F363600

General Info

Members Datasets Scaffolds Average Seq Length
252 167 250 437

Family's Representative Sequence

Representative Sequence 3300049688|Ga0501259_001863|Ga0501259_001863_945_2234
Length 411
Sequence MPDHAISSDPAVQSQLDRLAMLSPGRDVLGLERITRLLDRLGNPHRRMPPVFHVAGTNGKGSVCAYLRAAIEAAGLSAHVYTSPHLVRFNERIRIAGELIDDAELAPLLAEVLDHAGGIEPSFFEVTTAAAFLAFSRAPADACVIEVGLGGRLDATNVIDHPAVCGIAQLGLDHQAFLGDSIETIAGEKGGIAKLGAPLITLHYPEPMAERIGQAAAEVSARWIPKGGGWDVAAYQRRLHYRDAAGKLDLPLPHLPGAHQTLNAGLAIAMLRHQQAISVPASALQRLGPGPLLDRLPQGSELWLDGGHNPAAARAIADFFRGHVAADRPFHIILGLLENKDAMGVLKPFGGRTATLHAVPVPGHAHHQPAALAVLDWIRRHADRTHPPIVLIGGSLYLAGAMLAANGTPPD

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
135 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
136 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
142 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
143 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
146 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
147 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
148 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
152 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
155 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
156 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
157 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
158 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
161 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
166 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.4
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0
Rhizoplane 1.19
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10006578 3300001989 Bacteria 4379
2 JGI24735J21928_10001410 3300002067 Bacteria 8489
3 JGI24738J21930_10000504 3300002075 Bacteria 11126
4 JGI24738J21930_10001400 3300002075 Bacteria 6687
5 JGI24749J21850_1000037 3300002076 Bacteria 24773
6 JGI24751J29686_10000052 3300002459 Bacteria 65492
7 Ga0070658_10000001 3300005327 Bacteria 856789
8 Ga0070676_10010531 3300005328 Bacteria 5017
9 Ga0070690_100006235 3300005330 Bacteria 6765
10 Ga0070670_100000024 3300005331 Bacteria 189811
11 Ga0070670_100014826 3300005331 Bacteria 6684
12 Ga0068869_100000354 3300005334 Bacteria 24639
13 Ga0070666_10053750 3300005335 Bacteria 2717
14 Ga0070666_10068891 3300005335 Bacteria 2405
15 Ga0070680_100002763 3300005336 Bacteria 13033
16 Ga0068868_100000103 3300005338 Bacteria 52264
17 Ga0070660_100001016 3300005339 Bacteria 18852
18 Ga0070660_100002567 3300005339 Bacteria 12451
19 Ga0070660_100021035 3300005339 Bacteria 4804
20 Ga0070687_100071335 3300005343 Bacteria 1866
21 Ga0070661_100000028 3300005344 Bacteria 117932
22 Ga0070692_10001259 3300005345 Bacteria 9046
23 Ga0070668_100000018 3300005347 Bacteria 99142
24 Ga0070668_100005954 3300005347 Bacteria 9041
25 Ga0070669_100000047 3300005353 Bacteria 118892
26 Ga0070669_100000870 3300005353 Bacteria 21987
27 Ga0070675_100026150 3300005354 Bacteria 4682
28 Ga0070671_100000189 3300005355 Bacteria 41536
29 Ga0070671_100007352 3300005355 Bacteria 8798
30 Ga0070674_100096738 3300005356 Bacteria 2143
31 Ga0070673_100000848 3300005364 Bacteria 17123
32 Ga0070659_100000773 3300005366 Bacteria 23207
33 Ga0070659_100005552 3300005366 Bacteria 9062
34 Ga0070667_100000143 3300005367 Bacteria 90358
35 Ga0070667_100000480 3300005367 Bacteria 40910
36 Ga0070667_100012471 3300005367 Bacteria 7032
37 Ga0070662_100001097 3300005457 Bacteria 16493
38 Ga0068867_100000804 3300005459 Bacteria 21181
39 Ga0070679_100000010 3300005530 Bacteria 166632
40 Ga0068853_100002240 3300005539 Bacteria 14452
41 Ga0068853_100005934 3300005539 Bacteria 9646
42 Ga0070672_100001298 3300005543 Bacteria 15390
43 Ga0070686_100000338 3300005544 Bacteria 30239
44 Ga0068855_100009970 3300005563 Bacteria 11449
45 Ga0068857_100149070 3300005577 Bacteria 2118
46 Ga0068857_100175627 3300005577 Bacteria 1949
47 Ga0068854_100001497 3300005578 Bacteria 14144
48 Ga0068854_100031597 3300005578 Bacteria 3680
49 Ga0068854_100128042 3300005578 Bacteria 1936
50 Ga0068852_100001532 3300005616 Bacteria 15679
51 Ga0068859_100003657 3300005617 Bacteria 15671
52 Ga0068859_100008379 3300005617 Bacteria 10478
53 Ga0068859_100013955 3300005617 Bacteria 8059
54 Ga0068864_100000036 3300005618 Bacteria 189811
55 Ga0068864_100000331 3300005618 Bacteria 41699
56 Ga0068861_100016028 3300005719 Bacteria 5292
57 Ga0068861_100174674 3300005719 Bacteria 1783
58 Ga0068861_100235106 3300005719 Bacteria 1556
59 Ga0068863_100000030 3300005841 Bacteria 176023
60 Ga0068863_100001241 3300005841 Bacteria 25408
61 Ga0068863_100003516 3300005841 Bacteria 15461
62 Ga0068863_100011167 3300005841 Bacteria 8705
63 Ga0068863_100267997 3300005841 Bacteria 1652
64 Ga0068858_100001213 3300005842 Bacteria 26754
65 Ga0068860_100000181 3300005843 Bacteria 101627
66 Ga0068860_100007273 3300005843 Bacteria 11074
67 Ga0068860_100012076 3300005843 Bacteria 8505
68 Ga0068862_100000033 3300005844 Bacteria 176515
69 Ga0068862_100000347 3300005844 Bacteria 50091
70 Ga0068862_100028184 3300005844 Bacteria 4729
71 Ga0068862_100088708 3300005844 Bacteria 2691
72 Ga0075430_100056087 3300006846 Bacteria 3313
73 Ga0075434_100168178 3300006871 Bacteria 2212
74 Ga0068865_100071371 3300006881 Bacteria 2463
75 Ga0097620_100003657 3300006931 Bacteria 15671
76 Ga0097620_100008379 3300006931 Bacteria 10478
77 Ga0097620_100013955 3300006931 Bacteria 8059
78 Ga0105240_10006304 3300009093 Bacteria 17454
79 Ga0105240_10043412 3300009093 Bacteria 5721
80 Ga0105240_10060879 3300009093 Bacteria 4706
81 Ga0105245_10000407 3300009098 Bacteria 39932
82 Ga0105247_10004506 3300009101 Bacteria 8885
83 Ga0105243_10088239 3300009148 Bacteria 2548
84 Ga0105241_10039482 3300009174 Bacteria 3561
85 Ga0105248_10000091 3300009177 Bacteria 101191
86 Ga0105248_10001673 3300009177 Bacteria 24666
87 Ga0105248_10025100 3300009177 Bacteria 6626
88 Ga0105248_10045404 3300009177 Bacteria 4927
89 Ga0105248_10069199 3300009177 Bacteria 3963
90 Ga0105237_10232556 3300009545 Bacteria 1844
91 Ga0105249_10000072 3300009553 Bacteria 146435
92 Ga0105239_10000216 3300010375 Bacteria 85418
93 Ga0157326_1001103 3300012513 Bacteria 3033
94 Ga0157371_10004210 3300013102 Bacteria 12664
95 Ga0157370_10003264 3300013104 Bacteria 19115
96 Ga0157378_10007130 3300013297 Bacteria 9766
97 Ga0157372_10310492 3300013307 Bacteria 1835
98 Ga0163163_10074602 3300014325 Bacteria 3384
99 Ga0157380_10002487 3300014326 Bacteria 12422
100 Ga0206353_10359237 3300020082 Bacteria 10066
101 Ga0213873_10000020 3300021358 Bacteria 119758
102 Ga0213876_10000004 3300021384 Bacteria 943822
103 Ga0213876_10000174 3300021384 Bacteria 66934
104 Ga0213875_10000230 3300021388 Bacteria 56647
105 Ga0207697_10000104 3300025315 Bacteria 38619
106 Ga0207688_10001249 3300025901 Bacteria 13206
107 Ga0207647_10000331 3300025904 Bacteria 38861
108 Ga0207647_10001144 3300025904 Bacteria 20400
109 Ga0207645_10020378 3300025907 Bacteria 4341
110 Ga0207705_10000002 3300025909 Bacteria 2046852
111 Ga0207654_10006763 3300025911 Bacteria 5768
112 Ga0207654_10024032 3300025911 Bacteria 3271
113 Ga0207695_10001498 3300025913 Bacteria 38870
114 Ga0207695_10016690 3300025913 Bacteria 8580
115 Ga0207671_10000350 3300025914 Bacteria 66648
116 Ga0207660_10005758 3300025917 Bacteria 8039
117 Ga0207662_10066985 3300025918 Bacteria 2165
118 Ga0207657_10001901 3300025919 Bacteria 22568
119 Ga0207657_10009191 3300025919 Bacteria 9966
120 Ga0207657_10078393 3300025919 Bacteria 2782
121 Ga0207657_10087212 3300025919 Bacteria 2611
122 Ga0207649_10000079 3300025920 Bacteria 82899
123 Ga0207652_10000005 3300025921 Bacteria 343384
124 Ga0207652_10000006 3300025921 Bacteria 302991
125 Ga0207652_10000007 3300025921 Bacteria 301303
126 Ga0207652_10000009 3300025921 Bacteria 257234
127 Ga0207681_10000014 3300025923 Bacteria 353422
128 Ga0207681_10003407 3300025923 Bacteria 9946
129 Ga0207694_10000447 3300025924 Bacteria 38252
130 Ga0207650_10000015 3300025925 Bacteria 369173
131 Ga0207650_10005881 3300025925 Bacteria 8370
132 Ga0207650_10009307 3300025925 Bacteria 6714
133 Ga0207687_10006230 3300025927 Bacteria 7896
134 Ga0207644_10000096 3300025931 Bacteria 63618
135 Ga0207644_10011618 3300025931 Bacteria 5831
136 Ga0207690_10001627 3300025932 Bacteria 13962
137 Ga0207690_10005612 3300025932 Bacteria 7415
138 Ga0207690_10006780 3300025932 Bacteria 6790
139 Ga0207706_10000346 3300025933 Bacteria 50165
140 Ga0207704_10020119 3300025938 Bacteria 3523
141 Ga0207691_10013733 3300025940 Bacteria 7738
142 Ga0207711_10002409 3300025941 Bacteria 16703
143 Ga0207711_10003425 3300025941 Bacteria 13721
144 Ga0207711_10005514 3300025941 Bacteria 10701
145 Ga0207711_10022893 3300025941 Bacteria 5229
146 Ga0207689_10000033 3300025942 Bacteria 95815
147 Ga0207667_10010481 3300025949 Bacteria 10834
148 Ga0207667_10031348 3300025949 Bacteria 5739
149 Ga0207651_10000139 3300025960 Bacteria 31720
150 Ga0207712_10000055 3300025961 Bacteria 146438
151 Ga0207668_10000082 3300025972 Bacteria 71860
152 Ga0207640_10002003 3300025981 Bacteria 10996
153 Ga0207640_10019915 3300025981 Bacteria 3974
154 Ga0207658_10000164 3300025986 Bacteria 70677
155 Ga0207658_10009146 3300025986 Bacteria 6721
156 Ga0207658_10015408 3300025986 Bacteria 5243
157 Ga0207658_10029393 3300025986 Bacteria 3881
158 Ga0207677_10000472 3300026023 Bacteria 26482
159 Ga0207639_10003993 3300026041 Bacteria 9960
160 Ga0207639_10011292 3300026041 Bacteria 6198
161 Ga0207678_10079858 3300026067 Bacteria 2800
162 Ga0207702_10000566 3300026078 Bacteria 41185
163 Ga0207641_10000001 3300026088 Bacteria 1180841
164 Ga0207641_10000755 3300026088 Bacteria 34850
165 Ga0207641_10003976 3300026088 Bacteria 12906
166 Ga0207641_10064397 3300026088 Bacteria 3133
167 Ga0207648_10000367 3300026089 Bacteria 49592
168 Ga0207676_10000021 3300026095 Bacteria 296572
169 Ga0207676_10000439 3300026095 Bacteria 35156
170 Ga0207674_10000104 3300026116 Bacteria 96273
171 Ga0207674_10014248 3300026116 Bacteria 8786
172 Ga0207675_100002066 3300026118 Bacteria 20003
173 Ga0207675_100092142 3300026118 Bacteria 2850
174 Ga0207698_10006394 3300026142 Bacteria 7346
175 Ga0268266_10001840 3300028379 Bacteria 23953
176 Ga0268266_10006012 3300028379 Bacteria 11199
177 Ga0268265_10000013 3300028380 Bacteria 341536
178 Ga0268265_10000295 3300028380 Bacteria 56143
179 Ga0268265_10005767 3300028380 Bacteria 8458
180 Ga0268265_10007204 3300028380 Bacteria 7516
181 Ga0268265_10031792 3300028380 Bacteria 3815
182 Ga0268264_10000144 3300028381 Bacteria 168841
183 Ga0268264_10004323 3300028381 Bacteria 12124
184 Ga0268264_10005538 3300028381 Bacteria 10705
185 Ga0307416_100102146 3300032002 Bacteria 2499
186 Ga0395900_0009483 3300037418 Bacteria 9978
187 Ga0395905_0001393 3300037471 Bacteria 29331
188 Ga0436364_1120654 3300037853 Bacteria 86811
189 Ga0436365_0842166 3300039437 Bacteria 1592
190 Ga0436365_0970858 3300039437 Bacteria 175279
191 Ga0436365_1205090 3300039437 Bacteria 128002
192 Ga0436365_1329259 3300039437 Bacteria 15523
193 Ga0436362_0806901 3300039453 Bacteria 55904
194 Ga0495638_0000494 3300046460 Bacteria 46930
195 Ga0495654_0038665 3300046530 Bacteria 2385
196 Ga0495625_0031828 3300046660 Bacteria 3919
197 Ga0495625_0119013 3300046660 Bacteria 1799
198 Ga0495670_0000009 3300046691 Bacteria 210956
199 Ga0495686_0000120 3300047472 Bacteria 164638
200 Ga0495686_0000254 3300047472 Bacteria 95907
201 Ga0495686_0003485 3300047472 Bacteria 13612
202 Ga0495686_0011426 3300047472 Bacteria 6256
203 Ga0496102_0000043 3300048905 Bacteria 189201
204 Ga0496103_0000086 3300048906 Bacteria 104765
205 Ga0496107_0061095 3300048910 Bacteria 2728
206 Ga0496116_0001293 3300048919 Bacteria 28728
207 Ga0496117_0000104 3300048920 Bacteria 189201
208 Ga0496118_0000080 3300048921 Bacteria 189201
209 Ga0496119_0062275 3300048922 Bacteria 2224
210 Ga0496120_0045438 3300048923 Bacteria 2544
211 Ga0496121_0002551 3300048924 Bacteria 27607
212 Ga0496121_0012202 3300048924 Bacteria 9417
213 Ga0496124_0000093 3300048927 Bacteria 189201
214 Ga0496126_0023476 3300048929 Bacteria 5976
215 Ga0501290_002605 3300049513 Bacteria 2318
216 Ga0501294_000273 3300049517 Bacteria 6347
217 Ga0501300_000324 3300049523 Bacteria 7228
218 Ga0501070_0137742 3300049586 Bacteria 2015
219 Ga0501222_002490 3300049662 Bacteria 2548
220 Ga0501223_003121 3300049663 Bacteria 3621
221 Ga0501227_005814 3300049665 Bacteria 2644
222 Ga0501257_002501 3300049686 Bacteria 3881
223 Ga0501259_001863 3300049688 Bacteria 3492
224 Ga0501261_000189 3300049690 Bacteria 8777
225 Ga0501225_0002102 3300049705 Bacteria 6188
226 Ga0501279_000013 3300049775 Bacteria 78551
227 Ga0501280_000627 3300049776 Bacteria 8062
228 Ga0501281_00090 3300049777 Bacteria 10674
229 Ga0501282_000697 3300049778 Bacteria 3853
230 nmdc:mga0qj67_51662_c1 3300050509 Bacteria 3251
231 nmdc:mga0n895_159103_c1 3300050512 Bacteria 2290
232 Ga0500643_000260 3300053087 Bacteria 47191
233 Ga0500643_007587 3300053087 Bacteria 4351
234 Ga0500643_012090 3300053087 Bacteria 3109
235 Ga0500646_0010456 3300053090 Bacteria 2381
236 Ga0500651_0003114 3300053093 Bacteria 8986
237 Ga0500592_000042 3300053116 Bacteria 39014
238 Ga0500618_014485 3300053125 Bacteria 2012
239 Ga0500642_0015384 3300053130 Bacteria 2875
240 Ga0500655_000135 3300053133 Bacteria 18478
241 Ga0500658_0000891 3300053134 Bacteria 12241
242 Ga0500577_0010874 3300053142 Bacteria 2696
243 Ga0500590_001473 3300053148 Bacteria 9734
244 Ga0500604_0000003 3300053151 Bacteria 148800
245 Ga0500616_0000087 3300053153 Bacteria 192225
246 Ga0500622_0029879 3300053156 Bacteria 2863
247 Ga0500624_000088 3300053157 Bacteria 47211
248 Ga0500636_0004858 3300053177 Bacteria 7624
249 Ga0500570_033490 3300053724 Bacteria 2757
250 Ga0500645_013302 3300053730 Bacteria 2644

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0062275 Ga0496119_0062275_1059_2198 379
2 3300049688 Ga0501259_001863 Ga0501259_001863_945_2234 411
3 3300047472 Ga0495686_0011426 Ga0495686_0011426_4288_5613 413
4 3300005335 Ga0070666_10053750 Ga0070666_100537502 418
5 3300005367 Ga0070667_100000480 Ga0070667_10000048037 418
6 3300005719 Ga0068861_100016028 Ga0068861_1000160285 418
7 3300005844 Ga0068862_100000033 Ga0068862_10000003338 418
8 3300014326 Ga0157380_10002487 Ga0157380_100024874 418
9 3300025986 Ga0207658_10009146 Ga0207658_100091463 418
10 3300026118 Ga0207675_100002066 Ga0207675_1000020665 418
11 3300028380 Ga0268265_10000013 Ga0268265_10000013207 418
12 3300049513 Ga0501290_002605 Ga0501290_002605_533_1861 420
13 3300049517 Ga0501294_000273 Ga0501294_000273_3106_4434 420
14 3300049662 Ga0501222_002490 Ga0501222_002490_1077_2405 420
15 3300049663 Ga0501223_003121 Ga0501223_003121_1683_3011 420
16 3300049776 Ga0501280_000627 Ga0501280_000627_4115_5443 420
17 3300049778 Ga0501282_000697 Ga0501282_000697_1993_3321 420
18 3300005344 Ga0070661_100000028 Ga0070661_10000002845 423
19 3300025920 Ga0207649_10000079 Ga0207649_1000007963 423
20 3300049523 Ga0501300_000324 Ga0501300_000324_4959_6287 424
21 3300049665 Ga0501227_005814 Ga0501227_005814_861_2189 424
22 3300049690 Ga0501261_000189 Ga0501261_000189_2459_3787 424
23 3300049705 Ga0501225_0002102 Ga0501225_0002102_4282_5610 424
24 3300049775 Ga0501279_000013 Ga0501279_000013_56448_57776 424
25 3300049777 Ga0501281_00090 Ga0501281_00090_3156_4484 424
26 3300005539 Ga0068853_100002240 Ga0068853_1000022407 426
27 3300026041 Ga0207639_10003993 Ga0207639_100039934 426
28 3300005339 Ga0070660_100002567 Ga0070660_1000025672 435
29 3300012513 Ga0157326_1001103 Ga0157326_10011033 435
30 3300025919 Ga0207657_10078393 Ga0207657_100783932 435
31 3300002075 JGI24738J21930_10000504 JGI24738J21930_100005049 436
32 3300005328 Ga0070676_10010531 Ga0070676_100105315 436
33 3300005330 Ga0070690_100006235 Ga0070690_1000062352 436
34 3300005331 Ga0070670_100014826 Ga0070670_1000148262 436
35 3300005334 Ga0068869_100000354 Ga0068869_10000035413 436
36 3300005338 Ga0068868_100000103 Ga0068868_10000010313 436
37 3300005339 Ga0070660_100001016 Ga0070660_1000010168 436
38 3300005343 Ga0070687_100071335 Ga0070687_1000713352 436
39 3300005347 Ga0070668_100005954 Ga0070668_1000059546 436
40 3300005353 Ga0070669_100000870 Ga0070669_1000008708 436
41 3300005354 Ga0070675_100026150 Ga0070675_1000261503 436
42 3300005355 Ga0070671_100007352 Ga0070671_1000073528 436
43 3300005356 Ga0070674_100096738 Ga0070674_1000967381 436
44 3300005364 Ga0070673_100000848 Ga0070673_10000084812 436
45 3300005366 Ga0070659_100000773 Ga0070659_10000077315 436
46 3300005367 Ga0070667_100012471 Ga0070667_1000124712 436
47 3300005457 Ga0070662_100001097 Ga0070662_1000010978 436
48 3300005459 Ga0068867_100000804 Ga0068867_1000008048 436
49 3300005539 Ga0068853_100005934 Ga0068853_1000059348 436
50 3300005543 Ga0070672_100001298 Ga0070672_10000129817 436
51 3300005563 Ga0068855_100009970 Ga0068855_1000099708 436
52 3300005578 Ga0068854_100001497 Ga0068854_10000149712 436
53 3300005616 Ga0068852_100001532 Ga0068852_1000015327 436
54 3300005617 Ga0068859_100003657 Ga0068859_10000365716 436
55 3300005618 Ga0068864_100000331 Ga0068864_10000033128 436
56 3300005719 Ga0068861_100174674 Ga0068861_1001746742 436
57 3300005719 Ga0068861_100235106 Ga0068861_1002351061 436
58 3300005841 Ga0068863_100011167 Ga0068863_1000111678 436
59 3300005841 Ga0068863_100267997 Ga0068863_1002679972 436
60 3300005842 Ga0068858_100001213 Ga0068858_10000121313 436
61 3300005843 Ga0068860_100012076 Ga0068860_1000120762 436
62 3300005844 Ga0068862_100028184 Ga0068862_1000281843 436
63 3300006881 Ga0068865_100071371 Ga0068865_1000713713 436
64 3300006931 Ga0097620_100003657 Ga0097620_10000365716 436
65 3300009098 Ga0105245_10000407 Ga0105245_1000040733 436
66 3300009148 Ga0105243_10088239 Ga0105243_100882392 436
67 3300009174 Ga0105241_10039482 Ga0105241_100394822 436
68 3300009177 Ga0105248_10001673 Ga0105248_1000167317 436
69 3300009177 Ga0105248_10025100 Ga0105248_100251005 436
70 3300013102 Ga0157371_10004210 Ga0157371_100042109 436
71 3300013297 Ga0157378_10007130 Ga0157378_100071308 436
72 3300013307 Ga0157372_10310492 Ga0157372_103104922 436
73 3300025315 Ga0207697_10000104 Ga0207697_1000010421 436
74 3300025901 Ga0207688_10001249 Ga0207688_1000124910 436
75 3300025904 Ga0207647_10001144 Ga0207647_100011449 436
76 3300025907 Ga0207645_10020378 Ga0207645_100203782 436
77 3300025911 Ga0207654_10024032 Ga0207654_100240322 436
78 3300025918 Ga0207662_10066985 Ga0207662_100669852 436
79 3300025919 Ga0207657_10001901 Ga0207657_100019019 436
80 3300025923 Ga0207681_10003407 Ga0207681_100034077 436
81 3300025925 Ga0207650_10005881 Ga0207650_100058813 436
82 3300025925 Ga0207650_10009307 Ga0207650_100093072 436
83 3300025927 Ga0207687_10006230 Ga0207687_100062307 436
84 3300025931 Ga0207644_10011618 Ga0207644_100116181 436
85 3300025932 Ga0207690_10006780 Ga0207690_100067802 436
86 3300025933 Ga0207706_10000346 Ga0207706_1000034632 436
87 3300025938 Ga0207704_10020119 Ga0207704_100201195 436
88 3300025940 Ga0207691_10013733 Ga0207691_100137336 436
89 3300025941 Ga0207711_10003425 Ga0207711_1000342515 436
90 3300025941 Ga0207711_10005514 Ga0207711_1000551412 436
91 3300025942 Ga0207689_10000033 Ga0207689_1000003389 436
92 3300025949 Ga0207667_10010481 Ga0207667_1001048112 436
93 3300025960 Ga0207651_10000139 Ga0207651_1000013930 436
94 3300025981 Ga0207640_10002003 Ga0207640_100020038 436
95 3300025986 Ga0207658_10015408 Ga0207658_100154086 436
96 3300025986 Ga0207658_10029393 Ga0207658_100293935 436
97 3300026023 Ga0207677_10000472 Ga0207677_1000047227 436
98 3300026041 Ga0207639_10011292 Ga0207639_100112927 436
99 3300026088 Ga0207641_10064397 Ga0207641_100643973 436
100 3300026089 Ga0207648_10000367 Ga0207648_1000036745 436
101 3300026095 Ga0207676_10000439 Ga0207676_100004399 436
102 3300026116 Ga0207674_10000104 Ga0207674_1000010464 436
103 3300026118 Ga0207675_100092142 Ga0207675_1000921422 436
104 3300026142 Ga0207698_10006394 Ga0207698_100063948 436
105 3300028379 Ga0268266_10001840 Ga0268266_1000184017 436
106 3300028380 Ga0268265_10005767 Ga0268265_100057672 436
107 3300028380 Ga0268265_10007204 Ga0268265_100072049 436
108 3300028381 Ga0268264_10004323 Ga0268264_100043232 436
109 3300037418 Ga0395900_0009483 Ga0395900_0009483_8105_9415 436
110 3300037471 Ga0395905_0001393 Ga0395905_0001393_13944_15254 436
111 3300048910 Ga0496107_0061095 Ga0496107_0061095_546_1856 436
112 3300046530 Ga0495654_0038665 Ga0495654_0038665_528_1856 437
113 3300047472 Ga0495686_0000120 Ga0495686_0000120_137096_138409 437
114 3300053087 Ga0500643_000260 Ga0500643_000260_4164_5492 437
115 3300053087 Ga0500643_012090 Ga0500643_012090_1274_2587 437
116 3300053116 Ga0500592_000042 Ga0500592_000042_8369_9697 437
117 3300053125 Ga0500618_014485 Ga0500618_014485_145_1458 437
118 3300053157 Ga0500624_000088 Ga0500624_000088_10506_11819 437
119 3300053177 Ga0500636_0004858 Ga0500636_0004858_2631_3944 437
120 iso_pu_bacteria 2643221605 2644040848 437
121 3300046691 Ga0495670_0000009 Ga0495670_0000009_83466_84788 438
122 iso_pu_bacteria 2582581305 2585263917 438
123 3300005544 Ga0070686_100000338 Ga0070686_10000033822 439
124 3300006871 Ga0075434_100168178 Ga0075434_1001681782 439
125 3300050512 nmdc:mga0n895_159103_c1 nmdc:mga0n895_159103_c1_857_2176 439
126 3300047472 Ga0495686_0003485 Ga0495686_0003485_9878_11203 440
127 3300002076 JGI24749J21850_1000037 JGI24749J21850_10000375 441
128 3300002459 JGI24751J29686_10000052 JGI24751J29686_100000523 441
129 3300005331 Ga0070670_100000024 Ga0070670_10000002465 441
130 3300005335 Ga0070666_10068891 Ga0070666_100688912 441
131 3300005336 Ga0070680_100002763 Ga0070680_1000027639 441
132 3300005339 Ga0070660_100021035 Ga0070660_1000210352 441
133 3300005345 Ga0070692_10001259 Ga0070692_1000125910 441
134 3300005353 Ga0070669_100000047 Ga0070669_10000004770 441
135 3300005367 Ga0070667_100000143 Ga0070667_10000014336 441
136 3300005530 Ga0070679_100000010 Ga0070679_100000010112 441
137 3300005577 Ga0068857_100175627 Ga0068857_1001756272 441
138 3300005617 Ga0068859_100013955 Ga0068859_1000139557 441
139 3300005618 Ga0068864_100000036 Ga0068864_10000003666 441
140 3300005841 Ga0068863_100001241 Ga0068863_1000012417 441
141 3300005841 Ga0068863_100003516 Ga0068863_10000351610 441
142 3300005843 Ga0068860_100000181 Ga0068860_10000018147 441
143 3300005843 Ga0068860_100007273 Ga0068860_1000072737 441
144 3300005844 Ga0068862_100000347 Ga0068862_10000034738 441
145 3300006931 Ga0097620_100013955 Ga0097620_1000139557 441
146 3300009101 Ga0105247_10004506 Ga0105247_100045064 441
147 3300009177 Ga0105248_10000091 Ga0105248_1000009166 441
148 3300009177 Ga0105248_10045404 Ga0105248_100454043 441
149 3300009553 Ga0105249_10000072 Ga0105249_10000072134 441
150 3300014325 Ga0163163_10074602 Ga0163163_100746023 441
151 3300020082 Ga0206353_10359237 Ga0206353_103592375 441
152 3300021358 Ga0213873_10000020 Ga0213873_1000002088 441
153 3300021384 Ga0213876_10000004 Ga0213876_10000004484 441
154 3300021384 Ga0213876_10000174 Ga0213876_1000017453 441
155 3300021388 Ga0213875_10000230 Ga0213875_100002308 441
156 3300025917 Ga0207660_10005758 Ga0207660_100057589 441
157 3300025919 Ga0207657_10009191 Ga0207657_100091918 441
158 3300025921 Ga0207652_10000005 Ga0207652_10000005233 441
159 3300025921 Ga0207652_10000006 Ga0207652_1000000648 441
160 3300025921 Ga0207652_10000007 Ga0207652_1000000749 441
161 3300025921 Ga0207652_10000009 Ga0207652_100000099 441
162 3300025923 Ga0207681_10000014 Ga0207681_10000014152 441
163 3300025925 Ga0207650_10000015 Ga0207650_10000015167 441
164 3300025932 Ga0207690_10005612 Ga0207690_100056125 441
165 3300025941 Ga0207711_10002409 Ga0207711_1000240916 441
166 3300025941 Ga0207711_10022893 Ga0207711_100228932 441
167 3300025961 Ga0207712_10000055 Ga0207712_10000055134 441
168 3300025986 Ga0207658_10000164 Ga0207658_1000016452 441
169 3300026088 Ga0207641_10000755 Ga0207641_100007554 441
170 3300026088 Ga0207641_10003976 Ga0207641_100039766 441
171 3300026095 Ga0207676_10000021 Ga0207676_10000021235 441
172 3300026116 Ga0207674_10014248 Ga0207674_100142484 441
173 3300028380 Ga0268265_10000295 Ga0268265_1000029537 441
174 3300028381 Ga0268264_10000144 Ga0268264_10000144112 441
175 3300028381 Ga0268264_10005538 Ga0268264_100055387 441
176 3300037853 Ga0436364_1120654 Ga0436364_1120654_46134_47474 441
177 3300039437 Ga0436365_0842166 Ga0436365_0842166_77_1402 441
178 3300039437 Ga0436365_0970858 Ga0436365_0970858_155752_157077 441
179 3300039437 Ga0436365_1205090 Ga0436365_1205090_46166_47494 441
180 3300039437 Ga0436365_1329259 Ga0436365_1329259_11722_13047 441
181 3300039453 Ga0436362_0806901 Ga0436362_0806901_29221_30546 441
182 3300053087 Ga0500643_007587 Ga0500643_007587_1195_2520 441
183 3300001989 JGI24739J22299_10006578 JGI24739J22299_100065783 442
184 3300002067 JGI24735J21928_10001410 JGI24735J21928_100014106 442
185 3300002075 JGI24738J21930_10001400 JGI24738J21930_100014002 442
186 3300005327 Ga0070658_10000001 Ga0070658_10000001721 442
187 3300005347 Ga0070668_100000018 Ga0070668_10000001831 442
188 3300005355 Ga0070671_100000189 Ga0070671_10000018920 442
189 3300005366 Ga0070659_100005552 Ga0070659_1000055528 442
190 3300005577 Ga0068857_100149070 Ga0068857_1001490702 442
191 3300005578 Ga0068854_100031597 Ga0068854_1000315972 442
192 3300005578 Ga0068854_100128042 Ga0068854_1001280422 442
193 3300005617 Ga0068859_100008379 Ga0068859_1000083797 442
194 3300005841 Ga0068863_100000030 Ga0068863_100000030168 442
195 3300005844 Ga0068862_100088708 Ga0068862_1000887082 442
196 3300006846 Ga0075430_100056087 Ga0075430_1000560873 442
197 3300006931 Ga0097620_100008379 Ga0097620_1000083796 442
198 3300009093 Ga0105240_10006304 Ga0105240_1000630413 442
199 3300009093 Ga0105240_10043412 Ga0105240_100434122 442
200 3300009093 Ga0105240_10060879 Ga0105240_100608795 442
201 3300009177 Ga0105248_10069199 Ga0105248_100691992 442
202 3300009545 Ga0105237_10232556 Ga0105237_102325561 442
203 3300010375 Ga0105239_10000216 Ga0105239_1000021627 442
204 3300013104 Ga0157370_10003264 Ga0157370_100032644 442
205 3300025904 Ga0207647_10000331 Ga0207647_1000033110 442
206 3300025909 Ga0207705_10000002 Ga0207705_100000021161 442
207 3300025911 Ga0207654_10006763 Ga0207654_100067633 442
208 3300025913 Ga0207695_10001498 Ga0207695_1000149813 442
209 3300025913 Ga0207695_10016690 Ga0207695_100166908 442
210 3300025914 Ga0207671_10000350 Ga0207671_1000035027 442
211 3300025919 Ga0207657_10087212 Ga0207657_100872122 442
212 3300025924 Ga0207694_10000447 Ga0207694_1000044713 442
213 3300025931 Ga0207644_10000096 Ga0207644_1000009621 442
214 3300025932 Ga0207690_10001627 Ga0207690_100016279 442
215 3300025949 Ga0207667_10031348 Ga0207667_100313484 442
216 3300025972 Ga0207668_10000082 Ga0207668_1000008252 442
217 3300025981 Ga0207640_10019915 Ga0207640_100199151 442
218 3300026067 Ga0207678_10079858 Ga0207678_100798582 442
219 3300026078 Ga0207702_10000566 Ga0207702_1000056625 442
220 3300026088 Ga0207641_10000001 Ga0207641_10000001115 442
221 3300028379 Ga0268266_10006012 Ga0268266_100060121 442
222 3300028380 Ga0268265_10031792 Ga0268265_100317922 442
223 3300032002 Ga0307416_100102146 Ga0307416_1001021461 442
224 3300046460 Ga0495638_0000494 Ga0495638_0000494_25901_27238 442
225 3300046660 Ga0495625_0031828 Ga0495625_0031828_1687_3015 442
226 3300046660 Ga0495625_0119013 Ga0495625_0119013_323_1660 442
227 3300047472 Ga0495686_0000254 Ga0495686_0000254_18629_19957 442
228 3300048905 Ga0496102_0000043 Ga0496102_0000043_39875_41203 442
229 3300048906 Ga0496103_0000086 Ga0496103_0000086_69370_70698 442
230 3300048919 Ga0496116_0001293 Ga0496116_0001293_8640_9968 442
231 3300048920 Ga0496117_0000104 Ga0496117_0000104_39875_41203 442
232 3300048921 Ga0496118_0000080 Ga0496118_0000080_147999_149327 442
233 3300048923 Ga0496120_0045438 Ga0496120_0045438_968_2296 442
234 3300048924 Ga0496121_0002551 Ga0496121_0002551_11693_13021 442
235 3300048924 Ga0496121_0012202 Ga0496121_0012202_1723_3051 442
236 3300048927 Ga0496124_0000093 Ga0496124_0000093_147999_149327 442
237 3300048929 Ga0496126_0023476 Ga0496126_0023476_111_1439 442
238 3300049586 Ga0501070_0137742 Ga0501070_0137742_382_1710 442
239 3300049686 Ga0501257_002501 Ga0501257_002501_2520_3848 442
240 3300050509 nmdc:mga0qj67_51662_c1 nmdc:mga0qj67_51662_c1_1480_2808 442
241 3300053090 Ga0500646_0010456 Ga0500646_0010456_406_1734 442
242 3300053093 Ga0500651_0003114 Ga0500651_0003114_6571_7899 442
243 3300053130 Ga0500642_0015384 Ga0500642_0015384_284_1612 442
244 3300053133 Ga0500655_000135 Ga0500655_000135_2879_4207 442
245 3300053134 Ga0500658_0000891 Ga0500658_0000891_53_1390 442
246 3300053142 Ga0500577_0010874 Ga0500577_0010874_141_1469 442
247 3300053148 Ga0500590_001473 Ga0500590_001473_7342_8670 442
248 3300053151 Ga0500604_0000003 Ga0500604_0000003_63464_64792 442
249 3300053153 Ga0500616_0000087 Ga0500616_0000087_145723_147051 442
250 3300053156 Ga0500622_0029879 Ga0500622_0029879_140_1468 442
251 3300053724 Ga0500570_033490 Ga0500570_033490_136_1464 442
252 3300053730 Ga0500645_013302 Ga0500645_013302_327_1655 442

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w78-assembly1.cif.gz_A e.coli folc in complex with dhpp and adp 0.9223 5 435
3pyz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase complexed with amppnp and mn ion from yersinia pestis c092 0.9094 5 436
1w7k-assembly1.cif.gz_A e.coli folc in complex with adp, without folate substrate 0.9089 5 435
3qcz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound 0.9083 3 436
3n2a-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis co92 0.9059 5 436
ID Description Score Start End Superfamily
af_Q2FXR9_1_294_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.923 14 293 3.40.1190.10
af_Q9UTD0_1_272_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9175 28 294 3.40.1190.10
af_Q9VQW0_287_553_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9052 30 226 3.40.1190.10
af_Q9VYL1_84_377_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9034 11 224 3.40.1190.10
af_P08192_1_287_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8994 1 294 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A494W2E8-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9807 1 442 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046654
GO:0046872
AF-A0A552UF54-F1-model_v4 Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) 0.9801 3 438 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046656
GO:0046872
AF-A0A494W2E8-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9785 1 442 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046654
GO:0046872
AF-A0A1M3PKK0-F1-model_v4 Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) 0.9699 1 442 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046656
GO:0046872
AF-A0A435WV06-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9679 30 182 GO:0004326
GO:0005524
GO:0005737
GO:0008841

Feature Viewer

pLDDT pTM Quality
92.08 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map