F363600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 167 | 250 | 437 |
Family's Representative Sequence
| Representative Sequence | 3300049688|Ga0501259_001863|Ga0501259_001863_945_2234 |
| Length | 411 |
| Sequence | MPDHAISSDPAVQSQLDRLAMLSPGRDVLGLERITRLLDRLGNPHRRMPPVFHVAGTNGKGSVCAYLRAAIEAAGLSAHVYTSPHLVRFNERIRIAGELIDDAELAPLLAEVLDHAGGIEPSFFEVTTAAAFLAFSRAPADACVIEVGLGGRLDATNVIDHPAVCGIAQLGLDHQAFLGDSIETIAGEKGGIAKLGAPLITLHYPEPMAERIGQAAAEVSARWIPKGGGWDVAAYQRRLHYRDAAGKLDLPLPHLPGAHQTLNAGLAIAMLRHQQAISVPASALQRLGPGPLLDRLPQGSELWLDGGHNPAAARAIADFFRGHVAADRPFHIILGLLENKDAMGVLKPFGGRTATLHAVPVPGHAHHQPAALAVLDWIRRHADRTHPPIVLIGGSLYLAGAMLAANGTPPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 67 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 68 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 69 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 116 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 117 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 118 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 125 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 126 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 127 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 128 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 129 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 130 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 131 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 132 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 133 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 134 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 135 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 136 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 137 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 139 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 140 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 141 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 142 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 143 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 144 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 145 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 146 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 147 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 148 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 149 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 152 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 153 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 154 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 155 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 156 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 157 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 158 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 159 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 160 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 161 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 162 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 163 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 164 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 165 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 166 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 167 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 0.4 |
| Isolates | 0.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.54 |
| Nodule | 0 |
| Rhizoplane | 1.19 |
| Rhizosphere | 84.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10006578 | 3300001989 | Bacteria | 4379 |
| 2 | JGI24735J21928_10001410 | 3300002067 | Bacteria | 8489 |
| 3 | JGI24738J21930_10000504 | 3300002075 | Bacteria | 11126 |
| 4 | JGI24738J21930_10001400 | 3300002075 | Bacteria | 6687 |
| 5 | JGI24749J21850_1000037 | 3300002076 | Bacteria | 24773 |
| 6 | JGI24751J29686_10000052 | 3300002459 | Bacteria | 65492 |
| 7 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 8 | Ga0070676_10010531 | 3300005328 | Bacteria | 5017 |
| 9 | Ga0070690_100006235 | 3300005330 | Bacteria | 6765 |
| 10 | Ga0070670_100000024 | 3300005331 | Bacteria | 189811 |
| 11 | Ga0070670_100014826 | 3300005331 | Bacteria | 6684 |
| 12 | Ga0068869_100000354 | 3300005334 | Bacteria | 24639 |
| 13 | Ga0070666_10053750 | 3300005335 | Bacteria | 2717 |
| 14 | Ga0070666_10068891 | 3300005335 | Bacteria | 2405 |
| 15 | Ga0070680_100002763 | 3300005336 | Bacteria | 13033 |
| 16 | Ga0068868_100000103 | 3300005338 | Bacteria | 52264 |
| 17 | Ga0070660_100001016 | 3300005339 | Bacteria | 18852 |
| 18 | Ga0070660_100002567 | 3300005339 | Bacteria | 12451 |
| 19 | Ga0070660_100021035 | 3300005339 | Bacteria | 4804 |
| 20 | Ga0070687_100071335 | 3300005343 | Bacteria | 1866 |
| 21 | Ga0070661_100000028 | 3300005344 | Bacteria | 117932 |
| 22 | Ga0070692_10001259 | 3300005345 | Bacteria | 9046 |
