F363453

General Info

Members Datasets Scaffolds Average Seq Length
252 138 244 396

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0036592|Ga0466968_0036592_162_1337
Length 391
Sequence MYQFEQTMRWFGPSDPVSLADIRQAGCTGVVSALHHVPNGAVWTKEEILQRKKIIEAAGLTWSVVESVPVHEEIKTQKGRYQEYIANYCESIRNLAACGIYIVTYNFMPVLDWTRTDLAYTVADGSKALRFEKAAMVAFDVYMLKRPGAEKDYTAADLAKAQQRLAAMSDDEKQLLQRNIIAGLPGSEESFTLQKFQAALDTYAGIDAKKLQQHLIYFLQQVSPVADEVGVKLVVHPDDPPYAIFGLPRVVSTAEHVQQLFDAVPNASNGLCFCTGSFGVRADNNLPAMVQQFGDRINFIHLRSTQRDAEGNFYEANHLEGDVDMYNVVKNLVKVMQKRQINIAMRPDHGHQMLDDLNKKTNPGYSAIGRLRGLAELRGLEMGIARSMASQ

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
7 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
135 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0.4
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.75
Nodule 0
Rhizoplane 0.4
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10012607 3300001991 Bacteria 1540
2 JGI25162J39368_1000012 3300002737 Bacteria 373191
3 rootH1_10005394 3300003316 Bacteria 34329
4 rootH2_10036808 3300003320 Bacteria 14194
5 rootL2_10165306 3300003322 Bacteria 2354
6 rootL2_10212956 3300003322 Bacteria 3605
7 rootH1_10035299 3300003323 Bacteria 54644
8 rootH1_10062487 3300003323 Bacteria 1961
9 rootH1_10157693 3300003323 Bacteria 4022
10 rootH1_10279903 3300003323 Bacteria 2747
11 Ga0058863_11774510 3300004799 Bacteria 1320
12 Ga0065714_10018180 3300005288 Bacteria 2246
13 Ga0070658_10000113 3300005327 Bacteria 72221
14 Ga0070658_10072052 3300005327 Bacteria 2831
15 Ga0070676_10000430 3300005328 Bacteria 19880
16 Ga0070683_100338598 3300005329 Bacteria 1432
17 Ga0070680_100001180 3300005336 Bacteria 18795
18 Ga0070682_100000632 3300005337 Bacteria 21377
19 Ga0068868_100004489 3300005338 Bacteria 9793
20 Ga0068868_100007397 3300005338 Bacteria 7823
21 Ga0070660_100015440 3300005339 Bacteria 5516
22 Ga0070691_10001554 3300005341 Bacteria 9896
23 Ga0070671_100014322 3300005355 Bacteria 6406
24 Ga0070659_100000119 3300005366 Bacteria 59333
25 Ga0070659_100001920 3300005366 Bacteria 14847
26 Ga0070659_100014255 3300005366 Bacteria 5934
27 Ga0070659_100061997 3300005366 Bacteria 2955
28 Ga0070678_100021914 3300005456 Bacteria 4223
29 Ga0070662_100000003 3300005457 Bacteria 239813
30 Ga0070681_10003572 3300005458 Bacteria 14581
31 Ga0070681_10003681 3300005458 Bacteria 14383
32 Ga0068867_100000725 3300005459 Bacteria 22054
33 Ga0070698_100001608 3300005471 Bacteria 25137
34 Ga0070679_100002597 3300005530 Bacteria 16419
35 Ga0070679_100034759 3300005530 Unclassified 4997
36 Ga0070684_100028398 3300005535 Bacteria 4733
37 Ga0068853_100002099 3300005539 Bacteria 14786
38 Ga0068853_100002412 3300005539 Bacteria 13959
39 Ga0070665_100000012 3300005548 Bacteria 508937
40 Ga0068855_100000019 3300005563 Bacteria 205963
41 Ga0068855_100002739 3300005563 Bacteria 21701
42 Ga0068855_100005291 3300005563 Bacteria 15758
43 Ga0068855_100009031 3300005563 Bacteria 12044
44 Ga0068855_100033806 3300005563 Bacteria 6100
45 Ga0068855_100042148 3300005563 Bacteria 5409
46 Ga0068855_100080114 3300005563 Bacteria 3787
47 Ga0068855_100245017 3300005563 Bacteria 2001
48 Ga0068857_100039587 3300005577 Bacteria 4176
49 Ga0068857_100063872 3300005577 Bacteria 3273
50 Ga0068854_100120797 3300005578 Bacteria 1989
51 Ga0068856_100000014 3300005614 Bacteria 163480
52 Ga0068856_100004414 3300005614 Bacteria 14023
53 Ga0068856_100242444 3300005614 Bacteria 1818
54 Ga0068852_100001570 3300005616 Bacteria 15506
55 Ga0075366_10000884 3300006195 Bacteria 14482
56 Ga0075366_10008311 3300006195 Bacteria 5765
57 Ga0097621_100000076 3300006237 Bacteria 51192
58 Ga0068871_100000070 3300006358 Bacteria 57286
59 Ga0068865_100000763 3300006881 Bacteria 18076
60 Ga0105240_10000515 3300009093 Bacteria 71183
61 Ga0105240_10001256 3300009093 Bacteria 44019
62 Ga0105240_10038058 3300009093 Bacteria 6175
63 Ga0105240_10077499 3300009093 Bacteria 4095
64 Ga0114129_10004260 3300009147 Bacteria 20220
65 Ga0105241_10000832 3300009174 Bacteria 23374
66 Ga0105241_10003983 3300009174 Bacteria 10917
67 Ga0105241_10018989 3300009174 Bacteria 5067
68 Ga0105242_10073812 3300009176 Bacteria 2837
69 Ga0105237_10000709 3300009545 Bacteria 46102
70 Ga0105237_10000779 3300009545 Bacteria 43629
71 Ga0105237_10001498 3300009545 Bacteria 30756
72 Ga0105237_10002541 3300009545 Bacteria 22572
73 Ga0105237_10003398 3300009545 Bacteria 18931
74 Ga0105237_10007988 3300009545 Bacteria 11517
75 Ga0105237_10012354 3300009545 Bacteria 8996
76 Ga0105237_10012690 3300009545 Bacteria 8866
77 Ga0105237_10024030 3300009545 Bacteria 6235
78 Ga0105238_10001588 3300009551 Bacteria 22750
79 Ga0105238_10127126 3300009551 Bacteria 2527
80 Ga0105238_10179454 3300009551 Bacteria 2094
81 Ga0105239_10000001 3300010375 Bacteria 617353
82 Ga0105239_10000010 3300010375 Bacteria 341545
83 Ga0105239_10000117 3300010375 Bacteria 112291
84 Ga0105239_10001338 3300010375 Bacteria 33217
85 Ga0105239_10001441 3300010375 Bacteria 31694
86 Ga0105239_10009681 3300010375 Bacteria 10836
87 Ga0105239_10148052 3300010375 Bacteria 2619
88 Ga0157373_10000045 3300013100 Bacteria 112207
89 Ga0157373_10001737 3300013100 Bacteria 16561
90 Ga0157371_10002765 3300013102 Bacteria 16489
91 Ga0157371_10034616 3300013102 Bacteria 3622
92 Ga0157370_10000440 3300013104 Bacteria 51946
93 Ga0157370_10023652 3300013104 Bacteria 6098
94 Ga0157370_10114730 3300013104 Bacteria 2516
95 Ga0157369_10003209 3300013105 Bacteria 19502
96 Ga0157369_10054288 3300013105 Bacteria 4328
97 Ga0157369_10127403 3300013105 Bacteria 2698
98 Ga0157374_10000147 3300013296 Bacteria 63762
99 Ga0157374_10002011 3300013296 Bacteria 17066
100 Ga0157374_10002735 3300013296 Bacteria 14808
101 Ga0157378_10057614 3300013297 Bacteria 3463
102 Ga0163162_10000044 3300013306 Bacteria 128200
103 Ga0163162_10048214 3300013306 Bacteria 4268
104 Ga0157372_10000015 3300013307 Bacteria 225365
105 Ga0157372_10001436 3300013307 Bacteria 25757
106 Ga0157372_10002432 3300013307 Bacteria 20167
107 Ga0157372_10008737 3300013307 Bacteria 10754
108 Ga0157372_10138186 3300013307 Bacteria 2807
109 Ga0157372_10173782 3300013307 Bacteria 2493
110 Ga0157375_10052879 3300013308 Bacteria 3995
111 Ga0182006_1000313 3300015261 Bacteria 42556
112 Ga0209437_100041 3300025233 Bacteria 444465
113 Ga0209646_1004200 3300025246 Bacteria 2659
114 Ga0209026_1000507 3300025250 Bacteria 27632
115 Ga0209026_1001979 3300025250 Bacteria 8185
116 Ga0209026_1007297 3300025250 Bacteria 2520
117 Ga0209233_1002896 3300025261 Bacteria 6132
118 Ga0209455_1007878 3300025272 Bacteria 2955
119 Ga0207647_10000049 3300025904 Bacteria 88392
120 Ga0207647_10000128 3300025904 Bacteria 59284
121 Ga0207645_10000300 3300025907 Bacteria 41495
122 Ga0207705_10000160 3300025909 Bacteria 72235
123 Ga0207705_10061570 3300025909 Bacteria 2711
124 Ga0207654_10000480 3300025911 Bacteria 22898
125 Ga0207654_10003537 3300025911 Bacteria 7900
126 Ga0207654_10003927 3300025911 Bacteria 7484
127 Ga0207707_10000026 3300025912 Bacteria 175026
128 Ga0207707_10000067 3300025912 Bacteria 105764
129 Ga0207695_10000267 3300025913 Bacteria 131133
130 Ga0207695_10008564 3300025913 Bacteria 12782
131 Ga0207695_10026137 3300025913 Bacteria 6519
132 Ga0207695_10028933 3300025913 Bacteria 6133
133 Ga0207695_10042219 3300025913 Bacteria 4874
134 Ga0207695_10206848 3300025913 Bacteria 1875
135 Ga0207671_10000244 3300025914 Bacteria 81258
136 Ga0207671_10001051 3300025914 Bacteria 33539
137 Ga0207671_10004337 3300025914 Bacteria 13623
138 Ga0207671_10009252 3300025914 Bacteria 8252
139 Ga0207671_10039782 3300025914 Bacteria 3482
140 Ga0207660_10008151 3300025917 Bacteria 6778
141 Ga0207657_10100717 3300025919 Bacteria 2398
142 Ga0207652_10000109 3300025921 Bacteria 89337
143 Ga0207694_10010575 3300025924 Bacteria 6965
144 Ga0207694_10284477 3300025924 Bacteria 1359
145 Ga0207644_10024838 3300025931 Bacteria 4116
146 Ga0207690_10001206 3300025932 Bacteria 16325
147 Ga0207690_10209060 3300025932 Bacteria 1486
148 Ga0207706_10000111 3300025933 Bacteria 87282
149 Ga0207704_10000016 3300025938 Bacteria 158362
150 Ga0207661_10075502 3300025944 Bacteria 2766
151 Ga0207667_10000020 3300025949 Bacteria 374770
152 Ga0207667_10003000 3300025949 Bacteria 20942
153 Ga0207667_10024953 3300025949 Bacteria 6554
154 Ga0207651_10009234 3300025960 Bacteria 5383
155 Ga0207640_10102672 3300025981 Bacteria 2009
156 Ga0207677_10010114 3300026023 Bacteria 5326
157 Ga0207677_10033257 3300026023 Bacteria 3324
158 Ga0207639_10001710 3300026041 Bacteria 14786
159 Ga0207639_10014325 3300026041 Bacteria 5574
160 Ga0207702_10000036 3300026078 Bacteria 154106
161 Ga0207702_10026139 3300026078 Bacteria 4846
162 Ga0207648_10000661 3300026089 Bacteria 38618
163 Ga0207674_10037579 3300026116 Bacteria 5034
164 Ga0207683_10005303 3300026121 Bacteria 11054
165 Ga0207698_10008542 3300026142 Bacteria 6486
166 Ga0268266_10000080 3300028379 Bacteria 210179
167 Ga0307515_10003035 3300028794 Bacteria 35572
168 Ga0307515_10004651 3300028794 Bacteria 28175
169 Ga0307515_10158386 3300028794 Bacteria 2323
170 Ga0265338_10070972 3300028800 Bacteria 2983
171 Ga0265327_10012357 3300031251 Bacteria 5772
172 Ga0307509_10070219 3300031507 Bacteria 3659
173 Ga0307507_10000015 3300033179 Bacteria 237419
174 Ga0395899_0000002 3300037312 Bacteria 1324310
175 Ga0395899_0000050 3300037312 Bacteria 224591
176 Ga0395899_0000534 3300037312 Bacteria 41504
177 Ga0395899_0000615 3300037312 Bacteria 37072
178 Ga0395899_0013779 3300037312 Bacteria 6180
179 Ga0395900_0000493 3300037418 Bacteria 55751
180 Ga0395900_0001751 3300037418 Bacteria 24946
181 Ga0395900_0005952 3300037418 Bacteria 12734
182 Ga0395898_0042542 3300037466 Bacteria 4481
183 Ga0395898_0066854 3300037466 Bacteria 3481
184 Ga0395905_0000461 3300037471 Bacteria 56680
185 Ga0395905_0002338 3300037471 Bacteria 21140
186 Ga0395901_0049355 3300038443 Bacteria 4372
187 Ga0395901_0072331 3300038443 Bacteria 3595
188 Ga0436361_0112281 3300039447 Bacteria 3381
189 Ga0439457_002520 3300042014 Bacteria 5213
190 Ga0439462_0009006 3300042015 Bacteria 2525
191 Ga0466966_0000113 3300044684 Bacteria 49984
192 Ga0466966_0060854 3300044684 Bacteria 2383
193 Ga0466968_0036592 3300044735 Bacteria 2057
194 Ga0466970_0089532 3300044765 Bacteria 1670
195 Ga0466959_0000015 3300045049 Bacteria 149242
196 Ga0495650_0051670 3300046471 Bacteria 1692
197 Ga0495585_0000138 3300046492 Bacteria 79479
198 Ga0495585_0000904 3300046492 Bacteria 25136
199 Ga0495606_0010350 3300046507 Bacteria 7752
200 Ga0495606_0010588 3300046507 Bacteria 7632
201 Ga0495610_0000302 3300046512 Bacteria 51984
202 Ga0495616_0009129 3300046513 Bacteria 5817
203 Ga0495616_0012774 3300046513 Bacteria 4753
204 Ga0495616_0022057 3300046513 Bacteria 3441
205 Ga0495648_0001856 3300046524 Bacteria 20231
206 Ga0495648_0013499 3300046524 Bacteria 6032
207 Ga0495652_0115908 3300046529 Bacteria 2146
208 Ga0495652_0125385 3300046529 Bacteria 2041
209 Ga0495609_0032228 3300046538 Bacteria 2381
210 Ga0495633_0000069 3300046558 Bacteria 135128
211 Ga0495668_0000494 3300046616 Bacteria 49401
212 Ga0495625_0000067 3300046660 Bacteria 171483
213 Ga0495625_0002630 3300046660 Bacteria 19183
214 Ga0495625_0003210 3300046660 Bacteria 16599
215 Ga0495625_0010306 3300046660 Bacteria 7749
216 Ga0495625_0010978 3300046660 Bacteria 7435
217 Ga0495625_0025194 3300046660 Bacteria 4515
218 Ga0495625_0114831 3300046660 Bacteria 1838
219 Ga0495649_0000054 3300046694 Bacteria 107048
220 Ga0495589_0042862 3300046794 Bacteria 2254
221 Ga0495600_0106615 3300046809 Bacteria 1826
222 Ga0495687_005648 3300047443 Bacteria 7900
223 Ga0495686_0000083 3300047472 Bacteria 198933
224 Ga0495686_0001829 3300047472 Bacteria 21405
225 Ga0495686_0002235 3300047472 Bacteria 18711
226 Ga0495686_0009256 3300047472 Bacteria 7114
227 Ga0495686_0027974 3300047472 Bacteria 3676
228 Ga0495686_0126675 3300047472 Bacteria 1518
229 Ga0496115_0314628 3300048918 Bacteria 1281
230 Ga0501036_0024031 3300049572 Bacteria 5137
231 Ga0501044_0085689 3300049823 Bacteria 3183
232 nmdc:mga0k408_53_c1 3300050493 Bacteria 57877
233 nmdc:mga0k408_80_c1 3300050493 Bacteria 45357
234 nmdc:mga05p37_2426_c1 3300050507 Bacteria 6274
235 Ga0500578_0000457 3300053086 Bacteria 49613
236 Ga0500578_0060472 3300053086 Bacteria 2420
237 Ga0500583_0000028 3300053092 Bacteria 108276
238 Ga0500608_005504 3300053122 Bacteria 5043
239 Ga0500618_000002 3300053125 Bacteria 370822
240 Ga0500652_076675 3300053131 Bacteria 1390
241 Ga0500622_0000333 3300053156 Bacteria 46554
242 Ga0500622_0045879 3300053156 Bacteria 2261
243 Ga0500636_0118851 3300053177 Bacteria 1485
244 Ga0501084_0008228 3300054114 Bacteria 8603

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0089532 Ga0466970_0089532_610_1650 344
2 3300005563 Ga0068855_100009031 Ga0068855_10000903112 346
3 3300005471 Ga0070698_100001608 Ga0070698_10000160812 347
4 3300047472 Ga0495686_0027974 Ga0495686_0027974_2093_3217 374
5 3300048918 Ga0496115_0314628 Ga0496115_0314628_20_1183 384
6 3300005336 Ga0070680_100001180 Ga0070680_1000011803 387
7 3300005337 Ga0070682_100000632 Ga0070682_10000063216 387
8 3300005341 Ga0070691_10001554 Ga0070691_100015547 387
9 3300005458 Ga0070681_10003681 Ga0070681_100036812 387
10 3300005530 Ga0070679_100034759 Ga0070679_1000347592 387
11 3300005563 Ga0068855_100033806 Ga0068855_1000338063 387
12 3300009093 Ga0105240_10001256 Ga0105240_1000125619 387
13 3300009174 Ga0105241_10000832 Ga0105241_1000083225 387
14 3300013104 Ga0157370_10000440 Ga0157370_1000044025 387
15 3300013105 Ga0157369_10127403 Ga0157369_101274033 387
16 3300025911 Ga0207654_10000480 Ga0207654_100004805 387
17 3300025912 Ga0207707_10000026 Ga0207707_1000002662 387
18 3300025912 Ga0207707_10000067 Ga0207707_1000006773 387
19 3300025913 Ga0207695_10008564 Ga0207695_100085645 387
20 3300025917 Ga0207660_10008151 Ga0207660_100081517 387
21 3300025921 Ga0207652_10000109 Ga0207652_100001097 387
22 3300025949 Ga0207667_10024953 Ga0207667_100249532 387
23 3300049823 Ga0501044_0085689 Ga0501044_0085689_447_1613 387
24 3300054114 Ga0501084_0008228 Ga0501084_0008228_681_1847 387
25 3300005577 Ga0068857_100063872 Ga0068857_1000638723 388
26 3300009147 Ga0114129_10004260 Ga0114129_100042606 388
27 3300025246 Ga0209646_1004200 Ga0209646_10042002 388
28 3300042014 Ga0439457_002520 Ga0439457_002520_1901_3070 388
29 3300042015 Ga0439462_0009006 Ga0439462_0009006_472_1641 388
30 3300044684 Ga0466966_0000113 Ga0466966_0000113_6134_7306 388
31 3300044735 Ga0466968_0036592 Ga0466968_0036592_162_1337 388
32 3300045049 Ga0466959_0000015 Ga0466959_0000015_12947_14119 388
33 3300050507 nmdc:mga05p37_2426_c1 nmdc:mga05p37_2426_c1_4468_5637 388
34 3300053086 Ga0500578_0000457 Ga0500578_0000457_28249_29421 388
35 3300053086 Ga0500578_0060472 Ga0500578_0060472_556_1725 388
36 3300053092 Ga0500583_0000028 Ga0500583_0000028_20485_21654 388
37 3300053156 Ga0500622_0045879 Ga0500622_0045879_432_1601 388
38 3300053177 Ga0500636_0118851 Ga0500636_0118851_206_1375 388
39 3300013297 Ga0157378_10057614 Ga0157378_100576142 389
40 3300049572 Ga0501036_0024031 Ga0501036_0024031_3400_4656 389
41 iso_pu_bacteria 2852623160 2852625122 389
42 iso_pu_bacteria 2884933994 2884934139 389
43 iso_pu_bacteria 2852627209 2852629883 392
44 iso_pu_bacteria 2919186247 2919188046 392
45 iso_pu_bacteria 2939664404 2939664687 392
46 3300003323 rootH1_10035299 rootH1_1003529932 393
47 3300009093 Ga0105240_10077499 Ga0105240_100774992 393
48 3300009545 Ga0105237_10003398 Ga0105237_1000339820 393
49 3300010375 Ga0105239_10000010 Ga0105239_1000001061 393
50 3300025914 Ga0207671_10039782 Ga0207671_100397823 393
51 3300046507 Ga0495606_0010588 Ga0495606_0010588_4464_5651 393
52 iso_pu_bacteria 2919437846 2919439185 393
53 iso_pu_bacteria 2919437846 2919439322 393
54 iso_pu_bacteria 2977232053 2977232077 393
55 3300005366 Ga0070659_100014255 Ga0070659_1000142554 395
56 3300005563 Ga0068855_100245017 Ga0068855_1002450172 395
57 3300005577 Ga0068857_100039587 Ga0068857_1000395872 395
58 3300009545 Ga0105237_10024030 Ga0105237_100240304 395
59 3300025261 Ga0209233_1002896 Ga0209233_10028962 395
60 3300025272 Ga0209455_1007878 Ga0209455_10078783 395
61 3300025904 Ga0207647_10000128 Ga0207647_1000012833 395
62 3300025932 Ga0207690_10209060 Ga0207690_102090602 395
63 3300026116 Ga0207674_10037579 Ga0207674_100375792 395
64 3300031507 Ga0307509_10070219 Ga0307509_100702192 395
65 3300038443 Ga0395901_0072331 Ga0395901_0072331_834_2021 395
66 3300004799 Ga0058863_11774510 Ga0058863_117745101 396
67 3300005327 Ga0070658_10072052 Ga0070658_100720522 396
68 3300005458 Ga0070681_10003572 Ga0070681_100035727 396
69 3300005530 Ga0070679_100002597 Ga0070679_1000025975 396
70 3300006195 Ga0075366_10000884 Ga0075366_100008847 396
71 3300010375 Ga0105239_10000001 Ga0105239_10000001164 396
72 3300013100 Ga0157373_10001737 Ga0157373_100017375 396
73 3300013104 Ga0157370_10023652 Ga0157370_100236523 396
74 3300013104 Ga0157370_10114730 Ga0157370_101147302 396
75 3300013307 Ga0157372_10001436 Ga0157372_100014364 396
76 3300013307 Ga0157372_10138186 Ga0157372_101381862 396
77 3300025250 Ga0209026_1007297 Ga0209026_10072972 396
78 3300025909 Ga0207705_10061570 Ga0207705_100615702 396
79 3300028794 Ga0307515_10003035 Ga0307515_1000303511 396
80 3300028794 Ga0307515_10004651 Ga0307515_1000465114 396
81 3300033179 Ga0307507_10000015 Ga0307507_10000015142 396
82 3300046492 Ga0495585_0000904 Ga0495585_0000904_11680_12876 396
83 3300046524 Ga0495648_0001856 Ga0495648_0001856_19008_20204 396
84 3300046524 Ga0495648_0013499 Ga0495648_0013499_3747_4940 396
85 3300046529 Ga0495652_0125385 Ga0495652_0125385_432_1628 396
86 3300046538 Ga0495609_0032228 Ga0495609_0032228_923_2119 396
87 3300046558 Ga0495633_0000069 Ga0495633_0000069_58700_59896 396
88 3300046616 Ga0495668_0000494 Ga0495668_0000494_41373_42569 396
89 3300046660 Ga0495625_0002630 Ga0495625_0002630_89_1285 396
90 3300046660 Ga0495625_0003210 Ga0495625_0003210_15291_16487 396
91 3300046660 Ga0495625_0025194 Ga0495625_0025194_2470_3666 396
92 3300046660 Ga0495625_0114831 Ga0495625_0114831_449_1639 396
93 3300046809 Ga0495600_0106615 Ga0495600_0106615_368_1564 396
94 3300047472 Ga0495686_0001829 Ga0495686_0001829_1814_3004 396
95 3300047472 Ga0495686_0126675 Ga0495686_0126675_198_1388 396
96 3300050493 nmdc:mga0k408_53_c1 nmdc:mga0k408_53_c1_37251_38447 396
97 3300053122 Ga0500608_005504 Ga0500608_005504_1194_2390 396
98 3300053156 Ga0500622_0000333 Ga0500622_0000333_43776_44966 396
99 3300001991 JGI24743J22301_10012607 JGI24743J22301_100126071 397
100 3300002737 JGI25162J39368_1000012 JGI25162J39368_100001268 397
101 3300003316 rootH1_10005394 rootH1_1000539413 397
102 3300003320 rootH2_10036808 rootH2_1003680810 397
103 3300003322 rootL2_10165306 rootL2_101653062 397
104 3300003322 rootL2_10212956 rootL2_102129562 397
105 3300003323 rootH1_10062487 rootH1_100624872 397
106 3300003323 rootH1_10157693 rootH1_101576932 397
107 3300003323 rootH1_10279903 rootH1_102799032 397
108 3300005288 Ga0065714_10018180 Ga0065714_100181801 397
109 3300005327 Ga0070658_10000113 Ga0070658_1000011368 397
110 3300005328 Ga0070676_10000430 Ga0070676_1000043015 397
111 3300005329 Ga0070683_100338598 Ga0070683_1003385982 397
112 3300005338 Ga0068868_100004489 Ga0068868_1000044893 397
113 3300005338 Ga0068868_100007397 Ga0068868_1000073973 397
114 3300005339 Ga0070660_100015440 Ga0070660_1000154402 397
115 3300005355 Ga0070671_100014322 Ga0070671_1000143224 397
116 3300005366 Ga0070659_100000119 Ga0070659_10000011936 397
117 3300005366 Ga0070659_100001920 Ga0070659_1000019208 397
118 3300005366 Ga0070659_100061997 Ga0070659_1000619971 397
119 3300005456 Ga0070678_100021914 Ga0070678_1000219144 397
120 3300005457 Ga0070662_100000003 Ga0070662_100000003192 397
121 3300005459 Ga0068867_100000725 Ga0068867_10000072512 397
122 3300005535 Ga0070684_100028398 Ga0070684_1000283982 397
123 3300005539 Ga0068853_100002099 Ga0068853_1000020992 397
124 3300005539 Ga0068853_100002412 Ga0068853_1000024126 397
125 3300005548 Ga0070665_100000012 Ga0070665_1000000128 397
126 3300005563 Ga0068855_100000019 Ga0068855_100000019128 397
127 3300005563 Ga0068855_100002739 Ga0068855_10000273910 397
128 3300005563 Ga0068855_100005291 Ga0068855_10000529110 397
129 3300005563 Ga0068855_100042148 Ga0068855_1000421484 397
130 3300005563 Ga0068855_100080114 Ga0068855_1000801142 397
131 3300005578 Ga0068854_100120797 Ga0068854_1001207971 397
132 3300005614 Ga0068856_100000014 Ga0068856_100000014132 397
133 3300005614 Ga0068856_100004414 Ga0068856_1000044148 397
134 3300005614 Ga0068856_100242444 Ga0068856_1002424442 397
135 3300005616 Ga0068852_100001570 Ga0068852_1000015704 397
136 3300006195 Ga0075366_10008311 Ga0075366_100083115 397
137 3300006237 Ga0097621_100000076 Ga0097621_10000007636 397
138 3300006358 Ga0068871_100000070 Ga0068871_1000000707 397
139 3300006881 Ga0068865_100000763 Ga0068865_1000007636 397
140 3300009093 Ga0105240_10000515 Ga0105240_1000051513 397
141 3300009093 Ga0105240_10038058 Ga0105240_100380585 397
142 3300009174 Ga0105241_10003983 Ga0105241_100039835 397
143 3300009174 Ga0105241_10018989 Ga0105241_100189892 397
144 3300009176 Ga0105242_10073812 Ga0105242_100738122 397
145 3300009545 Ga0105237_10000709 Ga0105237_1000070915 397
146 3300009545 Ga0105237_10000779 Ga0105237_1000077940 397
147 3300009545 Ga0105237_10001498 Ga0105237_1000149815 397
148 3300009545 Ga0105237_10002541 Ga0105237_100025413 397
149 3300009545 Ga0105237_10007988 Ga0105237_100079886 397
150 3300009545 Ga0105237_10012354 Ga0105237_1001235410 397
151 3300009545 Ga0105237_10012690 Ga0105237_1001269010 397
152 3300009551 Ga0105238_10001588 Ga0105238_1000158811 397
153 3300009551 Ga0105238_10127126 Ga0105238_101271263 397
154 3300009551 Ga0105238_10179454 Ga0105238_101794542 397
155 3300010375 Ga0105239_10000117 Ga0105239_1000011770 397
156 3300010375 Ga0105239_10001338 Ga0105239_1000133820 397
157 3300010375 Ga0105239_10001441 Ga0105239_100014415 397
158 3300010375 Ga0105239_10009681 Ga0105239_100096815 397
159 3300010375 Ga0105239_10148052 Ga0105239_101480522 397
160 3300013100 Ga0157373_10000045 Ga0157373_1000004575 397
161 3300013102 Ga0157371_10002765 Ga0157371_100027659 397
162 3300013102 Ga0157371_10034616 Ga0157371_100346163 397
163 3300013105 Ga0157369_10003209 Ga0157369_100032096 397
164 3300013105 Ga0157369_10054288 Ga0157369_100542881 397
165 3300013296 Ga0157374_10000147 Ga0157374_1000014734 397
166 3300013296 Ga0157374_10002011 Ga0157374_1000201116 397
167 3300013296 Ga0157374_10002735 Ga0157374_100027355 397
168 3300013306 Ga0163162_10000044 Ga0163162_1000004499 397
169 3300013306 Ga0163162_10048214 Ga0163162_100482142 397
170 3300013307 Ga0157372_10000015 Ga0157372_10000015161 397
171 3300013307 Ga0157372_10002432 Ga0157372_1000243211 397
172 3300013307 Ga0157372_10008737 Ga0157372_100087375 397
173 3300013307 Ga0157372_10173782 Ga0157372_101737822 397
174 3300013308 Ga0157375_10052879 Ga0157375_100528793 397
175 3300015261 Ga0182006_1000313 Ga0182006_100031326 397
176 3300025233 Ga0209437_100041 Ga0209437_100041113 397
177 3300025250 Ga0209026_1000507 Ga0209026_10005076 397
178 3300025250 Ga0209026_1001979 Ga0209026_10019795 397
179 3300025904 Ga0207647_10000049 Ga0207647_100000497 397
180 3300025907 Ga0207645_10000300 Ga0207645_1000030032 397
181 3300025909 Ga0207705_10000160 Ga0207705_100001608 397
182 3300025911 Ga0207654_10003537 Ga0207654_100035373 397
183 3300025911 Ga0207654_10003927 Ga0207654_100039275 397
184 3300025913 Ga0207695_10000267 Ga0207695_1000026721 397
185 3300025913 Ga0207695_10026137 Ga0207695_100261374 397
186 3300025913 Ga0207695_10028933 Ga0207695_100289335 397
187 3300025913 Ga0207695_10042219 Ga0207695_100422194 397
188 3300025913 Ga0207695_10206848 Ga0207695_102068482 397
189 3300025914 Ga0207671_10000244 Ga0207671_1000024485 397
190 3300025914 Ga0207671_10001051 Ga0207671_1000105117 397
191 3300025914 Ga0207671_10004337 Ga0207671_100043375 397
192 3300025914 Ga0207671_10009252 Ga0207671_100092529 397
193 3300025919 Ga0207657_10100717 Ga0207657_101007172 397
194 3300025924 Ga0207694_10010575 Ga0207694_100105754 397
195 3300025924 Ga0207694_10284477 Ga0207694_102844771 397
196 3300025931 Ga0207644_10024838 Ga0207644_100248382 397
197 3300025932 Ga0207690_10001206 Ga0207690_100012069 397
198 3300025933 Ga0207706_10000111 Ga0207706_100001116 397
199 3300025938 Ga0207704_10000016 Ga0207704_1000001667 397
200 3300025944 Ga0207661_10075502 Ga0207661_100755021 397
201 3300025949 Ga0207667_10000020 Ga0207667_1000002041 397
202 3300025949 Ga0207667_10003000 Ga0207667_1000300010 397
203 3300025960 Ga0207651_10009234 Ga0207651_100092342 397
204 3300025981 Ga0207640_10102672 Ga0207640_101026721 397
205 3300026023 Ga0207677_10010114 Ga0207677_100101143 397
206 3300026023 Ga0207677_10033257 Ga0207677_100332572 397
207 3300026041 Ga0207639_10001710 Ga0207639_1000171012 397
208 3300026041 Ga0207639_10014325 Ga0207639_100143251 397
209 3300026078 Ga0207702_10000036 Ga0207702_100000365 397
210 3300026078 Ga0207702_10026139 Ga0207702_100261393 397
211 3300026089 Ga0207648_10000661 Ga0207648_1000066122 397
212 3300026121 Ga0207683_10005303 Ga0207683_100053031 397
213 3300026142 Ga0207698_10008542 Ga0207698_100085424 397
214 3300028379 Ga0268266_10000080 Ga0268266_100000808 397
215 3300028794 Ga0307515_10158386 Ga0307515_101583862 397
216 3300028800 Ga0265338_10070972 Ga0265338_100709722 397
217 3300031251 Ga0265327_10012357 Ga0265327_100123573 397
218 3300037312 Ga0395899_0000002 Ga0395899_0000002_121715_122917 397
219 3300037312 Ga0395899_0000050 Ga0395899_0000050_93472_94665 397
220 3300037312 Ga0395899_0000534 Ga0395899_0000534_30615_31808 397
221 3300037312 Ga0395899_0000615 Ga0395899_0000615_20347_21540 397
222 3300037312 Ga0395899_0013779 Ga0395899_0013779_631_1824 397
223 3300037418 Ga0395900_0000493 Ga0395900_0000493_51736_52929 397
224 3300037418 Ga0395900_0001751 Ga0395900_0001751_20660_21853 397
225 3300037418 Ga0395900_0005952 Ga0395900_0005952_6324_7517 397
226 3300037466 Ga0395898_0042542 Ga0395898_0042542_3234_4427 397
227 3300037466 Ga0395898_0066854 Ga0395898_0066854_2178_3371 397
228 3300037471 Ga0395905_0000461 Ga0395905_0000461_52394_53587 397
229 3300037471 Ga0395905_0002338 Ga0395905_0002338_19051_20244 397
230 3300038443 Ga0395901_0049355 Ga0395901_0049355_86_1279 397
231 3300039447 Ga0436361_0112281 Ga0436361_0112281_935_2128 397
232 3300044684 Ga0466966_0060854 Ga0466966_0060854_1110_2312 397
233 3300046471 Ga0495650_0051670 Ga0495650_0051670_22_1215 397
234 3300046492 Ga0495585_0000138 Ga0495585_0000138_49289_50482 397
235 3300046507 Ga0495606_0010350 Ga0495606_0010350_1034_2239 397
236 3300046512 Ga0495610_0000302 Ga0495610_0000302_13514_14707 397
237 3300046513 Ga0495616_0009129 Ga0495616_0009129_586_1779 397
238 3300046513 Ga0495616_0012774 Ga0495616_0012774_625_1824 397
239 3300046513 Ga0495616_0022057 Ga0495616_0022057_1697_2920 397
240 3300046529 Ga0495652_0115908 Ga0495652_0115908_165_1358 397
241 3300046660 Ga0495625_0000067 Ga0495625_0000067_14132_15325 397
242 3300046660 Ga0495625_0010306 Ga0495625_0010306_4687_5883 397
243 3300046660 Ga0495625_0010978 Ga0495625_0010978_3030_4226 397
244 3300046694 Ga0495649_0000054 Ga0495649_0000054_14144_15337 397
245 3300046794 Ga0495589_0042862 Ga0495589_0042862_300_1493 397
246 3300047443 Ga0495687_005648 Ga0495687_005648_4567_5760 397
247 3300047472 Ga0495686_0000083 Ga0495686_0000083_18740_19933 397
248 3300047472 Ga0495686_0002235 Ga0495686_0002235_4219_5415 397
249 3300047472 Ga0495686_0009256 Ga0495686_0009256_3677_4873 397
250 3300050493 nmdc:mga0k408_80_c1 nmdc:mga0k408_80_c1_44055_45248 397
251 3300053125 Ga0500618_000002 Ga0500618_000002_12399_13598 397
252 3300053131 Ga0500652_076675 Ga0500652_076675_135_1328 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03786

UxuA

D-mannonate dehydratase (UxuA)

4

386

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.9718 3 397
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.9694 3 397
3ban-assembly1.cif.gz_B the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.9204 3 394
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.9042 3 397
1tz9-assembly1.cif.gz_B crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 0.8999 5 393
ID Description Score Start End Superfamily
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9752 3 397 3.20.20.150
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9679 3 397 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9601 177 397 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9517 177 397 3.20.20.150
3banB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9204 3 394 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A7X0DXS7-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) 0.9915 1 395 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A4R4GZ66-F1-model_v4 deleted 0.9914 207 317
AF-A0A530M004-F1-model_v4 deleted 0.9905 261 344
AF-A0A7X0DXS7-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) 0.989 1 395 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A7Y2DG78-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) 0.987 5 291 GO:0008198
GO:0008927
GO:0030145
GO:0042840

Feature Viewer

pLDDT pTM Quality
93.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map