F363605

General Info

Members Datasets Scaffolds Average Seq Length
252 170 504 142

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_114472_c1|nmdc:mga0yw44_114472_c1_1086_1586
Length 166
Sequence VGERDRVDSVGPQHLFPADDPRRPDVSDWNVKIIEEFRANAGAVGGQFAGAPLLLLTTTGAKSGEPRVSPMMYLDAADAGEEGASDRVFVFASKAGMPTNPAWYHNLKANPKVTVERGADTYEATATEVTGADRDRVYAEQARRYPGFAEYQEKTDRVIPVIALDR

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
170 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 5.16
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 4.76
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_114472_c1 3300050492 Bacteria 1731
2 Ga0006777J48905_1027126 3300003308 Bacteria 861
3 Ga0058861_11282085 3300004800 Bacteria 909
4 Ga0070658_10002064 3300005327 Bacteria 16844
5 Ga0070658_10090301 3300005327 Bacteria 2524
6 Ga0070690_100592433 3300005330 Bacteria 840
7 Ga0068869_100799444 3300005334 Bacteria 810
8 Ga0070680_100089176 3300005336 Bacteria 2552
9 Ga0070660_100151101 3300005339 Bacteria 1867
10 Ga0070668_100389234 3300005347 Bacteria 1188
11 Ga0070668_100554461 3300005347 Bacteria 1001
12 Ga0070668_101389150 3300005347 Bacteria 640
13 Ga0070671_100235756 3300005355 Bacteria 1553
14 Ga0070674_100365904 3300005356 Bacteria 1169
15 Ga0070667_100012725 3300005367 Bacteria 6956
16 Ga0070714_100122961 3300005435 Bacteria 2310
17 Ga0070714_100606271 3300005435 Bacteria 1052
18 Ga0070705_100140934 3300005440 Bacteria 1586
19 Ga0070662_100131819 3300005457 Bacteria 1928
20 Ga0070681_11083158 3300005458 Bacteria 722
21 Ga0070706_100009235 3300005467 Bacteria 9185
22 Ga0070706_100084840 3300005467 Bacteria 2934
23 Ga0070706_100294820 3300005467 Bacteria 1513
24 Ga0070706_101162923 3300005467 Bacteria 709
25 Ga0070707_100195626 3300005468 Bacteria 1971
26 Ga0070698_100025528 3300005471 Bacteria 6158
27 Ga0070698_100170266 3300005471 Bacteria 2119
28 Ga0070698_100365212 3300005471 Bacteria 1375
29 Ga0070698_101067089 3300005471 Unclassified 756
30 Ga0070699_100002019 3300005518 Bacteria 18346
31 Ga0070699_100292070 3300005518 Bacteria 1462
32 Ga0070699_100809481 3300005518 Bacteria 857
33 Ga0070679_100033447 3300005530 Bacteria 5091
34 Ga0070697_100874583 3300005536 Bacteria 797
35 Ga0070697_102108556 3300005536 Bacteria 505
36 Ga0070695_100300687 3300005545 Bacteria 1186
37 Ga0070704_100147436 3300005549 Bacteria 1846
38 Ga0068855_100021961 3300005563 Bacteria 7652
39 Ga0068855_100029957 3300005563 Bacteria 6508
40 Ga0068855_100407243 3300005563 Bacteria 1489
41 Ga0068856_100109750 3300005614 Bacteria 2755
42 Ga0068856_100386972 3300005614 Bacteria 1418
43 Ga0068860_100060426 3300005843 Bacteria 3601
44 Ga0068862_100080157 3300005844 Bacteria 2831
45 Ga0081540_1003568 3300005983 Bacteria 12230
46 Ga0081539_10086578 3300005985 Bacteria 1630
47 Ga0075365_10085774 3300006038 Bacteria 2139
48 Ga0075365_10159005 3300006038 Bacteria 1573
49 Ga0075367_10092943 3300006178 Bacteria 1837
50 Ga0075428_100147449 3300006844 Bacteria 2557
51 Ga0075428_100218323 3300006844 Bacteria 2059
52 Ga0075428_100496743 3300006844 Bacteria 1305
53 Ga0075428_100621118 3300006844 Bacteria 1154
54 Ga0075430_100208214 3300006846 Unclassified 1623
55 Ga0075431_100160054 3300006847 Bacteria 2315
56 Ga0075433_10178338 3300006852 Bacteria 1890
57 Ga0075433_10902803 3300006852 Bacteria 771
58 Ga0075434_100065339 3300006871 Bacteria 3623
59 Ga0075434_100073606 3300006871 Bacteria 3409
60 Ga0068865_100128255 3300006881 Bacteria 1897
61 Ga0075436_100004520 3300006914 Bacteria 9543
62 Ga0075435_100162031 3300007076 Bacteria 1884
63 Ga0105240_10046857 3300009093 Bacteria 5474
64 Ga0105240_10571006 3300009093 Bacteria 1249
65 Ga0111539_10189680 3300009094 Bacteria 2399
66 Ga0111539_11139767 3300009094 Unclassified 906
67 Ga0111539_11753562 3300009094 Bacteria 720
68 Ga0105245_10001950 3300009098 Bacteria 18712
69 Ga0114129_10215087 3300009147 Bacteria 2596
70 Ga0114129_11152238 3300009147 Bacteria 968
71 Ga0114129_11222247 3300009147 Bacteria 935
72 Ga0114129_11514672 3300009147 Bacteria 824
73 Ga0105243_11775229 3300009148 Bacteria 647
74 Ga0105242_10050046 3300009176 Bacteria 3401
75 Ga0105242_10203930 3300009176 Bacteria 1758
76 Ga0105242_10906131 3300009176 Bacteria 882
77 Ga0105237_10031120 3300009545 Bacteria 5412
78 Ga0105237_10203028 3300009545 Bacteria 1983
79 Ga0105238_10185666 3300009551 Bacteria 2055
80 Ga0105238_10591402 3300009551 Bacteria 1117
81 Ga0105249_11020596 3300009553 Bacteria 896
82 Ga0099796_10064109 3300010159 Bacteria 1310
83 Ga0099796_10303548 3300010159 Bacteria 677
84 Ga0105239_10228012 3300010375 Bacteria 2090
85 Ga0105239_10347609 3300010375 Bacteria 1674
86 Ga0105239_10398308 3300010375 Bacteria 1558
87 Ga0157370_10010146 3300013104 Bacteria 9948
88 Ga0157369_10008011 3300013105 Bacteria 12134
89 Ga0157369_10203307 3300013105 Bacteria 2078
90 Ga0157378_10761976 3300013297 Bacteria 991
91 Ga0157378_10805860 3300013297 Bacteria 965
92 Ga0163162_10589512 3300013306 Bacteria 1238
93 Ga0163163_10190322 3300014325 Bacteria 2100
94 Ga0157376_13005836 3300014969 Bacteria 511
95 Ga0163161_11396777 3300017792 Bacteria 611
96 Ga0206356_10434614 3300020070 Bacteria 951
97 Ga0206356_11619997 3300020070 Bacteria 966
98 Ga0206351_10032293 3300020077 Bacteria 1178
99 Ga0206350_10297795 3300020080 Bacteria 1374
100 Ga0206354_10915903 3300020081 Bacteria 937
101 Ga0206353_10925269 3300020082 Bacteria 1518
102 Ga0206353_11922679 3300020082 Bacteria 2280
103 Ga0154015_1001058 3300020610 Bacteria 1203
104 Ga0154015_1278975 3300020610 Bacteria 1131
105 Ga0224712_10006764 3300022467 Bacteria 3296
106 Ga0224712_10038161 3300022467 Bacteria 1792
107 Ga0207653_10277500 3300025885 Bacteria 646
108 Ga0207688_10190782 3300025901 Bacteria 1225
109 Ga0207647_10092007 3300025904 Bacteria 1808
110 Ga0207705_10012369 3300025909 Bacteria 6165
111 Ga0207684_10081781 3300025910 Bacteria 2749
112 Ga0207684_10221597 3300025910 Bacteria 1632
113 Ga0207654_10357410 3300025911 Bacteria 1007
114 Ga0207695_10156534 3300025913 Bacteria 2213
115 Ga0207671_10087524 3300025914 Bacteria 2342
116 Ga0207671_10797448 3300025914 Bacteria 749
117 Ga0207660_10188344 3300025917 Unclassified 1605
118 Ga0207657_10260051 3300025919 Bacteria 1381
119 Ga0207646_10099830 3300025922 Bacteria 2601
120 Ga0207694_10258563 3300025924 Bacteria 1426
121 Ga0207687_10034930 3300025927 Bacteria 3417
122 Ga0207644_10389877 3300025931 Bacteria 1137
123 Ga0207706_10160182 3300025933 Bacteria 1978
124 Ga0207686_11110266 3300025934 Unclassified 645
125 Ga0207667_10061932 3300025949 Bacteria 3913
126 Ga0207667_10071206 3300025949 Bacteria 3616
127 Ga0207667_10356975 3300025949 Bacteria 1490
128 Ga0207712_10113757 3300025961 Bacteria 2034
129 Ga0207668_10555806 3300025972 Bacteria 995
130 Ga0207668_11949274 3300025972 Bacteria 529
131 Ga0207658_10370995 3300025986 Bacteria 1251
132 Ga0207703_11089445 3300026035 Bacteria 767
133 Ga0207641_10137829 3300026088 Bacteria 2198
134 Ga0207675_102408605 3300026118 Bacteria 539
135 Ga0207428_10129492 3300027907 Bacteria 1932
136 Ga0207428_10428071 3300027907 Bacteria 967
137 Ga0207428_10436073 3300027907 Bacteria 956
138 Ga0268265_10200674 3300028380 Bacteria 1730
139 Ga0268265_10455673 3300028380 Bacteria 1196
140 Ga0268265_10926396 3300028380 Bacteria 857
141 Ga0268264_10617082 3300028381 Bacteria 1070
142 Ga0307407_11321380 3300031903 Bacteria 566
143 Ga0307507_10003906 3300033179 Bacteria 27626
144 Ga0307507_10028126 3300033179 Bacteria 6000
145 Ga0373938_0001439 3300034957 Bacteria 3810
146 Ga0373960_0042334 3300035121 Bacteria 1322
147 Ga0373961_0027823 3300035241 Bacteria 1555
148 Ga0373931_0228360 3300035691 Bacteria 1124
149 Ga0395899_0165430 3300037312 Bacteria 1561
150 Ga0395900_0010180 3300037418 Bacteria 9619
151 Ga0395900_0697089 3300037418 Bacteria 949
152 Ga0395898_0025681 3300037466 Bacteria 5933
153 Ga0395898_0205164 3300037466 Bacteria 1881
154 Ga0395901_0928416 3300038443 Bacteria 850
155 Ga0466972_0218036 3300044658 Bacteria 893
156 Ga0453683_0142646 3300044673 Bacteria 1512
157 Ga0453683_0679208 3300044673 Bacteria 674
158 Ga0466965_0068348 3300044683 Bacteria 1784
159 Ga0466966_0108127 3300044684 Bacteria 1716
160 Ga0466963_0127233 3300044694 Bacteria 1757
161 Ga0466963_0137646 3300044694 Bacteria 1690
162 Ga0466963_0266044 3300044694 Bacteria 1204
163 Ga0466963_0628475 3300044694 Bacteria 758
164 Ga0466971_0601899 3300044719 Bacteria 548
165 Ga0466957_0098949 3300044842 Bacteria 1836
166 Ga0466957_0308126 3300044842 Bacteria 1065
167 Ga0466960_0043387 3300044901 Bacteria 2139
168 Ga0466960_0299653 3300044901 Bacteria 905
169 Ga0466959_0331675 3300045049 Bacteria 1039
170 Ga0466959_1095441 3300045049 Bacteria 530
171 Ga0451576_2149458 3300045051 Bacteria 574
172 Ga0466958_0118090 3300045836 Bacteria 1659
173 Ga0466967_0026991 3300045976 Bacteria 4768
174 Ga0466967_0586688 3300045976 Bacteria 1099
175 Ga0466967_0599199 3300045976 Bacteria 1087
176 Ga0466967_1140600 3300045976 Bacteria 777
177 Ga0495617_136096 3300046452 Bacteria 786
178 Ga0495641_0240271 3300046461 Bacteria 814
179 Ga0495605_0263803 3300046474 Bacteria 735
180 Ga0495662_0100488 3300046476 Bacteria 1415
181 Ga0495596_0147249 3300046500 Bacteria 915
182 Ga0495620_0129252 3300046515 Bacteria 992
183 Ga0495631_0094795 3300046518 Bacteria 1285
184 Ga0495637_0268382 3300046520 Bacteria 611
185 Ga0495644_0205834 3300046523 Bacteria 759
186 Ga0495642_0431368 3300046528 Bacteria 582
187 Ga0495645_0648597 3300046543 Bacteria 645
188 Ga0495622_0071084 3300046557 Bacteria 1606
189 Ga0495667_0392811 3300046559 Bacteria 874
190 Ga0495668_0663418 3300046616 Bacteria 577
191 Ga0495611_0102182 3300046648 Bacteria 1332
192 Ga0495600_0193293 3300046809 Bacteria 1308
193 Ga0495604_0660871 3300047317 Bacteria 666
194 Ga0495676_1078249 3300047321 Bacteria 511
195 Ga0495683_0000668 3300047323 Bacteria 25356
196 Ga0496102_0000721 3300048905 Bacteria 32596
197 Ga0496102_0343374 3300048905 Bacteria 1406
198 Ga0496102_0825729 3300048905 Bacteria 849
199 Ga0496104_0218564 3300048907 Bacteria 1818
200 Ga0496105_0227130 3300048908 Bacteria 1518
201 Ga0496106_1102466 3300048909 Bacteria 622
202 Ga0496112_0131500 3300048915 Bacteria 2474
203 Ga0496112_0175382 3300048915 Bacteria 2109
204 Ga0496114_0019106 3300048917 Bacteria 5553
205 Ga0496115_0025885 3300048918 Bacteria 4572
206 Ga0496115_1188710 3300048918 Viruses 574
207 Ga0496115_1216302 3300048918 Bacteria 565
208 Ga0496121_0533508 3300048924 Bacteria 738
209 Ga0496126_0000007 3300048929 Bacteria 787364
210 Ga0501032_0047086 3300049569 Bacteria 2913
211 Ga0501033_0207452 3300049570 Bacteria 1398
212 Ga0501033_0607693 3300049570 Bacteria 749
213 Ga0501034_0056649 3300049571 Bacteria 3943
214 Ga0501037_0033533 3300049573 Bacteria 3792
215 Ga0501038_0014542 3300049574 Bacteria 7172
216 Ga0501038_0525797 3300049574 Bacteria 902
217 Ga0501042_0255369 3300049578 Unclassified 1265
218 Ga0501043_0322515 3300049579 Unclassified 1177
219 Ga0501046_0057644 3300049580 Bacteria 3047
220 Ga0501047_0070398 3300049581 Bacteria 3368
221 Ga0501048_0000850 3300049582 Bacteria 22495
222 Ga0501070_0013269 3300049586 Bacteria 6947
223 Ga0501074_0609593 3300049590 Bacteria 772
224 Ga0501035_0319140 3300049822 Unclassified 1305
225 Ga0501035_0451715 3300049822 Bacteria 1063
226 Ga0501044_0042811 3300049823 Bacteria 4708