| 23 | Ga0070668_100000018 | 3300005347 | Bacteria | 99142 |
| 24 | Ga0070668_100005954 | 3300005347 | Bacteria | 9041 |
| 25 | Ga0070669_100000047 | 3300005353 | Bacteria | 118892 |
| 26 | Ga0070669_100000870 | 3300005353 | Bacteria | 21987 |
| 27 | Ga0070675_100026150 | 3300005354 | Bacteria | 4682 |
| 28 | Ga0070671_100000189 | 3300005355 | Bacteria | 41536 |
| 29 | Ga0070671_100007352 | 3300005355 | Bacteria | 8798 |
| 30 | Ga0070674_100096738 | 3300005356 | Bacteria | 2143 |
| 31 | Ga0070673_100000848 | 3300005364 | Bacteria | 17123 |
| 32 | Ga0070659_100000773 | 3300005366 | Bacteria | 23207 |
| 33 | Ga0070659_100005552 | 3300005366 | Bacteria | 9062 |
| 34 | Ga0070667_100000143 | 3300005367 | Bacteria | 90358 |
| 35 | Ga0070667_100000480 | 3300005367 | Bacteria | 40910 |
| 36 | Ga0070667_100012471 | 3300005367 | Bacteria | 7032 |
| 37 | Ga0070662_100001097 | 3300005457 | Bacteria | 16493 |
| 38 | Ga0068867_100000804 | 3300005459 | Bacteria | 21181 |
| 39 | Ga0070679_100000010 | 3300005530 | Bacteria | 166632 |
| 40 | Ga0068853_100002240 | 3300005539 | Bacteria | 14452 |
| 41 | Ga0068853_100005934 | 3300005539 | Bacteria | 9646 |
| 42 | Ga0070672_100001298 | 3300005543 | Bacteria | 15390 |
| 43 | Ga0070686_100000338 | 3300005544 | Bacteria | 30239 |
| 44 | Ga0068855_100009970 | 3300005563 | Bacteria | 11449 |
| 45 | Ga0068857_100149070 | 3300005577 | Bacteria | 2118 |
| 46 | Ga0068857_100175627 | 3300005577 | Bacteria | 1949 |
| 47 | Ga0068854_100001497 | 3300005578 | Bacteria | 14144 |
| 48 | Ga0068854_100031597 | 3300005578 | Bacteria | 3680 |
| 49 | Ga0068854_100128042 | 3300005578 | Bacteria | 1936 |
| 50 | Ga0068852_100001532 | 3300005616 | Bacteria | 15679 |
| 51 | Ga0068859_100003657 | 3300005617 | Bacteria | 15671 |
| 52 | Ga0068859_100008379 | 3300005617 | Bacteria | 10478 |
| 53 | Ga0068859_100013955 | 3300005617 | Bacteria | 8059 |
| 54 | Ga0068864_100000036 | 3300005618 | Bacteria | 189811 |
| 55 | Ga0068864_100000331 | 3300005618 | Bacteria | 41699 |
| 56 | Ga0068861_100016028 | 3300005719 | Bacteria | 5292 |
| 57 | Ga0068861_100174674 | 3300005719 | Bacteria | 1783 |
| 58 | Ga0068861_100235106 | 3300005719 | Bacteria | 1556 |
| 59 | Ga0068863_100000030 | 3300005841 | Bacteria | 176023 |
| 60 | Ga0068863_100001241 | 3300005841 | Bacteria | 25408 |
| 61 | Ga0068863_100003516 | 3300005841 | Bacteria | 15461 |
| 62 | Ga0068863_100011167 | 3300005841 | Bacteria | 8705 |
| 63 | Ga0068863_100267997 | 3300005841 | Bacteria | 1652 |
| 64 | Ga0068858_100001213 | 3300005842 | Bacteria | 26754 |
| 65 | Ga0068860_100000181 | 3300005843 | Bacteria | 101627 |
| 66 | Ga0068860_100007273 | 3300005843 | Bacteria | 11074 |
| 67 | Ga0068860_100012076 | 3300005843 | Bacteria | 8505 |
| 68 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 69 | Ga0068862_100000347 | 3300005844 | Bacteria | 50091 |
| 70 | Ga0068862_100028184 | 3300005844 | Bacteria | 4729 |
| 71 | Ga0068862_100088708 | 3300005844 | Bacteria | 2691 |
| 72 | Ga0075430_100056087 | 3300006846 | Bacteria | 3313 |
| 73 | Ga0075434_100168178 | 3300006871 | Bacteria | 2212 |
| 74 | Ga0068865_100071371 | 3300006881 | Bacteria | 2463 |
| 75 | Ga0097620_100003657 | 3300006931 | Bacteria | 15671 |
| 76 | Ga0097620_100008379 | 3300006931 | Bacteria | 10478 |
| 77 | Ga0097620_100013955 | 3300006931 | Bacteria | 8059 |
| 78 | Ga0105240_10006304 | 3300009093 | Bacteria | 17454 |
| 79 | Ga0105240_10043412 | 3300009093 | Bacteria | 5721 |
| 80 | Ga0105240_10060879 | 3300009093 | Bacteria | 4706 |
| 81 | Ga0105245_10000407 | 3300009098 | Bacteria | 39932 |
| 82 | Ga0105247_10004506 | 3300009101 | Bacteria | 8885 |
| 83 | Ga0105243_10088239 | 3300009148 | Bacteria | 2548 |
| 84 | Ga0105241_10039482 | 3300009174 | Bacteria | 3561 |
| 85 | Ga0105248_10000091 | 3300009177 | Bacteria | 101191 |
| 86 | Ga0105248_10001673 | 3300009177 | Bacteria | 24666 |
| 87 | Ga0105248_10025100 | 3300009177 | Bacteria | 6626 |
| 88 | Ga0105248_10045404 | 3300009177 | Bacteria | 4927 |
| 89 | Ga0105248_10069199 | 3300009177 | Bacteria | 3963 |
| 90 | Ga0105237_10232556 | 3300009545 | Bacteria | 1844 |
| 91 | Ga0105249_10000072 | 3300009553 | Bacteria | 146435 |
| 92 | Ga0105239_10000216 | 3300010375 | Bacteria | 85418 |
| 93 | Ga0157326_1001103 | 3300012513 | Bacteria | 3033 |
| 94 | Ga0157371_10004210 | 3300013102 | Bacteria | 12664 |
| 95 | Ga0157370_10003264 | 3300013104 | Bacteria | 19115 |
| 96 | Ga0157378_10007130 | 3300013297 | Bacteria | 9766 |
| 97 | Ga0157372_10310492 | 3300013307 | Bacteria | 1835 |
| 98 | Ga0163163_10074602 | 3300014325 | Bacteria | 3384 |
| 99 | Ga0157380_10002487 | 3300014326 | Bacteria | 12422 |
| 100 | Ga0206353_10359237 | 3300020082 | Bacteria | 10066 |
| 101 | Ga0213873_10000020 | 3300021358 | Bacteria | 119758 |
| 102 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 103 | Ga0213876_10000174 | 3300021384 | Bacteria | 66934 |
| 104 | Ga0213875_10000230 | 3300021388 | Bacteria | 56647 |
| 105 | Ga0207697_10000104 | 3300025315 | Bacteria | 38619 |
| 106 | Ga0207688_10001249 | 3300025901 | Bacteria | 13206 |
| 107 | Ga0207647_10000331 | 3300025904 | Bacteria | 38861 |
| 108 | Ga0207647_10001144 | 3300025904 | Bacteria | 20400 |
| 109 | Ga0207645_10020378 | 3300025907 | Bacteria | 4341 |
| 110 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 111 | Ga0207654_10006763 | 3300025911 | Bacteria | 5768 |
| 112 | Ga0207654_10024032 | 3300025911 | Bacteria | 3271 |
| 113 | Ga0207695_10001498 | 3300025913 | Bacteria | 38870 |
| 114 | Ga0207695_10016690 | 3300025913 | Bacteria | 8580 |
| 115 | Ga0207671_10000350 | 3300025914 | Bacteria | 66648 |
| 116 | Ga0207660_10005758 | 3300025917 | Bacteria | 8039 |
| 117 | Ga0207662_10066985 | 3300025918 | Bacteria | 2165 |
| 118 | Ga0207657_10001901 | 3300025919 | Bacteria | 22568 |
| 119 | Ga0207657_10009191 | 3300025919 | Bacteria | 9966 |
| 120 | Ga0207657_10078393 | 3300025919 | Bacteria | 2782 |
| 121 | Ga0207657_10087212 | 3300025919 | Bacteria | 2611 |
| 122 | Ga0207649_10000079 | 3300025920 | Bacteria | 82899 |
| 123 | Ga0207652_10000005 | 3300025921 | Bacteria | 343384 |
| 124 | Ga0207652_10000006 | 3300025921 | Bacteria | 302991 |
| 125 | Ga0207652_10000007 | 3300025921 | Bacteria | 301303 |
| 126 | Ga0207652_10000009 | 3300025921 | Bacteria | 257234 |
| 127 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 128 | Ga0207681_10003407 | 3300025923 | Bacteria | 9946 |
| 129 | Ga0207694_10000447 | 3300025924 | Bacteria | 38252 |
| 130 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 131 | Ga0207650_10005881 | 3300025925 | Bacteria | 8370 |
| 132 | Ga0207650_10009307 | 3300025925 | Bacteria | 6714 |
| 133 | Ga0207687_10006230 | 3300025927 | Bacteria | 7896 |
| 134 | Ga0207644_10000096 | 3300025931 | Bacteria | 63618 |
| 135 | Ga0207644_10011618 | 3300025931 | Bacteria | 5831 |
| 136 | Ga0207690_10001627 | 3300025932 | Bacteria | 13962 |
| 137 | Ga0207690_10005612 | 3300025932 | Bacteria | 7415 |
| 138 | Ga0207690_10006780 | 3300025932 | Bacteria | 6790 |
| 139 | Ga0207706_10000346 | 3300025933 | Bacteria | 50165 |
| 140 | Ga0207704_10020119 | 3300025938 | Bacteria | 3523 |
| 141 | Ga0207691_10013733 | 3300025940 | Bacteria | 7738 |
| 142 | Ga0207711_10002409 | 3300025941 | Bacteria | 16703 |
| 143 | Ga0207711_10003425 | 3300025941 | Bacteria | 13721 |
| 144 | Ga0207711_10005514 | 3300025941 | Bacteria | 10701 |
| 145 | Ga0207711_10022893 | 3300025941 | Bacteria | 5229 |
| 146 | Ga0207689_10000033 | 3300025942 | Bacteria | 95815 |
| 147 | Ga0207667_10010481 | 3300025949 | Bacteria | 10834 |
| 148 | Ga0207667_10031348 | 3300025949 | Bacteria | 5739 |
| 149 | Ga0207651_10000139 | 3300025960 | Bacteria | 31720 |
| 150 | Ga0207712_10000055 | 3300025961 | Bacteria | 146438 |
| 151 | Ga0207668_10000082 | 3300025972 | Bacteria | 71860 |
| 152 | Ga0207640_10002003 | 3300025981 | Bacteria | 10996 |
| 153 | Ga0207640_10019915 | 3300025981 | Bacteria | 3974 |
| 154 | Ga0207658_10000164 | 3300025986 | Bacteria | 70677 |
| 155 | Ga0207658_10009146 | 3300025986 | Bacteria | 6721 |
| 156 | Ga0207658_10015408 | 3300025986 | Bacteria | 5243 |
| 157 | Ga0207658_10029393 | 3300025986 | Bacteria | 3881 |
| 158 | Ga0207677_10000472 | 3300026023 | Bacteria | 26482 |
| 159 | Ga0207639_10003993 | 3300026041 | Bacteria | 9960 |
| 160 | Ga0207639_10011292 | 3300026041 | Bacteria | 6198 |
| 161 | Ga0207678_10079858 | 3300026067 | Bacteria | 2800 |
| 162 | Ga0207702_10000566 | 3300026078 | Bacteria | 41185 |
| 163 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 164 | Ga0207641_10000755 | 3300026088 | Bacteria | 34850 |
| 165 | Ga0207641_10003976 | 3300026088 | Bacteria | 12906 |
| 166 | Ga0207641_10064397 | 3300026088 | Bacteria | 3133 |
| 167 | Ga0207648_10000367 | 3300026089 | Bacteria | 49592 |
| 168 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 169 | Ga0207676_10000439 | 3300026095 | Bacteria | 35156 |
| 170 | Ga0207674_10000104 | 3300026116 | Bacteria | 96273 |
| 171 | Ga0207674_10014248 | 3300026116 | Bacteria | 8786 |
| 172 | Ga0207675_100002066 | 3300026118 | Bacteria | 20003 |
| 173 | Ga0207675_100092142 | 3300026118 | Bacteria | 2850 |
| 174 | Ga0207698_10006394 | 3300026142 | Bacteria | 7346 |
| 175 | Ga0268266_10001840 | 3300028379 | Bacteria | 23953 |
| 176 | Ga0268266_10006012 | 3300028379 | Bacteria | 11199 |
| 177 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 178 | Ga0268265_10000295 | 3300028380 | Bacteria | 56143 |
| 179 | Ga0268265_10005767 | 3300028380 | Bacteria | 8458 |
| 180 | Ga0268265_10007204 | 3300028380 | Bacteria | 7516 |
| 181 | Ga0268265_10031792 | 3300028380 | Bacteria | 3815 |
| 182 | Ga0268264_10000144 | 3300028381 | Bacteria | 168841 |
| 183 | Ga0268264_10004323 | 3300028381 | Bacteria | 12124 |
| 184 | Ga0268264_10005538 | 3300028381 | Bacteria | 10705 |
| 185 | Ga0307416_100102146 | 3300032002 | Bacteria | 2499 |
| 186 | Ga0395900_0009483 | 3300037418 | Bacteria | 9978 |
| 187 | Ga0395905_0001393 | 3300037471 | Bacteria | 29331 |
| 188 | Ga0436364_1120654 | 3300037853 | Bacteria | 86811 |
| 189 | Ga0436365_0842166 | 3300039437 | Bacteria | 1592 |
| 190 | Ga0436365_0970858 | 3300039437 | Bacteria | 175279 |
| 191 | Ga0436365_1205090 | 3300039437 | Bacteria | 128002 |
| 192 | Ga0436365_1329259 | 3300039437 | Bacteria | 15523 |
| 193 | Ga0436362_0806901 | 3300039453 | Bacteria | 55904 |
| 194 | Ga0495638_0000494 | 3300046460 | Bacteria | 46930 |
| 195 | Ga0495654_0038665 | 3300046530 | Bacteria | 2385 |
| 196 | Ga0495625_0031828 | 3300046660 | Bacteria | 3919 |
| 197 | Ga0495625_0119013 | 3300046660 | Bacteria | 1799 |
| 198 | Ga0495670_0000009 | 3300046691 | Bacteria | 210956 |
| 199 | Ga0495686_0000120 | 3300047472 | Bacteria | 164638 |
| 200 | Ga0495686_0000254 | 3300047472 | Bacteria | 95907 |
| 201 | Ga0495686_0003485 | 3300047472 | Bacteria | 13612 |
| 202 | Ga0495686_0011426 | 3300047472 | Bacteria | 6256 |
| 203 | Ga0496102_0000043 | 3300048905 | Bacteria | 189201 |
| 204 | Ga0496103_0000086 | 3300048906 | Bacteria | 104765 |
| 205 | Ga0496107_0061095 | 3300048910 | Bacteria | 2728 |
| 206 | Ga0496116_0001293 | 3300048919 | Bacteria | 28728 |
| 207 | Ga0496117_0000104 | 3300048920 | Bacteria | 189201 |
| 208 | Ga0496118_0000080 | 3300048921 | Bacteria | 189201 |
| 209 | Ga0496119_0062275 | 3300048922 | Bacteria | 2224 |
| 210 | Ga0496120_0045438 | 3300048923 | Bacteria | 2544 |
| 211 | Ga0496121_0002551 | 3300048924 | Bacteria | 27607 |
| 212 | Ga0496121_0012202 | 3300048924 | Bacteria | 9417 |
| 213 | Ga0496124_0000093 | 3300048927 | Bacteria | 189201 |
| 214 | Ga0496126_0023476 | 3300048929 | Bacteria | 5976 |
| 215 | Ga0501290_002605 | 3300049513 | Bacteria | 2318 |
| 216 | Ga0501294_000273 | 3300049517 | Bacteria | 6347 |
| 217 | Ga0501300_000324 | 3300049523 | Bacteria | 7228 |
| 218 | Ga0501070_0137742 | 3300049586 | Bacteria | 2015 |
| 219 | Ga0501222_002490 | 3300049662 | Bacteria | 2548 |
| 220 | Ga0501223_003121 | 3300049663 | Bacteria | 3621 |
| 221 | Ga0501227_005814 | 3300049665 | Bacteria | 2644 |
| 222 | Ga0501257_002501 | 3300049686 | Bacteria | 3881 |
| 223 | Ga0501259_001863 | 3300049688 | Bacteria | 3492 |
| 224 | Ga0501261_000189 | 3300049690 | Bacteria | 8777 |
| 225 | Ga0501225_0002102 | 3300049705 | Bacteria | 6188 |
| 226 | Ga0501279_000013 | 3300049775 | Bacteria | 78551 |
| 227 | Ga0501280_000627 | 3300049776 | Bacteria | 8062 |
| 228 | Ga0501281_00090 | 3300049777 | Bacteria | 10674 |
| 229 | Ga0501282_000697 | 3300049778 | Bacteria | 3853 |
| 230 | nmdc:mga0qj67_51662_c1 | 3300050509 | Bacteria | 3251 |
| 231 | nmdc:mga0n895_159103_c1 | 3300050512 | Bacteria | 2290 |
| 232 | Ga0500643_000260 | 3300053087 | Bacteria | 47191 |
| 233 | Ga0500643_007587 | 3300053087 | Bacteria | 4351 |
| 234 | Ga0500643_012090 | 3300053087 | Bacteria | 3109 |
| 235 | Ga0500646_0010456 | 3300053090 | Bacteria | 2381 |
| 236 | Ga0500651_0003114 | 3300053093 | Bacteria | 8986 |
| 237 | Ga0500592_000042 | 3300053116 | Bacteria | 39014 |
| 238 | Ga0500618_014485 | 3300053125 | Bacteria | 2012 |
| 239 | Ga0500642_0015384 | 3300053130 | Bacteria | 2875 |
| 240 | Ga0500655_000135 | 3300053133 | Bacteria | 18478 |
| 241 | Ga0500658_0000891 | 3300053134 | Bacteria | 12241 |
| 242 | Ga0500577_0010874 | 3300053142 | Bacteria | 2696 |
| 243 | Ga0500590_001473 | 3300053148 | Bacteria | 9734 |
| 244 | Ga0500604_0000003 | 3300053151 | Bacteria | 148800 |
| 245 | Ga0500616_0000087 | 3300053153 | Bacteria | 192225 |
| 246 | Ga0500622_0029879 | 3300053156 | Bacteria | 2863 |
| 247 | Ga0500624_000088 | 3300053157 | Bacteria | 47211 |
| 248 | Ga0500636_0004858 | 3300053177 | Bacteria | 7624 |
| 249 | Ga0500570_033490 | 3300053724 | Bacteria | 2757 |
| 250 | Ga0500645_013302 | 3300053730 | Bacteria | 2644 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048922 | Ga0496119_0062275 | Ga0496119_0062275_1059_2198 | 379 |
| 2 | 3300049688 | Ga0501259_001863 | Ga0501259_001863_945_2234 | 411 |
| 3 | 3300047472 | Ga0495686_0011426 | Ga0495686_0011426_4288_5613 | 413 |
| 4 | 3300005335 | Ga0070666_10053750 | Ga0070666_100537502 | 418 |
| 5 | 3300005367 | Ga0070667_100000480 | Ga0070667_10000048037 | 418 |
| 6 | 3300005719 | Ga0068861_100016028 | Ga0068861_1000160285 | 418 |
| 7 | 3300005844 | Ga0068862_100000033 | Ga0068862_10000003338 | 418 |
| 8 | 3300014326 | Ga0157380_10002487 | Ga0157380_100024874 | 418 |
| 9 | 3300025986 | Ga0207658_10009146 | Ga0207658_100091463 | 418 |
| 10 | 3300026118 | Ga0207675_100002066 | Ga0207675_1000020665 | 418 |
| 11 | 3300028380 | Ga0268265_10000013 | Ga0268265_10000013207 | 418 |
| 12 | 3300049513 | Ga0501290_002605 | Ga0501290_002605_533_1861 | 420 |
| 13 | 3300049517 | Ga0501294_000273 | Ga0501294_000273_3106_4434 | 420 |
| 14 | 3300049662 | Ga0501222_002490 | Ga0501222_002490_1077_2405 | 420 |
| 15 | 3300049663 | Ga0501223_003121 | Ga0501223_003121_1683_3011 | 420 |
| 16 | 3300049776 | Ga0501280_000627 | Ga0501280_000627_4115_5443 | 420 |
| 17 | 3300049778 | Ga0501282_000697 | Ga0501282_000697_1993_3321 | 420 |
| 18 | 3300005344 | Ga0070661_100000028 | Ga0070661_10000002845 | 423 |
| 19 | 3300025920 | Ga0207649_10000079 | Ga0207649_1000007963 | 423 |
| 20 | 3300049523 | Ga0501300_000324 | Ga0501300_000324_4959_6287 | 424 |
| 21 | 3300049665 | Ga0501227_005814 | Ga0501227_005814_861_2189 | 424 |
| 22 | 3300049690 | Ga0501261_000189 | Ga0501261_000189_2459_3787 | 424 |
| 23 | 3300049705 | Ga0501225_0002102 | Ga0501225_0002102_4282_5610 | 424 |
| 24 | 3300049775 | Ga0501279_000013 | Ga0501279_000013_56448_57776 | 424 |
| 25 | 3300049777 | Ga0501281_00090 | Ga0501281_00090_3156_4484 | 424 |
| 26 | 3300005539 | Ga0068853_100002240 | Ga0068853_1000022407 | 426 |
| 27 | 3300026041 | Ga0207639_10003993 | Ga0207639_100039934 | 426 |
| 28 | 3300005339 | Ga0070660_100002567 | Ga0070660_1000025672 | 435 |
| 29 | 3300012513 | Ga0157326_1001103 | Ga0157326_10011033 | 435 |
| 30 | 3300025919 | Ga0207657_10078393 | Ga0207657_100783932 | 435 |
| 31 | 3300002075 | JGI24738J21930_10000504 | JGI24738J21930_100005049 | 436 |
| 32 | 3300005328 | Ga0070676_10010531 | Ga0070676_100105315 | 436 |
| 33 | 3300005330 | Ga0070690_100006235 | Ga0070690_1000062352 | 436 |
| 34 | 3300005331 | Ga0070670_100014826 | Ga0070670_1000148262 | 436 |
| 35 | 3300005334 | Ga0068869_100000354 | Ga0068869_10000035413 | 436 |
| 36 | 3300005338 | Ga0068868_100000103 | Ga0068868_10000010313 | 436 |
| 37 | 3300005339 | Ga0070660_100001016 | Ga0070660_1000010168 | 436 |
| 38 | 3300005343 | Ga0070687_100071335 | Ga0070687_1000713352 | 436 |
| 39 | 3300005347 | Ga0070668_100005954 | Ga0070668_1000059546 | 436 |
| 40 | 3300005353 | Ga0070669_100000870 | Ga0070669_1000008708 | 436 |
| 41 | 3300005354 | Ga0070675_100026150 | Ga0070675_1000261503 | 436 |
| 42 | 3300005355 | Ga0070671_100007352 | Ga0070671_1000073528 | 436 |
| 43 | 3300005356 | Ga0070674_100096738 | Ga0070674_1000967381 | 436 |
| 44 | 3300005364 | Ga0070673_100000848 | Ga0070673_10000084812 | 436 |
| 45 | 3300005366 | Ga0070659_100000773 | Ga0070659_10000077315 | 436 |
| 46 | 3300005367 | Ga0070667_100012471 | Ga0070667_1000124712 | 436 |
| 47 | 3300005457 | Ga0070662_100001097 | Ga0070662_1000010978 | 436 |
| 48 | 3300005459 | Ga0068867_100000804 | Ga0068867_1000008048 | 436 |
| 49 | 3300005539 | Ga0068853_100005934 | Ga0068853_1000059348 | 436 |
| 50 | 3300005543 | Ga0070672_100001298 | Ga0070672_10000129817 | 436 |
| 51 | 3300005563 | Ga0068855_100009970 | Ga0068855_1000099708 | 436 |
| 52 | 3300005578 | Ga0068854_100001497 | Ga0068854_10000149712 | 436 |
| 53 | 3300005616 | Ga0068852_100001532 | Ga0068852_1000015327 | 436 |
| 54 | 3300005617 | Ga0068859_100003657 | Ga0068859_10000365716 | 436 |
| 55 | 3300005618 | Ga0068864_100000331 | Ga0068864_10000033128 | 436 |
| 56 | 3300005719 | Ga0068861_100174674 | Ga0068861_1001746742 | 436 |
| 57 | 3300005719 | Ga0068861_100235106 | Ga0068861_1002351061 | 436 |
| 58 | 3300005841 | Ga0068863_100011167 | Ga0068863_1000111678 | 436 |
| 59 | 3300005841 | Ga0068863_100267997 | Ga0068863_1002679972 | 436 |
| 60 | 3300005842 | Ga0068858_100001213 | Ga0068858_10000121313 | 436 |
| 61 | 3300005843 | Ga0068860_100012076 | Ga0068860_1000120762 | 436 |
| 62 | 3300005844 | Ga0068862_100028184 | Ga0068862_1000281843 | 436 |
| 63 | 3300006881 | Ga0068865_100071371 | Ga0068865_1000713713 | 436 |
| 64 | 3300006931 | Ga0097620_100003657 | Ga0097620_10000365716 | 436 |
| 65 | 3300009098 | Ga0105245_10000407 | Ga0105245_1000040733 | 436 |
| 66 | 3300009148 | Ga0105243_10088239 | Ga0105243_100882392 | 436 |
| 67 | 3300009174 | Ga0105241_10039482 | Ga0105241_100394822 | 436 |
| 68 | 3300009177 | Ga0105248_10001673 | Ga0105248_1000167317 | 436 |
| 69 | 3300009177 | Ga0105248_10025100 | Ga0105248_100251005 | 436 |
| 70 | 3300013102 | Ga0157371_10004210 | Ga0157371_100042109 | 436 |
| 71 | 3300013297 | Ga0157378_10007130 | Ga0157378_100071308 | 436 |
| 72 | 3300013307 | Ga0157372_10310492 | Ga0157372_103104922 | 436 |
| 73 | 3300025315 | Ga0207697_10000104 | Ga0207697_1000010421 | 436 |
| 74 | 3300025901 | Ga0207688_10001249 | Ga0207688_1000124910 | 436 |
| 75 | 3300025904 | Ga0207647_10001144 | Ga0207647_100011449 | 436 |
| 76 | 3300025907 | Ga0207645_10020378 | Ga0207645_100203782 | 436 |
| 77 | 3300025911 | Ga0207654_10024032 | Ga0207654_100240322 | 436 |
| 78 | 3300025918 | Ga0207662_10066985 | Ga0207662_100669852 | 436 |
| 79 | 3300025919 | Ga0207657_10001901 | Ga0207657_100019019 | 436 |
| 80 | 3300025923 | Ga0207681_10003407 | Ga0207681_100034077 | 436 |
| 81 | 3300025925 | Ga0207650_10005881 | Ga0207650_100058813 | 436 |
| 82 | 3300025925 | Ga0207650_10009307 | Ga0207650_100093072 | 436 |
| 83 | 3300025927 | Ga0207687_10006230 | Ga0207687_100062307 | 436 |
| 84 | 3300025931 | Ga0207644_10011618 | Ga0207644_100116181 | 436 |
| 85 | 3300025932 | Ga0207690_10006780 | Ga0207690_100067802 | 436 |
| 86 | 3300025933 | Ga0207706_10000346 | Ga0207706_1000034632 | 436 |
| 87 | 3300025938 | Ga0207704_10020119 | Ga0207704_100201195 | 436 |
| 88 | 3300025940 | Ga0207691_10013733 | Ga0207691_100137336 | 436 |
| 89 | 3300025941 | Ga0207711_10003425 | Ga0207711_1000342515 | 436 |
| 90 | 3300025941 | Ga0207711_10005514 | Ga0207711_1000551412 | 436 |
| 91 | 3300025942 | Ga0207689_10000033 | Ga0207689_1000003389 | 436 |
| 92 | 3300025949 | Ga0207667_10010481 | Ga0207667_1001048112 | 436 |
| 93 | 3300025960 | Ga0207651_10000139 | Ga0207651_1000013930 | 436 |
| 94 | 3300025981 | Ga0207640_10002003 | Ga0207640_100020038 | 436 |
| 95 | 3300025986 | Ga0207658_10015408 | Ga0207658_100154086 | 436 |
| 96 | 3300025986 | Ga0207658_10029393 | Ga0207658_100293935 | 436 |
| 97 | 3300026023 | Ga0207677_10000472 | Ga0207677_1000047227 | 436 |
| 98 | 3300026041 | Ga0207639_10011292 | Ga0207639_100112927 | 436 |
| 99 | 3300026088 | Ga0207641_10064397 | Ga0207641_100643973 | 436 |
| 100 | 3300026089 | Ga0207648_10000367 | Ga0207648_1000036745 | 436 |
| 101 | 3300026095 | Ga0207676_10000439 | Ga0207676_100004399 | 436 |
| 102 | 3300026116 | Ga0207674_10000104 | Ga0207674_1000010464 | 436 |
| 103 | 3300026118 | Ga0207675_100092142 | Ga0207675_1000921422 | 436 |
| 104 | 3300026142 | Ga0207698_10006394 | Ga0207698_100063948 | 436 |
| 105 | 3300028379 | Ga0268266_10001840 | Ga0268266_1000184017 | 436 |
| 106 | 3300028380 | Ga0268265_10005767 | Ga0268265_100057672 | 436 |
| 107 | 3300028380 | Ga0268265_10007204 | Ga0268265_100072049 | 436 |
| 108 | 3300028381 | Ga0268264_10004323 | Ga0268264_100043232 | 436 |
| 109 | 3300037418 | Ga0395900_0009483 | Ga0395900_0009483_8105_9415 | 436 |
| 110 | 3300037471 | Ga0395905_0001393 | Ga0395905_0001393_13944_15254 | 436 |
| 111 | 3300048910 | Ga0496107_0061095 | Ga0496107_0061095_546_1856 | 436 |
| 112 | 3300046530 | Ga0495654_0038665 | Ga0495654_0038665_528_1856 | 437 |
| 113 | 3300047472 | Ga0495686_0000120 | Ga0495686_0000120_137096_138409 | 437 |
| 114 | 3300053087 | Ga0500643_000260 | Ga0500643_000260_4164_5492 | 437 |
| 115 | 3300053087 | Ga0500643_012090 | Ga0500643_012090_1274_2587 | 437 |
| 116 | 3300053116 | Ga0500592_000042 | Ga0500592_000042_8369_9697 | 437 |
| 117 | 3300053125 | Ga0500618_014485 | Ga0500618_014485_145_1458 | 437 |
| 118 | 3300053157 | Ga0500624_000088 | Ga0500624_000088_10506_11819 | 437 |
| 119 | 3300053177 | Ga0500636_0004858 | Ga0500636_0004858_2631_3944 | 437 |
| 120 | iso_pu_bacteria | 2643221605 | 2644040848 | 437 |
| 121 | 3300046691 | Ga0495670_0000009 | Ga0495670_0000009_83466_84788 | 438 |
| 122 | iso_pu_bacteria | 2582581305 | 2585263917 | 438 |
| 123 | 3300005544 | Ga0070686_100000338 | Ga0070686_10000033822 | 439 |
| 124 | 3300006871 | Ga0075434_100168178 | Ga0075434_1001681782 | 439 |
| 125 | 3300050512 | nmdc:mga0n895_159103_c1 | nmdc:mga0n895_159103_c1_857_2176 | 439 |
| 126 | 3300047472 | Ga0495686_0003485 | Ga0495686_0003485_9878_11203 | 440 |
| 127 | 3300002076 | JGI24749J21850_1000037 | JGI24749J21850_10000375 | 441 |
| 128 | 3300002459 | JGI24751J29686_10000052 | JGI24751J29686_100000523 | 441 |
| 129 | 3300005331 | Ga0070670_100000024 | Ga0070670_10000002465 | 441 |
| 130 | 3300005335 | Ga0070666_10068891 | Ga0070666_100688912 | 441 |
| 131 | 3300005336 | Ga0070680_100002763 | Ga0070680_1000027639 | 441 |
| 132 | 3300005339 | Ga0070660_100021035 | Ga0070660_1000210352 | 441 |
| 133 | 3300005345 | Ga0070692_10001259 | Ga0070692_1000125910 | 441 |
| 134 | 3300005353 | Ga0070669_100000047 | Ga0070669_10000004770 | 441 |
| 135 | 3300005367 | Ga0070667_100000143 | Ga0070667_10000014336 | 441 |
| 136 | 3300005530 | Ga0070679_100000010 | Ga0070679_100000010112 | 441 |
| 137 | 3300005577 | Ga0068857_100175627 | Ga0068857_1001756272 | 441 |
| 138 | 3300005617 | Ga0068859_100013955 | Ga0068859_1000139557 | 441 |
| 139 | 3300005618 | Ga0068864_100000036 | Ga0068864_10000003666 | 441 |
| 140 | 3300005841 | Ga0068863_100001241 | Ga0068863_1000012417 | 441 |
| 141 | 3300005841 | Ga0068863_100003516 | Ga0068863_10000351610 | 441 |
| 142 | 3300005843 | Ga0068860_100000181 | Ga0068860_10000018147 | 441 |
| 143 | 3300005843 | Ga0068860_100007273 | Ga0068860_1000072737 | 441 |
| 144 | 3300005844 | Ga0068862_100000347 | Ga0068862_10000034738 | 441 |
| 145 | 3300006931 | Ga0097620_100013955 | Ga0097620_1000139557 | 441 |
| 146 | 3300009101 | Ga0105247_10004506 | Ga0105247_100045064 | 441 |
| 147 | 3300009177 | Ga0105248_10000091 | Ga0105248_1000009166 | 441 |
| 148 | 3300009177 | Ga0105248_10045404 | Ga0105248_100454043 | 441 |
| 149 | 3300009553 | Ga0105249_10000072 | Ga0105249_10000072134 | 441 |
| 150 | 3300014325 | Ga0163163_10074602 | Ga0163163_100746023 | 441 |
| 151 | 3300020082 | Ga0206353_10359237 | Ga0206353_103592375 | 441 |
| 152 | 3300021358 | Ga0213873_10000020 | Ga0213873_1000002088 | 441 |
| 153 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004484 | 441 |
| 154 | 3300021384 | Ga0213876_10000174 | Ga0213876_1000017453 | 441 |
| 155 | 3300021388 | Ga0213875_10000230 | Ga0213875_100002308 | 441 |
| 156 | 3300025917 | Ga0207660_10005758 | Ga0207660_100057589 | 441 |
| 157 | 3300025919 | Ga0207657_10009191 | Ga0207657_100091918 | 441 |
| 158 | 3300025921 | Ga0207652_10000005 | Ga0207652_10000005233 | 441 |
| 159 | 3300025921 | Ga0207652_10000006 | Ga0207652_1000000648 | 441 |
| 160 | 3300025921 | Ga0207652_10000007 | Ga0207652_1000000749 | 441 |
| 161 | 3300025921 | Ga0207652_10000009 | Ga0207652_100000099 | 441 |
| 162 | 3300025923 | Ga0207681_10000014 | Ga0207681_10000014152 | 441 |
| 163 | 3300025925 | Ga0207650_10000015 | Ga0207650_10000015167 | 441 |
| 164 | 3300025932 | Ga0207690_10005612 | Ga0207690_100056125 | 441 |
| 165 | 3300025941 | Ga0207711_10002409 | Ga0207711_1000240916 | 441 |
| 166 | 3300025941 | Ga0207711_10022893 | Ga0207711_100228932 | 441 |
| 167 | 3300025961 | Ga0207712_10000055 | Ga0207712_10000055134 | 441 |
| 168 | 3300025986 | Ga0207658_10000164 | Ga0207658_1000016452 | 441 |
| 169 | 3300026088 | Ga0207641_10000755 | Ga0207641_100007554 | 441 |
| 170 | 3300026088 | Ga0207641_10003976 | Ga0207641_100039766 | 441 |
| 171 | 3300026095 | Ga0207676_10000021 | Ga0207676_10000021235 | 441 |
| 172 | 3300026116 | Ga0207674_10014248 | Ga0207674_100142484 | 441 |
| 173 | 3300028380 | Ga0268265_10000295 | Ga0268265_1000029537 | 441 |
| 174 | 3300028381 | Ga0268264_10000144 | Ga0268264_10000144112 | 441 |
| 175 | 3300028381 | Ga0268264_10005538 | Ga0268264_100055387 | 441 |
| 176 | 3300037853 | Ga0436364_1120654 | Ga0436364_1120654_46134_47474 | 441 |
| 177 | 3300039437 | Ga0436365_0842166 | Ga0436365_0842166_77_1402 | 441 |
| 178 | 3300039437 | Ga0436365_0970858 | Ga0436365_0970858_155752_157077 | 441 |
| 179 | 3300039437 | Ga0436365_1205090 | Ga0436365_1205090_46166_47494 | 441 |
| 180 | 3300039437 | Ga0436365_1329259 | Ga0436365_1329259_11722_13047 | 441 |
| 181 | 3300039453 | Ga0436362_0806901 | Ga0436362_0806901_29221_30546 | 441 |
| 182 | 3300053087 | Ga0500643_007587 | Ga0500643_007587_1195_2520 | 441 |
| 183 | 3300001989 | JGI24739J22299_10006578 | JGI24739J22299_100065783 | 442 |
| 184 | 3300002067 | JGI24735J21928_10001410 | JGI24735J21928_100014106 | 442 |
| 185 | 3300002075 | JGI24738J21930_10001400 | JGI24738J21930_100014002 | 442 |
| 186 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001721 | 442 |
| 187 | 3300005347 | Ga0070668_100000018 | Ga0070668_10000001831 | 442 |
| 188 | 3300005355 | Ga0070671_100000189 | Ga0070671_10000018920 | 442 |
| 189 | 3300005366 | Ga0070659_100005552 | Ga0070659_1000055528 | 442 |
| 190 | 3300005577 | Ga0068857_100149070 | Ga0068857_1001490702 | 442 |
| 191 | 3300005578 | Ga0068854_100031597 | Ga0068854_1000315972 | 442 |
| 192 | 3300005578 | Ga0068854_100128042 | Ga0068854_1001280422 | 442 |
| 193 | 3300005617 | Ga0068859_100008379 | Ga0068859_1000083797 | 442 |
| 194 | 3300005841 | Ga0068863_100000030 | Ga0068863_100000030168 | 442 |
| 195 | 3300005844 | Ga0068862_100088708 | Ga0068862_1000887082 | 442 |
| 196 | 3300006846 | Ga0075430_100056087 | Ga0075430_1000560873 | 442 |
| 197 | 3300006931 | Ga0097620_100008379 | Ga0097620_1000083796 | 442 |
| 198 | 3300009093 | Ga0105240_10006304 | Ga0105240_1000630413 | 442 |
| 199 | 3300009093 | Ga0105240_10043412 | Ga0105240_100434122 | 442 |
| 200 | 3300009093 | Ga0105240_10060879 | Ga0105240_100608795 | 442 |
| 201 | 3300009177 | Ga0105248_10069199 | Ga0105248_100691992 | 442 |
| 202 | 3300009545 | Ga0105237_10232556 | Ga0105237_102325561 | 442 |
| 203 | 3300010375 | Ga0105239_10000216 | Ga0105239_1000021627 | 442 |
| 204 | 3300013104 | Ga0157370_10003264 | Ga0157370_100032644 | 442 |
| 205 | 3300025904 | Ga0207647_10000331 | Ga0207647_1000033110 | 442 |
| 206 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021161 | 442 |
| 207 | 3300025911 | Ga0207654_10006763 | Ga0207654_100067633 | 442 |
| 208 | 3300025913 | Ga0207695_10001498 | Ga0207695_1000149813 | 442 |
| 209 | 3300025913 | Ga0207695_10016690 | Ga0207695_100166908 | 442 |
| 210 | 3300025914 | Ga0207671_10000350 | Ga0207671_1000035027 | 442 |
| 211 | 3300025919 | Ga0207657_10087212 | Ga0207657_100872122 | 442 |
| 212 | 3300025924 | Ga0207694_10000447 | Ga0207694_1000044713 | 442 |
| 213 | 3300025931 | Ga0207644_10000096 | Ga0207644_1000009621 | 442 |
| 214 | 3300025932 | Ga0207690_10001627 | Ga0207690_100016279 | 442 |
| 215 | 3300025949 | Ga0207667_10031348 | Ga0207667_100313484 | 442 |
| 216 | 3300025972 | Ga0207668_10000082 | Ga0207668_1000008252 | 442 |
| 217 | 3300025981 | Ga0207640_10019915 | Ga0207640_100199151 | 442 |
| 218 | 3300026067 | Ga0207678_10079858 | Ga0207678_100798582 | 442 |
| 219 | 3300026078 | Ga0207702_10000566 | Ga0207702_1000056625 | 442 |
| 220 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001115 | 442 |
| 221 | 3300028379 | Ga0268266_10006012 | Ga0268266_100060121 | 442 |
| 222 | 3300028380 | Ga0268265_10031792 | Ga0268265_100317922 | 442 |
| 223 | 3300032002 | Ga0307416_100102146 | Ga0307416_1001021461 | 442 |
| 224 | 3300046460 | Ga0495638_0000494 | Ga0495638_0000494_25901_27238 | 442 |
| 225 | 3300046660 | Ga0495625_0031828 | Ga0495625_0031828_1687_3015 | 442 |
| 226 | 3300046660 | Ga0495625_0119013 | Ga0495625_0119013_323_1660 | 442 |
| 227 | 3300047472 | Ga0495686_0000254 | Ga0495686_0000254_18629_19957 | 442 |
| 228 | 3300048905 | Ga0496102_0000043 | Ga0496102_0000043_39875_41203 | 442 |
| 229 | 3300048906 | Ga0496103_0000086 | Ga0496103_0000086_69370_70698 | 442 |
| 230 | 3300048919 | Ga0496116_0001293 | Ga0496116_0001293_8640_9968 | 442 |
| 231 | 3300048920 | Ga0496117_0000104 | Ga0496117_0000104_39875_41203 | 442 |
| 232 | 3300048921 | Ga0496118_0000080 | Ga0496118_0000080_147999_149327 | 442 |
| 233 | 3300048923 | Ga0496120_0045438 | Ga0496120_0045438_968_2296 | 442 |
| 234 | 3300048924 | Ga0496121_0002551 | Ga0496121_0002551_11693_13021 | 442 |
| 235 | 3300048924 | Ga0496121_0012202 | Ga0496121_0012202_1723_3051 | 442 |
| 236 | 3300048927 | Ga0496124_0000093 | Ga0496124_0000093_147999_149327 | 442 |
| 237 | 3300048929 | Ga0496126_0023476 | Ga0496126_0023476_111_1439 | 442 |
| 238 | 3300049586 | Ga0501070_0137742 | Ga0501070_0137742_382_1710 | 442 |
| 239 | 3300049686 | Ga0501257_002501 | Ga0501257_002501_2520_3848 | 442 |
| 240 | 3300050509 | nmdc:mga0qj67_51662_c1 | nmdc:mga0qj67_51662_c1_1480_2808 | 442 |
| 241 | 3300053090 | Ga0500646_0010456 | Ga0500646_0010456_406_1734 | 442 |
| 242 | 3300053093 | Ga0500651_0003114 | Ga0500651_0003114_6571_7899 | 442 |
| 243 | 3300053130 | Ga0500642_0015384 | Ga0500642_0015384_284_1612 | 442 |
| 244 | 3300053133 | Ga0500655_000135 | Ga0500655_000135_2879_4207 | 442 |
| 245 | 3300053134 | Ga0500658_0000891 | Ga0500658_0000891_53_1390 | 442 |
| 246 | 3300053142 | Ga0500577_0010874 | Ga0500577_0010874_141_1469 | 442 |
| 247 | 3300053148 | Ga0500590_001473 | Ga0500590_001473_7342_8670 | 442 |
| 248 | 3300053151 | Ga0500604_0000003 | Ga0500604_0000003_63464_64792 | 442 |
| 249 | 3300053153 | Ga0500616_0000087 | Ga0500616_0000087_145723_147051 | 442 |
| 250 | 3300053156 | Ga0500622_0029879 | Ga0500622_0029879_140_1468 | 442 |
| 251 | 3300053724 | Ga0500570_033490 | Ga0500570_033490_136_1464 | 442 |
| 252 | 3300053730 | Ga0500645_013302 | Ga0500645_013302_327_1655 | 442 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w78-assembly1.cif.gz_A | e.coli folc in complex with dhpp and adp | 0.9223 | 5 | 435 |
| 3pyz-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase complexed with amppnp and mn ion from yersinia pestis c092 | 0.9094 | 5 | 436 |
| 1w7k-assembly1.cif.gz_A | e.coli folc in complex with adp, without folate substrate | 0.9089 | 5 | 435 |
| 3qcz-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound | 0.9083 | 3 | 436 |
| 3n2a-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis co92 | 0.9059 | 5 | 436 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXR9_1_294_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.923 | 14 | 293 | 3.40.1190.10 |
| af_Q9UTD0_1_272_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9175 | 28 | 294 | 3.40.1190.10 |
| af_Q9VQW0_287_553_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9052 | 30 | 226 | 3.40.1190.10 |
| af_Q9VYL1_84_377_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9034 | 11 | 224 | 3.40.1190.10 |
| af_P08192_1_287_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.8994 | 1 | 294 | 3.40.1190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A494W2E8-F1-model_v4 | Bifunctional folylpolyglutamate synthase/dihydrofolate synthase | 0.9807 | 1 | 442 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046654 GO:0046872 |
| AF-A0A552UF54-F1-model_v4 | Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) | 0.9801 | 3 | 438 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046656 GO:0046872 |
| AF-A0A494W2E8-F1-model_v4 | Bifunctional folylpolyglutamate synthase/dihydrofolate synthase | 0.9785 | 1 | 442 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046654 GO:0046872 |
| AF-A0A1M3PKK0-F1-model_v4 | Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) | 0.9699 | 1 | 442 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046656 GO:0046872 |
| AF-A0A435WV06-F1-model_v4 | Bifunctional folylpolyglutamate synthase/dihydrofolate synthase | 0.9679 | 30 | 182 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar