F363966
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 169 | 252 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100335467|Ga0075431_1003354672 |
| Length | 397 |
| Sequence | VVPFAFRGTDLVLADAPTLDFLPSSVQHSDNAMLRIINVVGARPNFMKIAPVIDEMRRRPSRIEPILVHTGQHYDESMSDSFFEDLQIPRPDINLEVGSGSHSEQTARVMIAFEQVLLKHRADWVVVVGDVNSTMAAAIVAAKQLVRVAHVEAGLRSGDRTMPEEINRVVTDALADLLLTPSRDANQNLLREGVASEKIRFVGNVMIDSLYRNLERARASQVLERLRLEPGKFCAITLHRPSNVDAKETLSGILDALAAIGERLPIVFPIHPRTRDRLEQFGLRDRVRSQPSLVLIEPLGYLDFLKLYSNSRLVLTDSGGVQEETTALGIPCLTLRHNTERPITVTEGTNRVVGSDPEIIKLEALAALERPSPAARAPELWDGHAAARIVDAIEETS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 68 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 69 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 70 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 110 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 123 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 133 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 136 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 160 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.95 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 92.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001072 | 3300000549 | Bacteria | 4168 |
| 2 | JGI24751J29686_10000013 | 3300002459 | Bacteria | 113565 |
| 3 | Ga0055538_1000020 | 3300003751 | Bacteria | 264193 |
| 4 | Ga0055539_1000025 | 3300003752 | Bacteria | 264193 |
| 5 | Ga0055533_1000034 | 3300003756 | Bacteria | 264193 |
| 6 | Ga0055525_1000044 | 3300003759 | Bacteria | 264193 |
| 7 | Ga0055541_1000019 | 3300003841 | Bacteria | 264193 |
| 8 | Ga0070683_100232669 | 3300005329 | Bacteria | 1752 |
| 9 | Ga0070690_100017847 | 3300005330 | Bacteria | 4278 |
| 10 | Ga0070690_100123138 | 3300005330 | Bacteria | 1743 |
| 11 | Ga0070670_100000129 | 3300005331 | Bacteria | 71325 |
| 12 | Ga0070670_100001081 | 3300005331 | Bacteria | 21612 |
| 13 | Ga0070670_100013080 | 3300005331 | Bacteria | 7108 |
| 14 | Ga0070666_10050843 | 3300005335 | Bacteria | 2789 |
| 15 | Ga0070680_100040076 | 3300005336 | Bacteria | 3791 |
| 16 | Ga0070687_100033930 | 3300005343 | Bacteria | 2523 |
| 17 | Ga0070668_100005489 | 3300005347 | Bacteria | 9407 |
| 18 | Ga0070669_100000895 | 3300005353 | Bacteria | 21689 |
| 19 | Ga0070675_100178041 | 3300005354 | Bacteria | 1837 |
| 20 | Ga0070671_100002755 | 3300005355 | Bacteria | 13650 |
| 21 | Ga0070673_100101695 | 3300005364 | Bacteria | 2368 |
| 22 | Ga0070673_100169174 | 3300005364 | Unclassified | 1864 |
| 23 | Ga0070667_100080777 | 3300005367 | Bacteria | 2782 |
| 24 | Ga0070703_10000437 | 3300005406 | Bacteria | 16968 |
| 25 | Ga0070709_10000012 | 3300005434 | Bacteria | 163026 |
| 26 | Ga0070709_10080584 | 3300005434 | Bacteria | 2123 |
| 27 | Ga0070713_100018396 | 3300005436 | Bacteria | 5311 |
| 28 | Ga0070713_100116983 | 3300005436 | Unclassified | 2332 |
| 29 | Ga0070710_10055557 | 3300005437 | Bacteria | 2238 |
| 30 | Ga0070711_100000035 | 3300005439 | Bacteria | 88475 |
| 31 | Ga0070705_100000107 | 3300005440 | Bacteria | 47341 |
| 32 | Ga0070694_100019944 | 3300005444 | Bacteria | 4269 |
| 33 | Ga0070694_100071483 | 3300005444 | Bacteria | 2392 |
| 34 | Ga0070662_100000964 | 3300005457 | Bacteria | 17651 |
| 35 | Ga0070662_100014255 | 3300005457 | Bacteria | 5306 |
| 36 | Ga0070685_10000403 | 3300005466 | Bacteria | 25952 |
| 37 | Ga0070706_100002365 | 3300005467 | Bacteria | 19038 |
| 38 | Ga0070706_100004478 | 3300005467 | Bacteria | 13473 |
| 39 | Ga0070706_100015801 | 3300005467 | Bacteria | 6969 |
| 40 | Ga0070706_100024708 | 3300005467 | Bacteria | 5532 |
| 41 | Ga0070706_100134791 | 3300005467 | Bacteria | 2305 |
| 42 | Ga0070707_100000898 | 3300005468 | Bacteria | 29541 |
| 43 | Ga0070698_100001365 | 3300005471 | Bacteria | 27171 |
| 44 | Ga0070698_100119377 | 3300005471 | Bacteria | 2597 |
| 45 | Ga0070698_100225736 | 3300005471 | Bacteria | 1806 |
| 46 | Ga0070699_100000129 | 3300005518 | Bacteria | 69764 |
| 47 | Ga0070699_100025253 | 3300005518 | Bacteria | 5123 |
| 48 | Ga0070697_100070115 | 3300005536 | Bacteria | 2873 |
| 49 | Ga0070697_100081167 | 3300005536 | Bacteria | 2672 |
| 50 | Ga0070672_100113875 | 3300005543 | Bacteria | 2208 |
| 51 | Ga0070686_100000483 | 3300005544 | Bacteria | 24107 |
| 52 | Ga0070686_100086499 | 3300005544 | Bacteria | 2087 |
| 53 | Ga0070696_100001116 | 3300005546 | Bacteria | 17376 |
| 54 | Ga0070696_100022549 | 3300005546 | Bacteria | 4278 |
| 55 | Ga0070696_100046900 | 3300005546 | Bacteria | 2997 |
| 56 | Ga0070665_100141697 | 3300005548 | Unclassified | 2407 |
| 57 | Ga0070704_100027982 | 3300005549 | Unclassified | 3745 |
| 58 | Ga0070704_100033212 | 3300005549 | Bacteria | 3487 |
| 59 | Ga0070704_100357493 | 3300005549 | Bacteria | 1235 |
| 60 | Ga0070664_100177935 | 3300005564 | Bacteria | 1889 |
| 61 | Ga0068859_100001956 | 3300005617 | Bacteria | 21008 |
| 62 | Ga0068859_100393661 | 3300005617 | Unclassified | 1481 |
| 63 | Ga0068861_100091552 | 3300005719 | Unclassified | 2401 |
| 64 | Ga0068861_100095837 | 3300005719 | Bacteria | 2351 |
| 65 | Ga0068858_100033667 | 3300005842 | Bacteria | 4753 |
| 66 | Ga0068858_100084311 | 3300005842 | Bacteria | 2956 |
| 67 | Ga0068862_100023796 | 3300005844 | Bacteria | 5134 |
| 68 | Ga0070715_10000004 | 3300006163 | Bacteria | 305411 |
| 69 | Ga0070716_100041999 | 3300006173 | Bacteria | 2551 |
| 70 | Ga0070716_100050718 | 3300006173 | Bacteria | 2357 |
| 71 | Ga0075428_100016805 | 3300006844 | Bacteria | 8080 |
| 72 | Ga0075428_100131666 | 3300006844 | Bacteria | 2720 |
| 73 | Ga0075431_100202855 | 3300006847 | Bacteria | 2029 |
| 74 | Ga0075431_100335467 | 3300006847 | Unclassified | 1522 |
| 75 | Ga0075433_10010772 | 3300006852 | Bacteria | 7353 |
| 76 | Ga0075433_10315009 | 3300006852 | Bacteria | 1384 |
| 77 | Ga0075434_100194980 | 3300006871 | Bacteria | 2045 |
| 78 | Ga0075429_100259428 | 3300006880 | Bacteria | 1521 |
| 79 | Ga0075436_100000141 | 3300006914 | Bacteria | 43568 |
| 80 | Ga0075436_100000354 | 3300006914 | Bacteria | 29304 |
| 81 | Ga0075436_100018652 | 3300006914 | Bacteria | 4749 |
| 82 | Ga0075436_100126476 | 3300006914 | Bacteria | 1791 |
| 83 | Ga0097620_100001956 | 3300006931 | Bacteria | 21008 |
| 84 | Ga0097620_100393675 | 3300006931 | Unclassified | 1481 |
| 85 | Ga0105240_10104412 | 3300009093 | Unclassified | 3441 |
| 86 | Ga0105240_10149670 | 3300009093 | Bacteria | 2782 |
| 87 | Ga0114129_10048408 | 3300009147 | Bacteria | 5973 |
| 88 | Ga0105242_10002694 | 3300009176 | Bacteria | 13895 |
| 89 | Ga0105242_10153831 | 3300009176 | Bacteria | 2007 |
| 90 | Ga0105248_10020688 | 3300009177 | Bacteria | 7292 |
| 91 | Ga0105248_10035501 | 3300009177 | Bacteria | 5577 |
| 92 | Ga0105248_10128559 | 3300009177 | Bacteria | 2858 |
| 93 | Ga0105248_10570668 | 3300009177 | Bacteria | 1277 |
| 94 | Ga0105238_10000035 | 3300009551 | Bacteria | 165866 |
| 95 | Ga0105238_10027289 | 3300009551 | Bacteria | 5817 |
| 96 | Ga0105249_10000044 | 3300009553 | Bacteria | 184637 |
| 97 | Ga0105249_10080456 | 3300009553 | Bacteria | 3026 |
| 98 | Ga0105246_10271500 | 3300011119 | Bacteria | 1356 |
| 99 | Ga0157373_10039709 | 3300013100 | Unclassified | 3368 |
| 100 | Ga0163162_10000025 | 3300013306 | Bacteria | 184648 |
| 101 | Ga0163162_10018599 | 3300013306 | Bacteria | 6808 |
| 102 | Ga0163162_10034639 | 3300013306 | Bacteria | 5026 |
| 103 | Ga0163162_10055377 | 3300013306 | Bacteria | 3992 |
| 104 | Ga0163162_10115495 | 3300013306 | Unclassified | 2784 |
| 105 | Ga0157375_10014193 | 3300013308 | Bacteria | 7102 |
| 106 | Ga0157375_10033482 | 3300013308 | Bacteria | 4884 |
| 107 | Ga0163163_10000536 | 3300014325 | Bacteria | 33560 |
| 108 | Ga0163163_10020034 | 3300014325 | Bacteria | 6294 |
| 109 | Ga0163163_10027068 | 3300014325 | Bacteria | 5487 |
| 110 | Ga0163163_10209450 | 3300014325 | Unclassified | 1998 |
| 111 | Ga0157380_10015309 | 3300014326 | Bacteria | 5636 |
| 112 | Ga0157380_10034593 | 3300014326 | Bacteria | 3898 |
| 113 | Ga0157380_10554474 | 3300014326 | Bacteria | 1128 |
| 114 | Ga0157376_10065672 | 3300014969 | Bacteria | 3065 |
| 115 | Ga0163161_10000627 | 3300017792 | Bacteria | 28166 |
| 116 | Ga0213872_10016501 | 3300021361 | Bacteria | 3426 |
| 117 | Ga0213876_10000006 | 3300021384 | Bacteria | 700803 |
| 118 | Ga0213876_10000196 | 3300021384 | Bacteria | 62628 |
| 119 | Ga0228598_1004948 | 3300024227 | Bacteria | 2803 |
| 120 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 121 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 122 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 123 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 124 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 125 | Ga0207653_10000212 | 3300025885 | Bacteria | 39081 |
| 126 | Ga0207685_10000004 | 3300025905 | Bacteria | 305368 |
| 127 | Ga0207699_10000007 | 3300025906 | Bacteria | 405928 |
| 128 | Ga0207699_10039473 | 3300025906 | Unclassified | 2713 |
| 129 | Ga0207643_10010247 | 3300025908 | Bacteria | 5043 |
| 130 | Ga0207684_10000611 | 3300025910 | Bacteria | 42502 |
| 131 | Ga0207684_10090419 | 3300025910 | Bacteria | 2608 |
| 132 | Ga0207695_10460260 | 3300025913 | Unclassified | 1155 |
| 133 | Ga0207663_10000037 | 3300025916 | Bacteria | 85962 |
| 134 | Ga0207662_10046915 | 3300025918 | Bacteria | 2558 |
