F363453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 138 | 244 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300044735|Ga0466968_0036592|Ga0466968_0036592_162_1337 |
| Length | 391 |
| Sequence | MYQFEQTMRWFGPSDPVSLADIRQAGCTGVVSALHHVPNGAVWTKEEILQRKKIIEAAGLTWSVVESVPVHEEIKTQKGRYQEYIANYCESIRNLAACGIYIVTYNFMPVLDWTRTDLAYTVADGSKALRFEKAAMVAFDVYMLKRPGAEKDYTAADLAKAQQRLAAMSDDEKQLLQRNIIAGLPGSEESFTLQKFQAALDTYAGIDAKKLQQHLIYFLQQVSPVADEVGVKLVVHPDDPPYAIFGLPRVVSTAEHVQQLFDAVPNASNGLCFCTGSFGVRADNNLPAMVQQFGDRINFIHLRSTQRDAEGNFYEANHLEGDVDMYNVVKNLVKVMQKRQINIAMRPDHGHQMLDDLNKKTNPGYSAIGRLRGLAELRGLEMGIARSMASQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 2 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 5 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 6 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 7 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 97 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 104 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 105 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 108 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 109 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 110 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 127 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 130 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 132 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 133 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 134 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 135 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 136 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 137 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 138 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.43 |
| Metatranscriptomes | 0.4 |
| Isolates | 3.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.75 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 85.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10012607 | 3300001991 | Bacteria | 1540 |
| 2 | JGI25162J39368_1000012 | 3300002737 | Bacteria | 373191 |
| 3 | rootH1_10005394 | 3300003316 | Bacteria | 34329 |
| 4 | rootH2_10036808 | 3300003320 | Bacteria | 14194 |
| 5 | rootL2_10165306 | 3300003322 | Bacteria | 2354 |
| 6 | rootL2_10212956 | 3300003322 | Bacteria | 3605 |
| 7 | rootH1_10035299 | 3300003323 | Bacteria | 54644 |
| 8 | rootH1_10062487 | 3300003323 | Bacteria | 1961 |
| 9 | rootH1_10157693 | 3300003323 | Bacteria | 4022 |
| 10 | rootH1_10279903 | 3300003323 | Bacteria | 2747 |
| 11 | Ga0058863_11774510 | 3300004799 | Bacteria | 1320 |
| 12 | Ga0065714_10018180 | 3300005288 | Bacteria | 2246 |
| 13 | Ga0070658_10000113 | 3300005327 | Bacteria | 72221 |
| 14 | Ga0070658_10072052 | 3300005327 | Bacteria | 2831 |
| 15 | Ga0070676_10000430 | 3300005328 | Bacteria | 19880 |
| 16 | Ga0070683_100338598 | 3300005329 | Bacteria | 1432 |
| 17 | Ga0070680_100001180 | 3300005336 | Bacteria | 18795 |
| 18 | Ga0070682_100000632 | 3300005337 | Bacteria | 21377 |
| 19 | Ga0068868_100004489 | 3300005338 | Bacteria | 9793 |
| 20 | Ga0068868_100007397 | 3300005338 | Bacteria | 7823 |
| 21 | Ga0070660_100015440 | 3300005339 | Bacteria | 5516 |
| 22 | Ga0070691_10001554 | 3300005341 | Bacteria | 9896 |
| 23 | Ga0070671_100014322 | 3300005355 | Bacteria | 6406 |
| 24 | Ga0070659_100000119 | 3300005366 | Bacteria | 59333 |
| 25 | Ga0070659_100001920 | 3300005366 | Bacteria | 14847 |
| 26 | Ga0070659_100014255 | 3300005366 | Bacteria | 5934 |
| 27 | Ga0070659_100061997 | 3300005366 | Bacteria | 2955 |
| 28 | Ga0070678_100021914 | 3300005456 | Bacteria | 4223 |
| 29 | Ga0070662_100000003 | 3300005457 | Bacteria | 239813 |
| 30 | Ga0070681_10003572 | 3300005458 | Bacteria | 14581 |
| 31 | Ga0070681_10003681 | 3300005458 | Bacteria | 14383 |
| 32 | Ga0068867_100000725 | 3300005459 | Bacteria | 22054 |
| 33 | Ga0070698_100001608 | 3300005471 | Bacteria | 25137 |
| 34 | Ga0070679_100002597 | 3300005530 | Bacteria | 16419 |
| 35 | Ga0070679_100034759 | 3300005530 | Unclassified | 4997 |
| 36 | Ga0070684_100028398 | 3300005535 | Bacteria | 4733 |
| 37 | Ga0068853_100002099 | 3300005539 | Bacteria | 14786 |
| 38 | Ga0068853_100002412 | 3300005539 | Bacteria | 13959 |
| 39 | Ga0070665_100000012 | 3300005548 | Bacteria | 508937 |
| 40 | Ga0068855_100000019 | 3300005563 | Bacteria | 205963 |
| 41 | Ga0068855_100002739 | 3300005563 | Bacteria | 21701 |
| 42 | Ga0068855_100005291 | 3300005563 | Bacteria | 15758 |
| 43 | Ga0068855_100009031 | 3300005563 | Bacteria | 12044 |
| 44 | Ga0068855_100033806 | 3300005563 | Bacteria | 6100 |
| 45 | Ga0068855_100042148 | 3300005563 | Bacteria | 5409 |
| 46 | Ga0068855_100080114 | 3300005563 | Bacteria | 3787 |
| 47 | Ga0068855_100245017 | 3300005563 | Bacteria | 2001 |
| 48 | Ga0068857_100039587 | 3300005577 | Bacteria | 4176 |
| 49 | Ga0068857_100063872 | 3300005577 | Bacteria | 3273 |
| 50 | Ga0068854_100120797 | 3300005578 | Bacteria | 1989 |
| 51 | Ga0068856_100000014 | 3300005614 | Bacteria | 163480 |
| 52 | Ga0068856_100004414 | 3300005614 | Bacteria | 14023 |
| 53 | Ga0068856_100242444 | 3300005614 | Bacteria | 1818 |
| 54 | Ga0068852_100001570 | 3300005616 | Bacteria | 15506 |
| 55 | Ga0075366_10000884 | 3300006195 | Bacteria | 14482 |
| 56 | Ga0075366_10008311 | 3300006195 | Bacteria | 5765 |
| 57 | Ga0097621_100000076 | 3300006237 | Bacteria | 51192 |
| 58 | Ga0068871_100000070 | 3300006358 | Bacteria | 57286 |
| 59 | Ga0068865_100000763 | 3300006881 | Bacteria | 18076 |
| 60 | Ga0105240_10000515 | 3300009093 | Bacteria | 71183 |
| 61 | Ga0105240_10001256 | 3300009093 | Bacteria | 44019 |
| 62 | Ga0105240_10038058 | 3300009093 | Bacteria | 6175 |
| 63 | Ga0105240_10077499 | 3300009093 | Bacteria | 4095 |
| 64 | Ga0114129_10004260 | 3300009147 | Bacteria | 20220 |
| 65 | Ga0105241_10000832 | 3300009174 | Bacteria | 23374 |
| 66 | Ga0105241_10003983 | 3300009174 | Bacteria | 10917 |
| 67 | Ga0105241_10018989 | 3300009174 | Bacteria | 5067 |
| 68 | Ga0105242_10073812 | 3300009176 | Bacteria | 2837 |
| 69 | Ga0105237_10000709 | 3300009545 | Bacteria | 46102 |
| 70 | Ga0105237_10000779 | 3300009545 | Bacteria | 43629 |
| 71 | Ga0105237_10001498 | 3300009545 | Bacteria | 30756 |
| 72 | Ga0105237_10002541 | 3300009545 | Bacteria | 22572 |
| 73 | Ga0105237_10003398 | 3300009545 | Bacteria | 18931 |
| 74 | Ga0105237_10007988 | 3300009545 | Bacteria | 11517 |
| 75 | Ga0105237_10012354 | 3300009545 | Bacteria | 8996 |
| 76 | Ga0105237_10012690 | 3300009545 | Bacteria | 8866 |
| 77 | Ga0105237_10024030 | 3300009545 | Bacteria | 6235 |
| 78 | Ga0105238_10001588 | 3300009551 | Bacteria | 22750 |
| 79 | Ga0105238_10127126 | 3300009551 | Bacteria | 2527 |
| 80 | Ga0105238_10179454 | 3300009551 | Bacteria | 2094 |
| 81 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 82 | Ga0105239_10000010 | 3300010375 | Bacteria | 341545 |
| 83 | Ga0105239_10000117 | 3300010375 | Bacteria | 112291 |
| 84 | Ga0105239_10001338 | 3300010375 | Bacteria | 33217 |
| 85 | Ga0105239_10001441 | 3300010375 | Bacteria | 31694 |
| 86 | Ga0105239_10009681 | 3300010375 | Bacteria | 10836 |
| 87 | Ga0105239_10148052 | 3300010375 | Bacteria | 2619 |
| 88 | Ga0157373_10000045 | 3300013100 | Bacteria | 112207 |
| 89 | Ga0157373_10001737 | 3300013100 | Bacteria | 16561 |
| 90 | Ga0157371_10002765 | 3300013102 | Bacteria | 16489 |
| 91 | Ga0157371_10034616 | 3300013102 | Bacteria | 3622 |
| 92 | Ga0157370_10000440 | 3300013104 | Bacteria | 51946 |
| 93 | Ga0157370_10023652 | 3300013104 | Bacteria | 6098 |
| 94 | Ga0157370_10114730 | 3300013104 | Bacteria | 2516 |
| 95 | Ga0157369_10003209 | 3300013105 | Bacteria | 19502 |
| 96 | Ga0157369_10054288 | 3300013105 | Bacteria | 4328 |
| 97 | Ga0157369_10127403 | 3300013105 | Bacteria | 2698 |
| 98 | Ga0157374_10000147 | 3300013296 | Bacteria | 63762 |
| 99 | Ga0157374_10002011 | 3300013296 | Bacteria | 17066 |
| 100 | Ga0157374_10002735 | 3300013296 | Bacteria | 14808 |
| 101 | Ga0157378_10057614 | 3300013297 | Bacteria | 3463 |
| 102 | Ga0163162_10000044 | 3300013306 | Bacteria | 128200 |
| 103 | Ga0163162_10048214 | 3300013306 | Bacteria | 4268 |
| 104 | Ga0157372_10000015 | 3300013307 | Bacteria | 225365 |
| 105 | Ga0157372_10001436 | 3300013307 | Bacteria | 25757 |
| 106 | Ga0157372_10002432 | 3300013307 | Bacteria | 20167 |
| 107 | Ga0157372_10008737 | 3300013307 | Bacteria | 10754 |
| 108 | Ga0157372_10138186 | 3300013307 | Bacteria | 2807 |
| 109 | Ga0157372_10173782 | 3300013307 | Bacteria | 2493 |
| 110 | Ga0157375_10052879 | 3300013308 | Bacteria | 3995 |
| 111 | Ga0182006_1000313 | 3300015261 | Bacteria | 42556 |
| 112 | Ga0209437_100041 | 3300025233 | Bacteria | 444465 |
| 113 | Ga0209646_1004200 | 3300025246 | Bacteria | 2659 |
| 114 | Ga0209026_1000507 | 3300025250 | Bacteria | 27632 |
| 115 | Ga0209026_1001979 | 3300025250 | Bacteria | 8185 |
| 116 | Ga0209026_1007297 | 3300025250 | Bacteria | 2520 |
| 117 | Ga0209233_1002896 | 3300025261 | Bacteria | 6132 |
| 118 | Ga0209455_1007878 | 3300025272 | Bacteria | 2955 |
| 119 | Ga0207647_10000049 | 3300025904 | Bacteria | 88392 |
| 120 | Ga0207647_10000128 | 3300025904 | Bacteria | 59284 |
| 121 | Ga0207645_10000300 | 3300025907 | Bacteria | 41495 |
| 122 | Ga0207705_10000160 | 3300025909 | Bacteria | 72235 |
| 123 | Ga0207705_10061570 | 3300025909 | Bacteria | 2711 |
| 124 | Ga0207654_10000480 | 3300025911 | Bacteria | 22898 |
| 125 | Ga0207654_10003537 | 3300025911 | Bacteria | 7900 |
| 126 | Ga0207654_10003927 | 3300025911 | Bacteria | 7484 |
| 127 | Ga0207707_10000026 | 3300025912 | Bacteria | 175026 |
| 128 | Ga0207707_10000067 | 3300025912 | Bacteria | 105764 |
| 129 | Ga0207695_10000267 | 3300025913 | Bacteria | 131133 |
| 130 | Ga0207695_10008564 | 3300025913 | Bacteria | 12782 |
| 131 | Ga0207695_10026137 | 3300025913 | Bacteria | 6519 |
| 132 | Ga0207695_10028933 | 3300025913 | Bacteria | 6133 |
| 133 | Ga0207695_10042219 | 3300025913 | Bacteria | 4874 |
| 134 | Ga0207695_10206848 | 3300025913 | Bacteria | 1875 |
| 135 | Ga0207671_10000244 | 3300025914 | Bacteria | 81258 |
| 136 | Ga0207671_10001051 | 3300025914 | Bacteria | 33539 |
| 137 | Ga0207671_10004337 | 3300025914 | Bacteria | 13623 |
| 138 | Ga0207671_10009252 | 3300025914 | Bacteria | 8252 |
| 139 | Ga0207671_10039782 | 3300025914 | Bacteria | 3482 |
| 140 | Ga0207660_10008151 | 3300025917 | Bacteria | 6778 |
| 141 | Ga0207657_10100717 | 3300025919 | Bacteria | 2398 |
| 142 | Ga0207652_10000109 | 3300025921 | Bacteria | 89337 |
| 143 | Ga0207694_10010575 | 3300025924 | Bacteria | 6965 |
| 144 | Ga0207694_10284477 | 3300025924 | Bacteria | 1359 |
| 145 | Ga0207644_10024838 | 3300025931 | Bacteria | 4116 |
| 146 | Ga0207690_10001206 | 3300025932 | Bacteria | 16325 |
| 147 | Ga0207690_10209060 | 3300025932 | Bacteria | 1486 |
| 148 | Ga0207706_10000111 | 3300025933 | Bacteria | 87282 |
| 149 | Ga0207704_10000016 | 3300025938 | Bacteria | 158362 |
| 150 | Ga0207661_10075502 | 3300025944 | Bacteria | 2766 |
| 151 | Ga0207667_10000020 | 3300025949 | Bacteria | 374770 |
| 152 | Ga0207667_10003000 | 3300025949 | Bacteria | 20942 |
| 153 | Ga0207667_10024953 | 3300025949 | Bacteria | 6554 |
| 154 | Ga0207651_10009234 | 3300025960 | Bacteria | 5383 |
| 155 | Ga0207640_10102672 | 3300025981 | Bacteria | 2009 |
| 156 | Ga0207677_10010114 | 3300026023 | Bacteria | 5326 |
| 157 | Ga0207677_10033257 | 3300026023 | Bacteria | 3324 |
| 158 | Ga0207639_10001710 | 3300026041 | Bacteria | 14786 |
| 159 | Ga0207639_10014325 | 3300026041 | Bacteria | 5574 |
| 160 | Ga0207702_10000036 | 3300026078 | Bacteria | 154106 |
| 161 | Ga0207702_10026139 | 3300026078 | Bacteria | 4846 |
| 162 | Ga0207648_10000661 | 3300026089 | Bacteria | 38618 |
| 163 | Ga0207674_10037579 | 3300026116 | Bacteria | 5034 |
| 164 | Ga0207683_10005303 | 3300026121 | Bacteria | 11054 |
| 165 | Ga0207698_10008542 | 3300026142 | Bacteria | 6486 |
| 166 | Ga0268266_10000080 | 3300028379 | Bacteria | 210179 |
| 167 | Ga0307515_10003035 | 3300028794 | Bacteria | 35572 |
| 168 | Ga0307515_10004651 | 3300028794 | Bacteria | 28175 |
| 169 | Ga0307515_10158386 | 3300028794 | Bacteria | 2323 |
| 170 | Ga0265338_10070972 | 3300028800 | Bacteria | 2983 |
| 171 | Ga0265327_10012357 | 3300031251 | Bacteria | 5772 |
| 172 | Ga0307509_10070219 | 3300031507 | Bacteria | 3659 |
| 173 | Ga0307507_10000015 | 3300033179 | Bacteria | 237419 |
| 174 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 175 | Ga0395899_0000050 | 3300037312 | Bacteria | 224591 |
| 176 | Ga0395899_0000534 | 3300037312 | Bacteria | 41504 |
| 177 | Ga0395899_0000615 | 3300037312 | Bacteria | 37072 |
| 178 | