Ga0496124_0195463 3300048927 Bacteria 1544
234 Ga0501047_0047159 3300049581 Bacteria 4163
235 Ga0501201_004791 3300049651 Bacteria 1258
236 Ga0501083_0057541 3300049744 Bacteria 2602
237 Ga0501035_0000519 3300049822 Bacteria 43363
238 nmdc:mga05p37_177333_c1 3300050507 Unclassified 2595
239 nmdc:mga0qj67_307665_c1 3300050509 Bacteria 1284
240 nmdc:mga08y16_145586_c1 3300050511 Bacteria 2463
241 nmdc:mga0n895_2952_c1 3300050512 Bacteria 13496
242 nmdc:mga0n895_370851_c1 3300050512 Bacteria 1449
243 nmdc:mga0n895_436476_c1 3300050512 Bacteria 1323
244 nmdc:mga08x19_169883_c1 3300050514 Bacteria 1485
245 nmdc:mga08x19_203_c1 3300050514 Bacteria 45690
246 nmdc:mga08x19_22444_c1 3300050514 Bacteria 3909
247 nmdc:mga08x19_44400_c1 3300050514 Bacteria 2838
248 nmdc:mga08x19_497_c1 3300050514 Bacteria 26186
249 nmdc:mga08x19_71907_c1 3300050514 Bacteria 2256
250 nmdc:mga0a205_101655_c1 3300050515 Bacteria 2773
251 Ga0501082_0051516 3300060353 Bacteria 3548
252 Ga0501082_0147603 3300060353 Bacteria 2042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049651 Ga0501201_004791 Ga0501201_004791_326_1246 298
2 3300050514 nmdc:mga08x19_71907_c1 nmdc:mga08x19_71907_c1_1290_2225 310
3 3300025918 Ga0207662_10077993 Ga0207662_100779932 314
4 3300042435 Ga0439434_0032341 Ga0439434_0032341_581_1570 319
5 3300046690 Ga0495624_0075607 Ga0495624_0075607_25_1065 336
6 3300031995 Ga0307409_100091626 Ga0307409_1000916262 339
7 3300045976 Ga0466967_0020166 Ga0466967_0020166_4152_5195 340
8 3300006914 Ga0075436_100126476 Ga0075436_1001264762 341
9 3300050514 nmdc:mga08x19_169883_c1 nmdc:mga08x19_169883_c1_306_1334 341
10 3300050514 nmdc:mga08x19_44400_c1 nmdc:mga08x19_44400_c1_1413_2441 341
11 3300003751 Ga0055538_1000020 Ga0055538_100002072 342
12 3300003752 Ga0055539_1000025 Ga0055539_100002572 342
13 3300003756 Ga0055533_1000034 Ga0055533_1000034171 342
14 3300003759 Ga0055525_1000044 Ga0055525_100004472 342
15 3300003841 Ga0055541_1000019 Ga0055541_100001972 342
16 3300025224 Ga0209784_100002 Ga0209784_10000275 342
17 3300025225 Ga0209566_100003 Ga0209566_10000375 342
18 3300025226 Ga0209674_100004 Ga0209674_10000475 342
19 3300025230 Ga0209563_100006 Ga0209563_10000675 342
20 3300025253 Ga0209677_100003 Ga0209677_10000375 342
21 3300050512 nmdc:mga0n895_436476_c1 nmdc:mga0n895_436476_c1_269_1312 342
22 3300005330 Ga0070690_100123138 Ga0070690_1001231382 345
23 3300005343 Ga0070687_100033930 Ga0070687_1000339302 345
24 3300005355 Ga0070671_100002755 Ga0070671_1000027556 345
25 3300005367 Ga0070667_100080777 Ga0070667_1000807772 345
26 3300005543 Ga0070672_100113875 Ga0070672_1001138751 345
27 3300005544 Ga0070686_100086499 Ga0070686_1000864991 345
28 3300005842 Ga0068858_100033667 Ga0068858_1000336672 345
29 3300009177 Ga0105248_10035501 Ga0105248_100355013 345
30 3300009177 Ga0105248_10570668 Ga0105248_105706682 345
31 3300013308 Ga0157375_10014193 Ga0157375_100141933 345
32 3300025931 Ga0207644_10143956 Ga0207644_101439562 345
33 iso_pu_bacteria 8001522603 8001523214 345
34 3300014969 Ga0157376_10065672 Ga0157376_100656723 347
35 3300028381 Ga0268264_10001544 Ga0268264_1000154419 348
36 3300044712 Ga0453684_0519285 Ga0453684_0519285_222_1292 348
37 3300049744 Ga0501083_0057541 Ga0501083_0057541_908_1978 348
38 3300060353 Ga0501082_0051516 Ga0501082_0051516_354_1427 348
39 3300005471 Ga0070698_100001365 Ga0070698_10000136517 349
40 3300009147 Ga0114129_10048408 Ga0114129_100484085 349
41 3300009176 Ga0105242_10002694 Ga0105242_100026942 349
42 3300009177 Ga0105248_10020688 Ga0105248_100206883 349
43 3300013306 Ga0163162_10018599 Ga0163162_100185993 349
44 3300013306 Ga0163162_10034639 Ga0163162_100346394 349
45 3300014325 Ga0163163_10027068 Ga0163163_100270682 349
46 3300025934 Ga0207686_10001521 Ga0207686_1000152115 349
47 3300049581 Ga0501047_0047159 Ga0501047_0047159_509_1567 349
48 3300050507 nmdc:mga05p37_177333_c1 nmdc:mga05p37_177333_c1_203_1258 349
49 3300050514 nmdc:mga08x19_203_c1 nmdc:mga08x19_203_c1_4267_5334 349
50 3300047320 Ga0495672_0159538 Ga0495672_0159538_15_1067 350
51 3300009093 Ga0105240_10149670 Ga0105240_101496701 353
52 3300009551 Ga0105238_10000035 Ga0105238_1000003596 353
53 3300025924 Ga0207694_10000045 Ga0207694_1000004570 353
54 3300025928 Ga0207700_10221079 Ga0207700_102210792 353
55 3300005353 Ga0070669_100000895 Ga0070669_1000008956 354
56 3300005434 Ga0070709_10080584 Ga0070709_100805841 354
57 3300005436 Ga0070713_100018396 Ga0070713_1000183963 354
58 3300005437 Ga0070710_10055557 Ga0070710_100555572 354
59 3300011119 Ga0105246_10271500 Ga0105246_102715001 354
60 3300025906 Ga0207699_10039473 Ga0207699_100394733 354
61 3300025923 Ga0207681_10001635 Ga0207681_100016358 354
62 3300005467 Ga0070706_100002365 Ga0070706_1000023659 355
63 3300024227 Ga0228598_1004948 Ga0228598_10049482 356
64 3300034820 Ga0373959_0000049 Ga0373959_0000049_22676_23821 356
65 3300031711 Ga0265314_10021462 Ga0265314_100214622 357
66 3300035691 Ga0373931_0056739 Ga0373931_0056739_516_1649 357
67 3300044712 Ga0453684_0007813 Ga0453684_0007813_1213_2292 357
68 3300005467 Ga0070706_100024708 Ga0070706_1000247084 358
69 3300005468 Ga0070707_100000898 Ga0070707_10000089825 358
70 3300005471 Ga0070698_100119377 Ga0070698_1001193772 358
71 3300005536 Ga0070697_100070115 Ga0070697_1000701153 358
72 3300005549 Ga0070704_100357493 Ga0070704_1003574931 358
73 3300014326 Ga0157380_10554474 Ga0157380_105544741 358
74 3300025910 Ga0207684_10090419 Ga0207684_100904192 358
75 3300025922 Ga0207646_10000086 Ga0207646_1000008656 358
76 3300028563 Ga0265319_1000470 Ga0265319_100047023 358
77 3300028577 Ga0265318_10000099 Ga0265318_1000009968 358
78 3300028800 Ga0265338_10181362 Ga0265338_101813622 358
79 3300031235 Ga0265330_10057941 Ga0265330_100579412 358
80 3300031238 Ga0265332_10073681 Ga0265332_100736811 358
81 3300031240 Ga0265320_10000181 Ga0265320_1000018141 358
82 3300031242 Ga0265329_10004083 Ga0265329_100040833 358
83 3300031247 Ga0265340_10000810 Ga0265340_1000081014 358
84 3300031250 Ga0265331_10000112 Ga0265331_100001124 358
85 3300031344 Ga0265316_10004953 Ga0265316_100049532 358
86 3300031711 Ga0265314_10020333 Ga0265314_100203333 358
87 3300031712 Ga0265342_10010902 Ga0265342_100109023 358
88 3300042876 Ga0451577_0020550 Ga0451577_0020550_114_1238 358
89 3300044673 Ga0453683_0003711 Ga0453683_0003711_6896_8020 358
90 3300044712 Ga0453684_0002640 Ga0453684_0002640_17982_19106 358
91 3300045051 Ga0451576_0026565 Ga0451576_0026565_1328_2452 358
92 3300046462 Ga0495651_0037330 Ga0495651_0037330_2580_3686 358
93 3300046477 Ga0495664_0033244 Ga0495664_0033244_1314_2420 358
94 3300046539 Ga0495621_0004181 Ga0495621_0004181_2499_3584 358
95 3300046559 Ga0495667_0031358 Ga0495667_0031358_858_1964 358
96 3300046675 Ga0495657_0096298 Ga0495657_0096298_299_1405 358
97 3300047322 Ga0495680_0003571 Ga0495680_0003571_13126_14232 358
98 3300005335 Ga0070666_10050843 Ga0070666_100508432 359
99 3300005436 Ga0070713_100116983 Ga0070713_1001169832 359
100 3300005466 Ga0070685_10000403 Ga0070685_1000040317 359
101 3300005518 Ga0070699_100025253 Ga0070699_1000252533 359
102 3300005544 Ga0070686_100000483 Ga0070686_1000004833 359
103 3300006173 Ga0070716_100041999 Ga0070716_1000419991 359
104 3300006847 Ga0075431_100202855 Ga0075431_1002028552 359
105 3300006914 Ga0075436_100000141 Ga0075436_1000001419 359
106 3300006914 Ga0075436_100018652 Ga0075436_1000186522 359
107 3300009177 Ga0105248_10128559 Ga0105248_101285592 359
108 3300025918 Ga0207662_10046915 Ga0207662_100469152 359
109 3300025939 Ga0207665_10020501 Ga0207665_100205014 359
110 3300035170 Ga0373943_0021401 Ga0373943_0021401_130_1236 359
111 3300035695 Ga0373927_0001605 Ga0373927_0001605_367_1473 359
112 3300035725 Ga0373947_0002395 Ga0373947_0002395_7651_8757 359
113 3300037068 Ga0373925_0001084 Ga0373925_0001084_15467_16573 359
114 3300044693 Ga0466961_0017069 Ga0466961_0017069_569_1714 359
115 3300047317 Ga0495604_0078571 Ga0495604_0078571_562_1734 359
116 3300047319 Ga0495674_0015843 Ga0495674_0015843_68_1240 359
117 3300048088 Ga0495602_0003963 Ga0495602_0003963_1031_2203 359
118 3300048917 Ga0496114_0084674 Ga0496114_0084674_808_1905 359
119 3300050512 nmdc:mga0n895_2952_c1 nmdc:mga0n895_2952_c1_9075_10163 359
120 3300050514 nmdc:mga08x19_22444_c1 nmdc:mga08x19_22444_c1_797_1885 359
121 3300050514 nmdc:mga08x19_497_c1 nmdc:mga08x19_497_c1_8885_9991 359
122 3300005329 Ga0070683_100232669 Ga0070683_1002326692 360
123 3300005546 Ga0070696_100022549 Ga0070696_1000225492 360
124 3300013306 Ga0163162_10055377 Ga0163162_100553772 360
125 3300025938 Ga0207704_10080482 Ga0207704_100804822 360
126 3300031824 Ga0307413_10226289 Ga0307413_102262892 360
127 3300035172 Ga0373955_0180961 Ga0373955_0180961_41_1159 360
128 3300046522 Ga0495643_0000071 Ga0495643_0000071_22010_23116 360
129 3300005330 Ga0070690_100017847 Ga0070690_1000178473 361
130 3300005364 Ga0070673_100101695 Ga0070673_1001016951 361
131 3300005457 Ga0070662_100000964 Ga0070662_10000096415 361
132 3300005457 Ga0070662_100014255 Ga0070662_1000142552 361
133 3300005549 Ga0070704_100027982 Ga0070704_1000279822 361
134 3300005719 Ga0068861_100095837 Ga0068861_1000958372 361
135 3300005844 Ga0068862_100023796 Ga0068862_1000237962 361
136 3300009176 Ga0105242_10153831 Ga0105242_101538312 361
137 3300009553 Ga0105249_10080456 Ga0105249_100804562 361
138 3300014326 Ga0157380_10015309 Ga0157380_100153094 361
139 3300025933 Ga0207706_10000352 Ga0207706_1000035214 361
140 3300025933 Ga0207706_10060360 Ga0207706_100603602 361
141 3300028380 Ga0268265_10061252 Ga0268265_100612522 361
142 3300031235 Ga0265330_10014855 Ga0265330_100148552 361
143 3300031247 Ga0265340_10000296 Ga0265340_100002966 361
144 3300031344 Ga0265316_10005147 Ga0265316_100051479 361
145 3300031344 Ga0265316_10231309 Ga0265316_102313091 361
146 3300031711 Ga0265314_10017628 Ga0265314_100176284 361
147 3300032126 Ga0307415_100048329 Ga0307415_1000483293 361
148 3300035724 Ga0373933_0074611 Ga0373933_0074611_433_1539 361
149 3300037853 Ga0436364_0555582 Ga0436364_0555582_1067_2155 361
150 3300042876 Ga0451577_0127239 Ga0451577_0127239_712_1821 361
151 3300044673 Ga0453683_0001721 Ga0453683_0001721_3889_4998 361
152 3300044673 Ga0453683_0162383 Ga0453683_0162383_29_1147 361
153 3300044712 Ga0453684_0001118 Ga0453684_0001118_24098_25258 361
154 3300005331 Ga0070670_100001081 Ga0070670_1000010812 362
155 3300005467 Ga0070706_100015801 Ga0070706_1000158011 362
156 3300005471 Ga0070698_100225736 Ga0070698_1002257361 362
157 3300005617 Ga0068859_100001956 Ga0068859_1000019563 362
158 3300006844 Ga0075428_100131666 Ga0075428_1001316662 362
159 3300006852 Ga0075433_10010772 Ga0075433_100107724 362
160 3300006931 Ga0097620_100001956 Ga0097620_1000019563 362
161 3300025925 Ga0207650_10000511 Ga0207650_100005115 362
162 3300025960 Ga0207651_10050291 Ga0207651_100502912 362
163 3300032126 Ga0307415_100063416 Ga0307415_1000634161 362
164 3300044658 Ga0466972_0028198 Ga0466972_0028198_101_1228 362
165 3300045976 Ga0466967_0147153 Ga0466967_0147153_251_1399 362
166 3300047318 Ga0495636_0022036 Ga0495636_0022036_464_1585 362
167 3300048090 Ga0495615_0001182 Ga0495615_0001182_2509_3636 362
168 3300048090 Ga0495615_0003851 Ga0495615_0003851_387_1517 362
169 3300048927 Ga0496124_0195463 Ga0496124_0195463_376_1494 362
170 3300049822 Ga0501035_0000519 Ga0501035_0000519_31234_32364 362
171 3300060353 Ga0501082_0147603 Ga0501082_0147603_757_1887 362
172 3300002459 JGI24751J29686_10000013 JGI24751J29686_1000001356 363
173 3300005331 Ga0070670_100000129 Ga0070670_10000012937 363
174 3300005331 Ga0070670_100013080 Ga0070670_1000130806 363
175 3300005336 Ga0070680_100040076 Ga0070680_1000400762 363
176 3300005354 Ga0070675_100178041 Ga0070675_1001780412 363
177 3300005364 Ga0070673_100169174 Ga0070673_1001691742 363
178 3300005406 Ga0070703_10000437 Ga0070703_1000043710 363
179 3300005439 Ga0070711_100000035 Ga0070711_1000000355 363
180 3300005440 Ga0070705_100000107 Ga0070705_10000010729 363
181 3300005444 Ga0070694_100019944 Ga0070694_1000199443 363
182 3300005467 Ga0070706_100004478 Ga0070706_1000044784 363
183 3300005518 Ga0070699_100000129 Ga0070699_10000012961 363
184 3300005546 Ga0070696_100001116 Ga0070696_10000111611 363
185 3300005546 Ga0070696_100046900 Ga0070696_1000469002 363
186 3300005549 Ga0070704_100033212 Ga0070704_1000332123 363
187 3300005564 Ga0070664_100177935 Ga0070664_1001779352 363
188 3300005719 Ga0068861_100091552 Ga0068861_1000915522 363
189 3300005842 Ga0068858_100084311 Ga0068858_1000843112 363
190 3300006844 Ga0075428_100016805 Ga0075428_1000168056 363
191 3300006847 Ga0075431_100335467 Ga0075431_1003354672 363
192 3300006852 Ga0075433_10315009 Ga0075433_103150092 363
193 3300006871 Ga0075434_100194980 Ga0075434_1001949802 363
194 3300006880 Ga0075429_100259428 Ga0075429_1002594281 363
195 3300006914 Ga0075436_100000354 Ga0075436_1000003545 363
196 3300009551 Ga0105238_10027289 Ga0105238_100272892 363
197 3300013100 Ga0157373_10039709 Ga0157373_100397092 363
198 3300013306 Ga0163162_10115495 Ga0163162_101154952 363
199 3300014325 Ga0163163_10000536 Ga0163163_1000053614 363
200 3300014325 Ga0163163_10020034 Ga0163163_100200346 363
201 3300014325 Ga0163163_10209450 Ga0163163_102094504 363
202 3300014326 Ga0157380_10034593 Ga0157380_100345933 363
203 3300021361 Ga0213872_10016501 Ga0213872_100165012 363
204 3300025885 Ga0207653_10000212 Ga0207653_100002124 363
205 3300025908 Ga0207643_10010247 Ga0207643_100102472 363
206 3300025910 Ga0207684_10000611 Ga0207684_100006114 363
207 3300025916 Ga0207663_10000037 Ga0207663_100000375 363
208 3300025924 Ga0207694_10072286 Ga0207694_100722862 363
209 3300025925 Ga0207650_10000001 Ga0207650_10000001106 363
210 3300025925 Ga0207650_10005142 Ga0207650_100051423 363
211 3300025926 Ga0207659_10010495 Ga0207659_100104955 363
212 3300025940 Ga0207691_10056300 Ga0207691_100563004 363
213 3300025945 Ga0207679_10086940 Ga0207679_100869404 363
214 3300026035 Ga0207703_10026961 Ga0207703_100269613 363
215 3300026116 Ga0207674_10128343 Ga0207674_101283432 363
216 3300026118 Ga0207675_100227089 Ga0207675_1002270892 363
217 3300028380 Ga0268265_10072971 Ga0268265_100729712 363
218 3300031548 Ga0307408_100295807 Ga0307408_1002958072 363
219 3300032002 Ga0307416_100221212 Ga0307416_1002212122 363
220 3300039447 Ga0436361_0519738 Ga0436361_0519738_4693_5847 363
221 3300045051 Ga0451576_0336966 Ga0451576_0336966_67_1176 363
222 3300050509 nmdc:mga0qj67_307665_c1 nmdc:mga0qj67_307665_c1_26_1126 363
223 3300050511 nmdc:mga08y16_145586_c1 nmdc:mga08y16_145586_c1_1339_2436 363
224 3300050512 nmdc:mga0n895_370851_c1 nmdc:mga0n895_370851_c1_306_1403 363
225 3300050515 nmdc:mga0a205_101655_c1 nmdc:mga0a205_101655_c1_20_1120 363
226 3300005347 Ga0070668_100005489 Ga0070668_1000054896 364
227 3300009093 Ga0105240_10104412 Ga0105240_101044122 364
228 3300009553 Ga0105249_10000044 Ga0105249_1000004442 364
229 3300013306 Ga0163162_10000025 Ga0163162_10000025115 364
230 3300013308 Ga0157375_10033482 Ga0157375_100334824 364
231 3300021384 Ga0213876_10000006 Ga0213876_10000006496 364
232 3300021384 Ga0213876_10000196 Ga0213876_1000019617 364
233 3300025913 Ga0207695_10460260 Ga0207695_104602601 364
234 3300025961 Ga0207712_10000039 Ga0207712_10000039130 364
235 3300025972 Ga0207668_10011390 Ga0207668_100113902 364
236 3300039437 Ga0436365_0695157 Ga0436365_0695157_62968_64068 364
237 3300039437 Ga0436365_1753418 Ga0436365_1753418_59495_60595 364
238 3300000549 LJQas_1001072 LJQas_10010723 365
239 3300005434 Ga0070709_10000012 Ga0070709_1000001265 365
240 3300005444 Ga0070694_100071483 Ga0070694_1000714831 365
241 3300005467 Ga0070706_100134791 Ga0070706_1001347911 365
242 3300005536 Ga0070697_100081167 Ga0070697_1000811672 365
243 3300005548 Ga0070665_100141697 Ga0070665_1001416972 365
244 3300005617 Ga0068859_100393661 Ga0068859_1003936612 365
245 3300006163 Ga0070715_10000004 Ga0070715_10000004150 365
246 3300006173 Ga0070716_100050718 Ga0070716_1000507182 365
247 3300006931 Ga0097620_100393675 Ga0097620_1003936752 365
248 3300017792 Ga0163161_10000627 Ga0163161_1000062729 365
249 3300025905 Ga0207685_10000004 Ga0207685_10000004105 365
250 3300025906 Ga0207699_10000007 Ga0207699_10000007364 365
251 3300031731 Ga0307405_10034888 Ga0307405_100348883 365
252 3300039437 Ga0436365_0676892 Ga0436365_0676892_167_1279 365
253 3300046519 Ga0495632_0056821 Ga0495632_0056821_188_1300 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02350

Epimerase_2

UDP-N-acetylglucosamine 2-epimerase

54

394

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sye-assembly1.cif.gz_A x-ray crystal structure of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27, d98n variant in the presence of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid and udp at ph 6 0.941 1 363
8sye-assembly1.cif.gz_A x-ray crystal structure of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27, d98n variant in the presence of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid and udp at ph 6 0.936 1 363
8sy0-assembly1.cif.gz_A x-ray crystal structure of udp- 2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27 in complex with its product udp-2,3-diacetamido-2,3-dideoxy-d-mannuronic acid at ph 9 0.9351 1 361
8sxy-assembly1.cif.gz_B x-ray crystal structure of udp- 2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27 in complex with its product udp-2,3-diacetamido-2,3-dideoxy-d-mannuronic acid at ph 5 0.9308 2 365
4nes-assembly1.cif.gz_A-2 crystal structure of methanocaldococcus jannaschii udp-glcnac 2-epimerase in complex with udp-glcnac and udp 0.93 2 363
ID Description Score Start End Superfamily
af_Q58899_2_184_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9731 3 187 3.40.50.2000
af_Q58899_2_184_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9627 3 187 3.40.50.2000
af_Q58899_3_336_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9464 2 333 3.40.50.2000
af_P27828_2_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9421 4 187 3.40.50.2000
af_Q58899_3_336_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9381 2 333 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A176RTE3-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14) 1.005 85 159 GO:0008761
AF-A0A2V8SGL9-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (Non-hydrolyzing) 0.9896 1 187 GO:0008761
AF-A0A812AH51-F1-model_v4 deleted 0.9892 97 192
AF-A0A7W1L2B4-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase 0.9854 2 158 GO:0008761
AF-A0A2V8SGL9-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (Non-hydrolyzing) 0.9843 1 187 GO:0008761

Feature Viewer

pLDDT pTM Quality
94.47 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map