| 135 | Ga0207662_10077993 | 3300025918 | Bacteria | 2016 |
| 136 | Ga0207646_10000086 | 3300025922 | Bacteria | 125294 |
| 137 | Ga0207681_10001635 | 3300025923 | Bacteria | 14449 |
| 138 | Ga0207694_10000045 | 3300025924 | Bacteria | 165875 |
| 139 | Ga0207694_10072286 | 3300025924 | Bacteria | 2697 |
| 140 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 141 | Ga0207650_10000511 | 3300025925 | Bacteria | 32409 |
| 142 | Ga0207650_10005142 | 3300025925 | Bacteria | 8932 |
| 143 | Ga0207659_10010495 | 3300025926 | Bacteria | 5821 |
| 144 | Ga0207700_10221079 | 3300025928 | Unclassified | 1605 |
| 145 | Ga0207644_10143956 | 3300025931 | Bacteria | 1838 |
| 146 | Ga0207706_10000352 | 3300025933 | Bacteria | 49647 |
| 147 | Ga0207706_10060360 | 3300025933 | Bacteria | 3339 |
| 148 | Ga0207686_10001521 | 3300025934 | Bacteria | 13071 |
| 149 | Ga0207704_10080482 | 3300025938 | Bacteria | 2103 |
| 150 | Ga0207665_10020501 | 3300025939 | Bacteria | 4344 |
| 151 | Ga0207691_10056300 | 3300025940 | Bacteria | 3582 |
| 152 | Ga0207679_10086940 | 3300025945 | Bacteria | 2406 |
| 153 | Ga0207651_10050291 | 3300025960 | Bacteria | 2829 |
| 154 | Ga0207712_10000039 | 3300025961 | Bacteria | 182548 |
| 155 | Ga0207668_10011390 | 3300025972 | Bacteria | 5401 |
| 156 | Ga0207703_10026961 | 3300026035 | Bacteria | 4526 |
| 157 | Ga0207674_10128343 | 3300026116 | Bacteria | 2500 |
| 158 | Ga0207675_100227089 | 3300026118 | Unclassified | 1800 |
| 159 | Ga0268265_10061252 | 3300028380 | Bacteria | 2887 |
| 160 | Ga0268265_10072971 | 3300028380 | Bacteria | 2679 |
| 161 | Ga0268264_10001544 | 3300028381 | Bacteria | 21399 |
| 162 | Ga0265319_1000470 | 3300028563 | Bacteria | 28544 |
| 163 | Ga0265318_10000099 | 3300028577 | Bacteria | 80487 |
| 164 | Ga0265338_10181362 | 3300028800 | Bacteria | 1605 |
| 165 | Ga0265330_10014855 | 3300031235 | Bacteria | 3609 |
| 166 | Ga0265330_10057941 | 3300031235 | Bacteria | 1689 |
| 167 | Ga0265332_10073681 | 3300031238 | Bacteria | 1453 |
| 168 | Ga0265320_10000181 | 3300031240 | Bacteria | 53202 |
| 169 | Ga0265329_10004083 | 3300031242 | Bacteria | 6200 |
| 170 | Ga0265340_10000296 | 3300031247 | Bacteria | 26080 |
| 171 | Ga0265340_10000810 | 3300031247 | Bacteria | 17756 |
| 172 | Ga0265331_10000112 | 3300031250 | Bacteria | 107928 |
| 173 | Ga0265316_10004953 | 3300031344 | Bacteria | 13091 |
| 174 | Ga0265316_10005147 | 3300031344 | Bacteria | 12809 |
| 175 | Ga0265316_10231309 | 3300031344 | Bacteria | 1361 |
| 176 | Ga0307408_100295807 | 3300031548 | Unclassified | 1354 |
| 177 | Ga0265314_10017628 | 3300031711 | Bacteria | 5598 |
| 178 | Ga0265314_10020333 | 3300031711 | Bacteria | 5125 |
| 179 | Ga0265314_10021462 | 3300031711 | Bacteria | 4964 |
| 180 | Ga0265342_10010902 | 3300031712 | Bacteria | 6251 |
| 181 | Ga0307405_10034888 | 3300031731 | Bacteria | 2999 |
| 182 | Ga0307413_10226289 | 3300031824 | Bacteria | 1370 |
| 183 | Ga0307409_100091626 | 3300031995 | Bacteria | 2492 |
| 184 | Ga0307416_100221212 | 3300032002 | Unclassified | 1816 |
| 185 | Ga0307415_100048329 | 3300032126 | Unclassified | 2870 |
| 186 | Ga0307415_100063416 | 3300032126 | Bacteria | 2568 |
| 187 | Ga0373959_0000049 | 3300034820 | Bacteria | 27086 |
| 188 | Ga0373943_0021401 | 3300035170 | Bacteria | 2987 |
| 189 | Ga0373955_0180961 | 3300035172 | Bacteria | 1251 |
| 190 | Ga0373931_0056739 | 3300035691 | Bacteria | 2099 |
| 191 | Ga0373927_0001605 | 3300035695 | Bacteria | 16969 |
| 192 | Ga0373933_0074611 | 3300035724 | Bacteria | 2069 |
| 193 | Ga0373947_0002395 | 3300035725 | Bacteria | 11330 |
| 194 | Ga0373925_0001084 | 3300037068 | Bacteria | 24460 |
| 195 | Ga0436364_0555582 | 3300037853 | Bacteria | 4042 |
| 196 | Ga0436365_0676892 | 3300039437 | Bacteria | 5366 |
| 197 | Ga0436365_0695157 | 3300039437 | Bacteria | 511493 |
| 198 | Ga0436365_1753418 | 3300039437 | Bacteria | 95553 |
| 199 | Ga0436361_0519738 | 3300039447 | Bacteria | 9169 |
| 200 | Ga0439434_0032341 | 3300042435 | Bacteria | 1592 |
| 201 | Ga0451577_0020550 | 3300042876 | Bacteria | 6056 |
| 202 | Ga0451577_0127239 | 3300042876 | Bacteria | 2283 |
| 203 | Ga0466972_0028198 | 3300044658 | Bacteria | 2772 |
| 204 | Ga0453683_0001721 | 3300044673 | Bacteria | 18169 |
| 205 | Ga0453683_0003711 | 3300044673 | Bacteria | 11160 |
| 206 | Ga0453683_0162383 | 3300044673 | Bacteria | 1414 |
| 207 | Ga0466961_0017069 | 3300044693 | Bacteria | 4662 |
| 208 | Ga0453684_0001118 | 3300044712 | Bacteria | 84057 |
| 209 | Ga0453684_0002640 | 3300044712 | Bacteria | 42842 |
| 210 | Ga0453684_0007813 | 3300044712 | Bacteria | 19504 |
| 211 | Ga0453684_0519285 | 3300044712 | Bacteria | 1316 |
| 212 | Ga0451576_0026565 | 3300045051 | Bacteria | 6226 |
| 213 | Ga0451576_0336966 | 3300045051 | Bacteria | 1579 |
| 214 | Ga0466967_0020166 | 3300045976 | Bacteria | 5379 |
| 215 | Ga0466967_0147153 | 3300045976 | Bacteria | 2198 |
| 216 | Ga0495651_0037330 | 3300046462 | Bacteria | 3782 |
| 217 | Ga0495664_0033244 | 3300046477 | Bacteria | 3031 |
| 218 | Ga0495632_0056821 | 3300046519 | Bacteria | 1912 |
| 219 | Ga0495643_0000071 | 3300046522 | Bacteria | 168991 |
| 220 | Ga0495621_0004181 | 3300046539 | Bacteria | 4033 |
| 221 | Ga0495667_0031358 | 3300046559 | Bacteria | 3568 |
| 222 | Ga0495657_0096298 | 3300046675 | Bacteria | 1891 |
| 223 | Ga0495624_0075607 | 3300046690 | Bacteria | 2091 |
| 224 | Ga0495604_0078571 | 3300047317 | Bacteria | 2476 |
| 225 | Ga0495636_0022036 | 3300047318 | Bacteria | 2575 |
| 226 | Ga0495674_0015843 | 3300047319 | Bacteria | 7038 |
| 227 | Ga0495672_0159538 | 3300047320 | Bacteria | 1161 |
| 228 | Ga0495680_0003571 | 3300047322 | Bacteria | 15237 |
| 229 | Ga0495602_0003963 | 3300048088 | Bacteria | 15427 |
| 230 | Ga0495615_0001182 | 3300048090 | Bacteria | 3790 |
| 231 | Ga0495615_0003851 | 3300048090 | Bacteria | 2556 |
| 232 | Ga0496114_0084674 | 3300048917 | Bacteria | 2685 |
| 233 | Ga0496124_0195463 | 3300048927 | Bacteria | 1544 |
| 234 | Ga0501047_0047159 | 3300049581 | Bacteria | 4163 |
| 235 | Ga0501201_004791 | 3300049651 | Bacteria | 1258 |
| 236 | Ga0501083_0057541 | 3300049744 | Bacteria | 2602 |
| 237 | Ga0501035_0000519 | 3300049822 | Bacteria | 43363 |
| 238 | nmdc:mga05p37_177333_c1 | 3300050507 | Unclassified | 2595 |
| 239 | nmdc:mga0qj67_307665_c1 | 3300050509 | Bacteria | 1284 |
| 240 | nmdc:mga08y16_145586_c1 | 3300050511 | Bacteria | 2463 |
| 241 | nmdc:mga0n895_2952_c1 | 3300050512 | Bacteria | 13496 |
| 242 | nmdc:mga0n895_370851_c1 | 3300050512 | Bacteria | 1449 |
| 243 | nmdc:mga0n895_436476_c1 | 3300050512 | Bacteria | 1323 |
| 244 | nmdc:mga08x19_169883_c1 | 3300050514 | Bacteria | 1485 |
| 245 | nmdc:mga08x19_203_c1 | 3300050514 | Bacteria | 45690 |
| 246 | nmdc:mga08x19_22444_c1 | 3300050514 | Bacteria | 3909 |
| 247 | nmdc:mga08x19_44400_c1 | 3300050514 | Bacteria | 2838 |
| 248 | nmdc:mga08x19_497_c1 | 3300050514 | Bacteria | 26186 |
| 249 | nmdc:mga08x19_71907_c1 | 3300050514 | Bacteria | 2256 |
| 250 | nmdc:mga0a205_101655_c1 | 3300050515 | Bacteria | 2773 |
| 251 | Ga0501082_0051516 | 3300060353 | Bacteria | 3548 |
| 252 | Ga0501082_0147603 | 3300060353 | Bacteria | 2042 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049651 | Ga0501201_004791 | Ga0501201_004791_326_1246 | 298 |
| 2 | 3300050514 | nmdc:mga08x19_71907_c1 | nmdc:mga08x19_71907_c1_1290_2225 | 310 |
| 3 | 3300025918 | Ga0207662_10077993 | Ga0207662_100779932 | 314 |
| 4 | 3300042435 | Ga0439434_0032341 | Ga0439434_0032341_581_1570 | 319 |
| 5 | 3300046690 | Ga0495624_0075607 | Ga0495624_0075607_25_1065 | 336 |
| 6 | 3300031995 | Ga0307409_100091626 | Ga0307409_1000916262 | 339 |
| 7 | 3300045976 | Ga0466967_0020166 | Ga0466967_0020166_4152_5195 | 340 |
| 8 | 3300006914 | Ga0075436_100126476 | Ga0075436_1001264762 | 341 |
| 9 | 3300050514 | nmdc:mga08x19_169883_c1 | nmdc:mga08x19_169883_c1_306_1334 | 341 |
| 10 | 3300050514 | nmdc:mga08x19_44400_c1 | nmdc:mga08x19_44400_c1_1413_2441 | 341 |
| 11 | 3300003751 | Ga0055538_1000020 | Ga0055538_100002072 | 342 |
| 12 | 3300003752 | Ga0055539_1000025 | Ga0055539_100002572 | 342 |
| 13 | 3300003756 | Ga0055533_1000034 | Ga0055533_1000034171 | 342 |
| 14 | 3300003759 | Ga0055525_1000044 | Ga0055525_100004472 | 342 |
| 15 | 3300003841 | Ga0055541_1000019 | Ga0055541_100001972 | 342 |
| 16 | 3300025224 | Ga0209784_100002 | Ga0209784_10000275 | 342 |
| 17 | 3300025225 | Ga0209566_100003 | Ga0209566_10000375 | 342 |
| 18 | 3300025226 | Ga0209674_100004 | Ga0209674_10000475 | 342 |
| 19 | 3300025230 | Ga0209563_100006 | Ga0209563_10000675 | 342 |
| 20 | 3300025253 | Ga0209677_100003 | Ga0209677_10000375 | 342 |
| 21 | 3300050512 | nmdc:mga0n895_436476_c1 | nmdc:mga0n895_436476_c1_269_1312 | 342 |
| 22 | 3300005330 | Ga0070690_100123138 | Ga0070690_1001231382 | 345 |
| 23 | 3300005343 | Ga0070687_100033930 | Ga0070687_1000339302 | 345 |
| 24 | 3300005355 | Ga0070671_100002755 | Ga0070671_1000027556 | 345 |
| 25 | 3300005367 | Ga0070667_100080777 | Ga0070667_1000807772 | 345 |
| 26 | 3300005543 | Ga0070672_100113875 | Ga0070672_1001138751 | 345 |
| 27 | 3300005544 | Ga0070686_100086499 | Ga0070686_1000864991 | 345 |
| 28 | 3300005842 | Ga0068858_100033667 | Ga0068858_1000336672 | 345 |
| 29 | 3300009177 | Ga0105248_10035501 | Ga0105248_100355013 | 345 |
| 30 | 3300009177 | Ga0105248_10570668 | Ga0105248_105706682 | 345 |
| 31 | 3300013308 | Ga0157375_10014193 | Ga0157375_100141933 | 345 |
| 32 | 3300025931 | Ga0207644_10143956 | Ga0207644_101439562 | 345 |
| 33 | iso_pu_bacteria | 8001522603 | 8001523214 | 345 |
| 34 | 3300014969 | Ga0157376_10065672 | Ga0157376_100656723 | 347 |
| 35 | 3300028381 | Ga0268264_10001544 | Ga0268264_1000154419 | 348 |
| 36 | 3300044712 | Ga0453684_0519285 | Ga0453684_0519285_222_1292 | 348 |
| 37 | 3300049744 | Ga0501083_0057541 | Ga0501083_0057541_908_1978 | 348 |
| 38 | 3300060353 | Ga0501082_0051516 | Ga0501082_0051516_354_1427 | 348 |
| 39 | 3300005471 | Ga0070698_100001365 | Ga0070698_10000136517 | 349 |
| 40 | 3300009147 | Ga0114129_10048408 | Ga0114129_100484085 | 349 |
| 41 | 3300009176 | Ga0105242_10002694 | Ga0105242_100026942 | 349 |
| 42 | 3300009177 | Ga0105248_10020688 | Ga0105248_100206883 | 349 |
| 43 | 3300013306 | Ga0163162_10018599 | Ga0163162_100185993 | 349 |
| 44 | 3300013306 | Ga0163162_10034639 | Ga0163162_100346394 | 349 |
| 45 | 3300014325 | Ga0163163_10027068 | Ga0163163_100270682 | 349 |
| 46 | 3300025934 | Ga0207686_10001521 | Ga0207686_1000152115 | 349 |
| 47 | 3300049581 | Ga0501047_0047159 | Ga0501047_0047159_509_1567 | 349 |
| 48 | 3300050507 | nmdc:mga05p37_177333_c1 | nmdc:mga05p37_177333_c1_203_1258 | 349 |
| 49 | 3300050514 | nmdc:mga08x19_203_c1 | nmdc:mga08x19_203_c1_4267_5334 | 349 |
| 50 | 3300047320 | Ga0495672_0159538 | Ga0495672_0159538_15_1067 | 350 |
| 51 | 3300009093 | Ga0105240_10149670 | Ga0105240_101496701 | 353 |
| 52 | 3300009551 | Ga0105238_10000035 | Ga0105238_1000003596 | 353 |
| 53 | 3300025924 | Ga0207694_10000045 | Ga0207694_1000004570 | 353 |
| 54 | 3300025928 | Ga0207700_10221079 | Ga0207700_102210792 | 353 |
| 55 | 3300005353 | Ga0070669_100000895 | Ga0070669_1000008956 | 354 |
| 56 | 3300005434 | Ga0070709_10080584 | Ga0070709_100805841 | 354 |
| 57 | 3300005436 | Ga0070713_100018396 | Ga0070713_1000183963 | 354 |
| 58 | 3300005437 | Ga0070710_10055557 | Ga0070710_100555572 | 354 |
| 59 | 3300011119 | Ga0105246_10271500 | Ga0105246_102715001 | 354 |
| 60 | 3300025906 | Ga0207699_10039473 | Ga0207699_100394733 | 354 |
| 61 | 3300025923 | Ga0207681_10001635 | Ga0207681_100016358 | 354 |
| 62 | 3300005467 | Ga0070706_100002365 | Ga0070706_1000023659 | 355 |
| 63 | 3300024227 | Ga0228598_1004948 | Ga0228598_10049482 | 356 |
| 64 | 3300034820 | Ga0373959_0000049 | Ga0373959_0000049_22676_23821 | 356 |
| 65 | 3300031711 | Ga0265314_10021462 | Ga0265314_100214622 | 357 |
| 66 | 3300035691 | Ga0373931_0056739 | Ga0373931_0056739_516_1649 | 357 |
| 67 | 3300044712 | Ga0453684_0007813 | Ga0453684_0007813_1213_2292 | 357 |
| 68 | 3300005467 | Ga0070706_100024708 | Ga0070706_1000247084 | 358 |
| 69 | 3300005468 | Ga0070707_100000898 | Ga0070707_10000089825 | 358 |
| 70 | 3300005471 | Ga0070698_100119377 | Ga0070698_1001193772 | 358 |
| 71 | 3300005536 | Ga0070697_100070115 | Ga0070697_1000701153 | 358 |
| 72 | 3300005549 | Ga0070704_100357493 | Ga0070704_1003574931 | 358 |
| 73 | 3300014326 | Ga0157380_10554474 | Ga0157380_105544741 | 358 |
| 74 | 3300025910 | Ga0207684_10090419 | Ga0207684_100904192 | 358 |
| 75 | 3300025922 | Ga0207646_10000086 | Ga0207646_1000008656 | 358 |
| 76 | 3300028563 | Ga0265319_1000470 | Ga0265319_100047023 | 358 |
| 77 | 3300028577 | Ga0265318_10000099 | Ga0265318_1000009968 | 358 |
| 78 | 3300028800 | Ga0265338_10181362 | Ga0265338_101813622 | 358 |
| 79 | 3300031235 | Ga0265330_10057941 | Ga0265330_100579412 | 358 |
| 80 | 3300031238 | Ga0265332_10073681 | Ga0265332_100736811 | 358 |
| 81 | 3300031240 | Ga0265320_10000181 | Ga0265320_1000018141 | 358 |
| 82 | 3300031242 | Ga0265329_10004083 | Ga0265329_100040833 | 358 |
| 83 | 3300031247 | Ga0265340_10000810 | Ga0265340_1000081014 | 358 |
| 84 | 3300031250 | Ga0265331_10000112 | Ga0265331_100001124 | 358 |
| 85 | 3300031344 | Ga0265316_10004953 | Ga0265316_100049532 | 358 |
| 86 | 3300031711 | Ga0265314_10020333 | Ga0265314_100203333 | 358 |
| 87 | 3300031712 | Ga0265342_10010902 | Ga0265342_100109023 | 358 |
| 88 | 3300042876 | Ga0451577_0020550 | Ga0451577_0020550_114_1238 | 358 |
| 89 | 3300044673 | Ga0453683_0003711 | Ga0453683_0003711_6896_8020 | 358 |
| 90 | 3300044712 | Ga0453684_0002640 | Ga0453684_0002640_17982_19106 | 358 |
| 91 | 3300045051 | Ga0451576_0026565 | Ga0451576_0026565_1328_2452 | 358 |
| 92 | 3300046462 | Ga0495651_0037330 | Ga0495651_0037330_2580_3686 | 358 |
| 93 | 3300046477 | Ga0495664_0033244 | Ga0495664_0033244_1314_2420 | 358 |
| 94 | 3300046539 | Ga0495621_0004181 | Ga0495621_0004181_2499_3584 | 358 |
| 95 | 3300046559 | Ga0495667_0031358 | Ga0495667_0031358_858_1964 | 358 |
| 96 | 3300046675 | Ga0495657_0096298 | Ga0495657_0096298_299_1405 | 358 |
| 97 | 3300047322 | Ga0495680_0003571 | Ga0495680_0003571_13126_14232 | 358 |
| 98 | 3300005335 | Ga0070666_10050843 | Ga0070666_100508432 | 359 |
| 99 | 3300005436 | Ga0070713_100116983 | Ga0070713_1001169832 | 359 |
| 100 | 3300005466 | Ga0070685_10000403 | Ga0070685_1000040317 | 359 |
| 101 | 3300005518 | Ga0070699_100025253 | Ga0070699_1000252533 | 359 |
| 102 | 3300005544 | Ga0070686_100000483 | Ga0070686_1000004833 | 359 |
| 103 | 3300006173 | Ga0070716_100041999 | Ga0070716_1000419991 | 359 |
| 104 | 3300006847 | Ga0075431_100202855 | Ga0075431_1002028552 | 359 |
| 105 | 3300006914 | Ga0075436_100000141 | Ga0075436_1000001419 | 359 |
| 106 | 3300006914 | Ga0075436_100018652 | Ga0075436_1000186522 | 359 |
| 107 | 3300009177 | Ga0105248_10128559 | Ga0105248_101285592 | 359 |
| 108 | 3300025918 | Ga0207662_10046915 | Ga0207662_100469152 | 359 |
| 109 | 3300025939 | Ga0207665_10020501 | Ga0207665_100205014 | 359 |
| 110 | 3300035170 | Ga0373943_0021401 | Ga0373943_0021401_130_1236 | 359 |
| 111 | 3300035695 | Ga0373927_0001605 | Ga0373927_0001605_367_1473 | 359 |
| 112 | 3300035725 | Ga0373947_0002395 | Ga0373947_0002395_7651_8757 | 359 |
| 113 | 3300037068 | Ga0373925_0001084 | Ga0373925_0001084_15467_16573 | 359 |
| 114 | 3300044693 | Ga0466961_0017069 | Ga0466961_0017069_569_1714 | 359 |
| 115 | 3300047317 | Ga0495604_0078571 | Ga0495604_0078571_562_1734 | 359 |
| 116 | 3300047319 | Ga0495674_0015843 | Ga0495674_0015843_68_1240 | 359 |
| 117 | 3300048088 | Ga0495602_0003963 | Ga0495602_0003963_1031_2203 | 359 |
| 118 | 3300048917 | Ga0496114_0084674 | Ga0496114_0084674_808_1905 | 359 |
| 119 | 3300050512 | nmdc:mga0n895_2952_c1 | nmdc:mga0n895_2952_c1_9075_10163 | 359 |
| 120 | 3300050514 | nmdc:mga08x19_22444_c1 | nmdc:mga08x19_22444_c1_797_1885 | 359 |
| 121 | 3300050514 | nmdc:mga08x19_497_c1 | nmdc:mga08x19_497_c1_8885_9991 | 359 |
| 122 | 3300005329 | Ga0070683_100232669 | Ga0070683_1002326692 | 360 |
| 123 | 3300005546 | Ga0070696_100022549 | Ga0070696_1000225492 | 360 |
| 124 | 3300013306 | Ga0163162_10055377 | Ga0163162_100553772 | 360 |
| 125 | 3300025938 | Ga0207704_10080482 | Ga0207704_100804822 | 360 |
| 126 | 3300031824 | Ga0307413_10226289 | Ga0307413_102262892 | 360 |
| 127 | 3300035172 | Ga0373955_0180961 | Ga0373955_0180961_41_1159 | 360 |
| 128 | 3300046522 | Ga0495643_0000071 | Ga0495643_0000071_22010_23116 | 360 |
| 129 | 3300005330 | Ga0070690_100017847 | Ga0070690_1000178473 | 361 |
| 130 | 3300005364 | Ga0070673_100101695 | Ga0070673_1001016951 | 361 |
| 131 | 3300005457 | Ga0070662_100000964 | Ga0070662_10000096415 | 361 |
| 132 | 3300005457 | Ga0070662_100014255 | Ga0070662_1000142552 | 361 |
| 133 | 3300005549 | Ga0070704_100027982 | Ga0070704_1000279822 | 361 |
| 134 | 3300005719 | Ga0068861_100095837 | Ga0068861_1000958372 | 361 |
| 135 | 3300005844 | Ga0068862_100023796 | Ga0068862_1000237962 | 361 |
| 136 | 3300009176 | Ga0105242_10153831 | Ga0105242_101538312 | 361 |
| 137 | 3300009553 | Ga0105249_10080456 | Ga0105249_100804562 | 361 |
| 138 | 3300014326 | Ga0157380_10015309 | Ga0157380_100153094 | 361 |
| 139 | 3300025933 | Ga0207706_10000352 | Ga0207706_1000035214 | 361 |
| 140 | 3300025933 | Ga0207706_10060360 | Ga0207706_100603602 | 361 |
| 141 | 3300028380 | Ga0268265_10061252 | Ga0268265_100612522 | 361 |
| 142 | 3300031235 | Ga0265330_10014855 | Ga0265330_100148552 | 361 |
| 143 | 3300031247 | Ga0265340_10000296 | Ga0265340_100002966 | 361 |
| 144 | 3300031344 | Ga0265316_10005147 | Ga0265316_100051479 | 361 |
| 145 | 3300031344 | Ga0265316_10231309 | Ga0265316_102313091 | 361 |
| 146 | 3300031711 | Ga0265314_10017628 | Ga0265314_100176284 | 361 |
| 147 | 3300032126 | Ga0307415_100048329 | Ga0307415_1000483293 | 361 |
| 148 | 3300035724 | Ga0373933_0074611 | Ga0373933_0074611_433_1539 | 361 |
| 149 | 3300037853 | Ga0436364_0555582 | Ga0436364_0555582_1067_2155 | 361 |
| 150 | 3300042876 | Ga0451577_0127239 | Ga0451577_0127239_712_1821 | 361 |
| 151 | 3300044673 | Ga0453683_0001721 | Ga0453683_0001721_3889_4998 | 361 |
| 152 | 3300044673 | Ga0453683_0162383 | Ga0453683_0162383_29_1147 | 361 |
| 153 | 3300044712 | Ga0453684_0001118 | Ga0453684_0001118_24098_25258 | 361 |
| 154 | 3300005331 | Ga0070670_100001081 | Ga0070670_1000010812 | 362 |
| 155 | 3300005467 | Ga0070706_100015801 | Ga0070706_1000158011 | 362 |
| 156 | 3300005471 | Ga0070698_100225736 | Ga0070698_1002257361 | 362 |
| 157 | 3300005617 | Ga0068859_100001956 | Ga0068859_1000019563 | 362 |
| 158 | 3300006844 | Ga0075428_100131666 | Ga0075428_1001316662 | 362 |
| 159 | 3300006852 | Ga0075433_10010772 | Ga0075433_100107724 | 362 |
| 160 | 3300006931 | Ga0097620_100001956 | Ga0097620_1000019563 | 362 |
| 161 | 3300025925 | Ga0207650_10000511 | Ga0207650_100005115 | 362 |
| 162 | 3300025960 | Ga0207651_10050291 | Ga0207651_100502912 | 362 |
| 163 | 3300032126 | Ga0307415_100063416 | Ga0307415_1000634161 | 362 |
| 164 | 3300044658 | Ga0466972_0028198 | Ga0466972_0028198_101_1228 | 362 |
| 165 | 3300045976 | Ga0466967_0147153 | Ga0466967_0147153_251_1399 | 362 |
| 166 | 3300047318 | Ga0495636_0022036 | Ga0495636_0022036_464_1585 | 362 |
| 167 | 3300048090 | Ga0495615_0001182 | Ga0495615_0001182_2509_3636 | 362 |
| 168 | 3300048090 | Ga0495615_0003851 | Ga0495615_0003851_387_1517 | 362 |
| 169 | 3300048927 | Ga0496124_0195463 | Ga0496124_0195463_376_1494 | 362 |
| 170 | 3300049822 | Ga0501035_0000519 | Ga0501035_0000519_31234_32364 | 362 |
| 171 | 3300060353 | Ga0501082_0147603 | Ga0501082_0147603_757_1887 | 362 |
| 172 | 3300002459 | JGI24751J29686_10000013 | JGI24751J29686_1000001356 | 363 |
| 173 | 3300005331 | Ga0070670_100000129 | Ga0070670_10000012937 | 363 |
| 174 | 3300005331 | Ga0070670_100013080 | Ga0070670_1000130806 | 363 |
| 175 | 3300005336 | Ga0070680_100040076 | Ga0070680_1000400762 | 363 |
| 176 | 3300005354 | Ga0070675_100178041 | Ga0070675_1001780412 | 363 |
| 177 | 3300005364 | Ga0070673_100169174 | Ga0070673_1001691742 | 363 |
| 178 | 3300005406 | Ga0070703_10000437 | Ga0070703_1000043710 | 363 |
| 179 | 3300005439 | Ga0070711_100000035 | Ga0070711_1000000355 | 363 |
| 180 | 3300005440 | Ga0070705_100000107 | Ga0070705_10000010729 | 363 |
| 181 | 3300005444 | Ga0070694_100019944 | Ga0070694_1000199443 | 363 |
| 182 | 3300005467 | Ga0070706_100004478 | Ga0070706_1000044784 | 363 |
| 183 | 3300005518 | Ga0070699_100000129 | Ga0070699_10000012961 | 363 |
| 184 | 3300005546 | Ga0070696_100001116 | Ga0070696_10000111611 | 363 |
| 185 | 3300005546 | Ga0070696_100046900 | Ga0070696_1000469002 | 363 |
| 186 | 3300005549 | Ga0070704_100033212 | Ga0070704_1000332123 | 363 |
| 187 | 3300005564 | Ga0070664_100177935 | Ga0070664_1001779352 | 363 |
| 188 | 3300005719 | Ga0068861_100091552 | Ga0068861_1000915522 | 363 |
| 189 | 3300005842 | Ga0068858_100084311 | Ga0068858_1000843112 | 363 |
| 190 | 3300006844 | Ga0075428_100016805 | Ga0075428_1000168056 | 363 |
| 191 | 3300006847 | Ga0075431_100335467 | Ga0075431_1003354672 | 363 |
| 192 | 3300006852 | Ga0075433_10315009 | Ga0075433_103150092 | 363 |
| 193 | 3300006871 | Ga0075434_100194980 | Ga0075434_1001949802 | 363 |
| 194 | 3300006880 | Ga0075429_100259428 | Ga0075429_1002594281 | 363 |
| 195 | 3300006914 | Ga0075436_100000354 | Ga0075436_1000003545 | 363 |
| 196 | 3300009551 | Ga0105238_10027289 | Ga0105238_100272892 | 363 |
| 197 | 3300013100 | Ga0157373_10039709 | Ga0157373_100397092 | 363 |
| 198 | 3300013306 | Ga0163162_10115495 | Ga0163162_101154952 | 363 |
| 199 | 3300014325 | Ga0163163_10000536 | Ga0163163_1000053614 | 363 |
| 200 | 3300014325 | Ga0163163_10020034 | Ga0163163_100200346 | 363 |
| 201 | 3300014325 | Ga0163163_10209450 | Ga0163163_102094504 | 363 |
| 202 | 3300014326 | Ga0157380_10034593 | Ga0157380_100345933 | 363 |
| 203 | 3300021361 | Ga0213872_10016501 | Ga0213872_100165012 | 363 |
| 204 | 3300025885 | Ga0207653_10000212 | Ga0207653_100002124 | 363 |
| 205 | 3300025908 | Ga0207643_10010247 | Ga0207643_100102472 | 363 |
| 206 | 3300025910 | Ga0207684_10000611 | Ga0207684_100006114 | 363 |
| 207 | 3300025916 | Ga0207663_10000037 | Ga0207663_100000375 | 363 |
| 208 | 3300025924 | Ga0207694_10072286 | Ga0207694_100722862 | 363 |
| 209 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001106 | 363 |
| 210 | 3300025925 | Ga0207650_10005142 | Ga0207650_100051423 | 363 |
| 211 | 3300025926 | Ga0207659_10010495 | Ga0207659_100104955 | 363 |
| 212 | 3300025940 | Ga0207691_10056300 | Ga0207691_100563004 | 363 |
| 213 | 3300025945 | Ga0207679_10086940 | Ga0207679_100869404 | 363 |
| 214 | 3300026035 | Ga0207703_10026961 | Ga0207703_100269613 | 363 |
| 215 | 3300026116 | Ga0207674_10128343 | Ga0207674_101283432 | 363 |
| 216 | 3300026118 | Ga0207675_100227089 | Ga0207675_1002270892 | 363 |
| 217 | 3300028380 | Ga0268265_10072971 | Ga0268265_100729712 | 363 |
| 218 | 3300031548 | Ga0307408_100295807 | Ga0307408_1002958072 | 363 |
| 219 | 3300032002 | Ga0307416_100221212 | Ga0307416_1002212122 | 363 |
| 220 | 3300039447 | Ga0436361_0519738 | Ga0436361_0519738_4693_5847 | 363 |
| 221 | 3300045051 | Ga0451576_0336966 | Ga0451576_0336966_67_1176 | 363 |