227 Ga0501044_0043784 3300049823 Bacteria 4649
228 nmdc:mga0yw44_540326_c1 3300050492 Bacteria 791
229 nmdc:mga06z11_75349_c1 3300050494 Bacteria 1796
230 nmdc:mga05p37_1121671_c1 3300050507 Unclassified 821
231 nmdc:mga05p37_1212748_c1 3300050507 Bacteria 778
232 nmdc:mga05p37_1215628_c1 3300050507 Bacteria 777
233 nmdc:mga05p37_196666_c1 3300050507 Bacteria 2445
234 nmdc:mga0qj67_332854_c1 3300050509 Bacteria 1229
235 nmdc:mga06r32_280597_c1 3300050510 Bacteria 1653
236 nmdc:mga08y16_155842_c1 3300050511 Bacteria 2374
237 nmdc:mga08y16_563545_c1 3300050511 Bacteria 1152
238 nmdc:mga0n895_448065_c1 3300050512 Bacteria 1303
239 nmdc:mga0n895_72791_c1 3300050512 Bacteria 3410
240 nmdc:mga0rr50_64540_c1 3300050513 Bacteria 2770
241 nmdc:mga0rr50_770576_c1 3300050513 Bacteria 821
242 nmdc:mga08x19_356747_c1 3300050514 Bacteria 1021
243 nmdc:mga08x19_969715_c1 3300050514 Bacteria 604
244 nmdc:mga0a205_1197086_c1 3300050515 Bacteria 607
245 nmdc:mga0a205_416657_c1 3300050515 Bacteria 1206
246 nmdc:mga0a205_49953_c1 3300050515 Bacteria 4038
247 Ga0495601_0777039 3300053077 Bacteria 609
248 Ga0495655_0254031 3300053083 Bacteria 592
249 Ga0501082_0474828 3300060353 Bacteria 1093
250 Ga0466962_0258496 3300061719 Bacteria 857
251 2738886831 2738541308 Bacteria 7020677
252 2883824511 2883821847 Bacteria 5121194
253 nmdc:mga0yw44_114472_c1
254 Ga0006777J48905_1027126
255 Ga0058861_11282085
256 Ga0070658_10002064
257 Ga0070658_10090301
258 Ga0070690_100592433
259 Ga0068869_100799444
260 Ga0070680_100089176
261 Ga0070660_100151101
262 Ga0070668_100389234
263 Ga0070668_100554461
264 Ga0070668_101389150
265 Ga0070671_100235756
266 Ga0070674_100365904
267 Ga0070667_100012725
268 Ga0070714_100122961
269 Ga0070714_100606271
270 Ga0070705_100140934
271 Ga0070662_100131819
272 Ga0070681_11083158
273 Ga0070706_100009235
274 Ga0070706_100084840
275 Ga0070706_100294820
276 Ga0070706_101162923
277 Ga0070707_100195626
278 Ga0070698_100025528
279 Ga0070698_100170266
280 Ga0070698_100365212
281 Ga0070698_101067089
282 Ga0070699_100002019
283 Ga0070699_100292070
284 Ga0070699_100809481
285 Ga0070679_100033447
286 Ga0070697_100874583
287 Ga0070697_102108556
288 Ga0070695_100300687
289 Ga0070704_100147436
290 Ga0068855_100021961
291 Ga0068855_100029957
292 Ga0068855_100407243
293 Ga0068856_100109750
294 Ga0068856_100386972
295 Ga0068860_100060426
296 Ga0068862_100080157
297 Ga0081540_1003568
298 Ga0081539_10086578
299 Ga0075365_10085774
300 Ga0075365_10159005
301 Ga0075367_10092943
302 Ga0075428_100147449
303 Ga0075428_100218323
304 Ga0075428_100496743
305 Ga0075428_100621118
306 Ga0075430_100208214
307 Ga0075431_100160054
308 Ga0075433_10178338
309 Ga0075433_10902803
310 Ga0075434_100065339
311 Ga0075434_100073606
312 Ga0068865_100128255
313 Ga0075436_100004520
314 Ga0075435_100162031
315 Ga0105240_10046857
316 Ga0105240_10571006
317 Ga0111539_10189680
318 Ga0111539_11139767
319 Ga0111539_11753562
320 Ga0105245_10001950
321 Ga0114129_10215087
322 Ga0114129_11152238
323 Ga0114129_11222247
324 Ga0114129_11514672
325 Ga0105243_11775229
326 Ga0105242_10050046
327 Ga0105242_10203930
328 Ga0105242_10906131
329 Ga0105237_10031120
330 Ga0105237_10203028
331 Ga0105238_10185666
332 Ga0105238_10591402
333 Ga0105249_11020596
334 Ga0099796_10064109
335 Ga0099796_10303548
336 Ga0105239_10228012
337 Ga0105239_10347609
338 Ga0105239_10398308
339 Ga0157370_10010146
340 Ga0157369_10008011
341 Ga0157369_10203307
342 Ga0157378_10761976
343 Ga0157378_10805860
344 Ga0163162_10589512
345 Ga0163163_10190322
346 Ga0157376_13005836
347 Ga0163161_11396777
348 Ga0206356_10434614
349 Ga0206356_11619997
350 Ga0206351_10032293
351 Ga0206350_10297795
352 Ga0206354_10915903
353 Ga0206353_10925269
354 Ga0206353_11922679
355 Ga0154015_1001058
356 Ga0154015_1278975
357 Ga0224712_10006764
358 Ga0224712_10038161
359 Ga0207653_10277500
360 Ga0207688_10190782
361 Ga0207647_10092007
362 Ga0207705_10012369
363 Ga0207684_10081781
364 Ga0207684_10221597
365 Ga0207654_10357410
366 Ga0207695_10156534
367 Ga0207671_10087524
368 Ga0207671_10797448
369 Ga0207660_10188344
370 Ga0207657_10260051
371 Ga0207646_10099830
372 Ga0207694_10258563
373 Ga0207687_10034930
374 Ga0207644_10389877
375 Ga0207706_10160182
376 Ga0207686_11110266
377 Ga0207667_10061932
378 Ga0207667_10071206
379 Ga0207667_10356975
380 Ga0207712_10113757
381 Ga0207668_10555806
382 Ga0207668_11949274
383 Ga0207658_10370995
384 Ga0207703_11089445
385 Ga0207641_10137829
386 Ga0207675_102408605
387 Ga0207428_10129492
388 Ga0207428_10428071
389 Ga0207428_10436073
390 Ga0268265_10200674
391 Ga0268265_10455673
392 Ga0268265_10926396
393 Ga0268264_10617082
394 Ga0307407_11321380
395 Ga0307507_10003906
396 Ga0307507_10028126
397 Ga0373938_0001439
398 Ga0373960_0042334
399 Ga0373961_0027823
400 Ga0373931_0228360
401 Ga0395899_0165430
402 Ga0395900_0010180
403 Ga0395900_0697089
404 Ga0395898_0025681
405 Ga0395898_0205164
406 Ga0395901_0928416
407 Ga0466972_0218036
408 Ga0453683_0142646
409 Ga0453683_0679208
410 Ga0466965_0068348
411 Ga0466966_0108127
412 Ga0466963_0127233
413 Ga0466963_0137646
414 Ga0466963_0266044
415 Ga0466963_0628475
416 Ga0466971_0601899
417 Ga0466957_0098949
418 Ga0466957_0308126
419 Ga0466960_0043387
420 Ga0466960_0299653
421 Ga0466959_0331675
422 Ga0466959_1095441
423 Ga0451576_2149458
424 Ga0466958_0118090
425 Ga0466967_0026991
426 Ga0466967_0586688
427 Ga0466967_0599199
428 Ga0466967_1140600
429 Ga0495617_136096
430 Ga0495641_0240271
431 Ga0495605_0263803
432 Ga0495662_0100488
433 Ga0495596_0147249
434 Ga0495620_0129252
435 Ga0495631_0094795
436 Ga0495637_0268382
437 Ga0495644_0205834
438 Ga0495642_0431368
439 Ga0495645_0648597
440 Ga0495622_0071084
441 Ga0495667_0392811
442 Ga0495668_0663418
443 Ga0495611_0102182
444 Ga0495600_0193293
445 Ga0495604_0660871
446 Ga0495676_1078249
447 Ga0495683_0000668
448 Ga0496102_0000721
449 Ga0496102_0343374
450 Ga0496102_0825729
451 Ga0496104_0218564
452 Ga0496105_0227130
453 Ga0496106_1102466
454 Ga0496112_0131500
455 Ga0496112_0175382
456 Ga0496114_0019106
457 Ga0496115_0025885
458 Ga0496115_1188710
459 Ga0496115_1216302
460 Ga0496121_0533508
461 Ga0496126_0000007
462 Ga0501032_0047086
463 Ga0501033_0207452
464 Ga0501033_0607693
465 Ga0501034_0056649
466 Ga0501037_0033533
467 Ga0501038_0014542
468 Ga0501038_0525797
469 Ga0501042_0255369
470 Ga0501043_0322515
471 Ga0501046_0057644
472 Ga0501047_0070398
473 Ga0501048_0000850
474 Ga0501070_0013269
475 Ga0501074_0609593
476 Ga0501035_0319140
477 Ga0501035_0451715
478 Ga0501044_0042811
479 Ga0501044_0043784
480 nmdc:mga0yw44_540326_c1
481 nmdc:mga06z11_75349_c1
482 nmdc:mga05p37_1121671_c1
483 nmdc:mga05p37_1212748_c1
484 nmdc:mga05p37_1215628_c1
485 nmdc:mga05p37_196666_c1
486 nmdc:mga0qj67_332854_c1
487 nmdc:mga06r32_280597_c1
488 nmdc:mga08y16_155842_c1
489 nmdc:mga08y16_563545_c1
490 nmdc:mga0n895_448065_c1
491 nmdc:mga0n895_72791_c1
492 nmdc:mga0rr50_64540_c1
493 nmdc:mga0rr50_770576_c1
494 nmdc:mga08x19_356747_c1
495 nmdc:mga08x19_969715_c1
496 nmdc:mga0a205_1197086_c1
497 nmdc:mga0a205_416657_c1
498 nmdc:mga0a205_49953_c1
499 Ga0495601_0777039
500 Ga0495655_0254031
501 Ga0501082_0474828
502 Ga0466962_0258496
503 2738886831
504 2883824511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

29

166

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h96-assembly2.cif.gz_B msmeg_3358 f420 reductase 0.9972 4 139
3h96-assembly2.cif.gz_B msmeg_3358 f420 reductase 0.9827 4 139
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.945 26 137
8d4w-assembly1.cif.gz_A-2 asymmetric ene-reduction of alpha,beta-unsaturated compounds using msmeg_2850 0.9222 4 139
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9203 26 137
ID Description Score Start End Superfamily
3h96B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9944 4 139 2.30.110.10
3h96B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9797 4 139 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9002 18 139 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8929 18 139 2.30.110.10
af_P9WP15_14_151_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.891 4 137 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A402CNF9-F1-model_v4 AclJ 1.005 44 139 GO:0005886
GO:0016491
GO:0070967
AF-A0A2M9FIP2-F1-model_v4 deleted 1.002 29 139
AF-T5I175-F1-model_v4 deleted 0.9973 4 139
AF-A0A558A0M7-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9949 4 139 GO:0005886
GO:0016491
GO:0070967
AF-A0A0N9MTZ1-F1-model_v4 Uncharacterized protein 0.994 1 139 GO:0005886
GO:0016491
GO:0070967

Map