| 222 | 3300050509 | nmdc:mga0qj67_307665_c1 | nmdc:mga0qj67_307665_c1_26_1126 | 363 |
| 223 | 3300050511 | nmdc:mga08y16_145586_c1 | nmdc:mga08y16_145586_c1_1339_2436 | 363 |
| 224 | 3300050512 | nmdc:mga0n895_370851_c1 | nmdc:mga0n895_370851_c1_306_1403 | 363 |
| 225 | 3300050515 | nmdc:mga0a205_101655_c1 | nmdc:mga0a205_101655_c1_20_1120 | 363 |
| 226 | 3300005347 | Ga0070668_100005489 | Ga0070668_1000054896 | 364 |
| 227 | 3300009093 | Ga0105240_10104412 | Ga0105240_101044122 | 364 |
| 228 | 3300009553 | Ga0105249_10000044 | Ga0105249_1000004442 | 364 |
| 229 | 3300013306 | Ga0163162_10000025 | Ga0163162_10000025115 | 364 |
| 230 | 3300013308 | Ga0157375_10033482 | Ga0157375_100334824 | 364 |
| 231 | 3300021384 | Ga0213876_10000006 | Ga0213876_10000006496 | 364 |
| 232 | 3300021384 | Ga0213876_10000196 | Ga0213876_1000019617 | 364 |
| 233 | 3300025913 | Ga0207695_10460260 | Ga0207695_104602601 | 364 |
| 234 | 3300025961 | Ga0207712_10000039 | Ga0207712_10000039130 | 364 |
| 235 | 3300025972 | Ga0207668_10011390 | Ga0207668_100113902 | 364 |
| 236 | 3300039437 | Ga0436365_0695157 | Ga0436365_0695157_62968_64068 | 364 |
| 237 | 3300039437 | Ga0436365_1753418 | Ga0436365_1753418_59495_60595 | 364 |
| 238 | 3300000549 | LJQas_1001072 | LJQas_10010723 | 365 |
| 239 | 3300005434 | Ga0070709_10000012 | Ga0070709_1000001265 | 365 |
| 240 | 3300005444 | Ga0070694_100071483 | Ga0070694_1000714831 | 365 |
| 241 | 3300005467 | Ga0070706_100134791 | Ga0070706_1001347911 | 365 |
| 242 | 3300005536 | Ga0070697_100081167 | Ga0070697_1000811672 | 365 |
| 243 | 3300005548 | Ga0070665_100141697 | Ga0070665_1001416972 | 365 |
| 244 | 3300005617 | Ga0068859_100393661 | Ga0068859_1003936612 | 365 |
| 245 | 3300006163 | Ga0070715_10000004 | Ga0070715_10000004150 | 365 |
| 246 | 3300006173 | Ga0070716_100050718 | Ga0070716_1000507182 | 365 |
| 247 | 3300006931 | Ga0097620_100393675 | Ga0097620_1003936752 | 365 |
| 248 | 3300017792 | Ga0163161_10000627 | Ga0163161_1000062729 | 365 |
| 249 | 3300025905 | Ga0207685_10000004 | Ga0207685_10000004105 | 365 |
| 250 | 3300025906 | Ga0207699_10000007 | Ga0207699_10000007364 | 365 |
| 251 | 3300031731 | Ga0307405_10034888 | Ga0307405_100348883 | 365 |
| 252 | 3300039437 | Ga0436365_0676892 | Ga0436365_0676892_167_1279 | 365 |
| 253 | 3300046519 | Ga0495632_0056821 | Ga0495632_0056821_188_1300 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8sye-assembly1.cif.gz_A | x-ray crystal structure of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27, d98n variant in the presence of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid and udp at ph 6 | 0.941 | 1 | 363 |
| 8sye-assembly1.cif.gz_A | x-ray crystal structure of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27, d98n variant in the presence of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid and udp at ph 6 | 0.936 | 1 | 363 |
| 8sy0-assembly1.cif.gz_A | x-ray crystal structure of udp- 2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27 in complex with its product udp-2,3-diacetamido-2,3-dideoxy-d-mannuronic acid at ph 9 | 0.9351 | 1 | 361 |
| 8sxy-assembly1.cif.gz_B | x-ray crystal structure of udp- 2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27 in complex with its product udp-2,3-diacetamido-2,3-dideoxy-d-mannuronic acid at ph 5 | 0.9308 | 2 | 365 |
| 4nes-assembly1.cif.gz_A-2 | crystal structure of methanocaldococcus jannaschii udp-glcnac 2-epimerase in complex with udp-glcnac and udp | 0.93 | 2 | 363 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58899_2_184_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9731 | 3 | 187 | 3.40.50.2000 |
| af_Q58899_2_184_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9627 | 3 | 187 | 3.40.50.2000 |
| af_Q58899_3_336_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9464 | 2 | 333 | 3.40.50.2000 |
| af_P27828_2_186_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9421 | 4 | 187 | 3.40.50.2000 |
| af_Q58899_3_336_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9381 | 2 | 333 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A176RTE3-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14) | 1.005 | 85 | 159 |
GO:0008761
|
| AF-A0A2V8SGL9-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase (Non-hydrolyzing) | 0.9896 | 1 | 187 |
GO:0008761
|
| AF-A0A812AH51-F1-model_v4 | deleted | 0.9892 | 97 | 192 |
|
| AF-A0A7W1L2B4-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase | 0.9854 | 2 | 158 |
GO:0008761
|
| AF-A0A2V8SGL9-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase (Non-hydrolyzing) | 0.9843 | 1 | 187 |
GO:0008761
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar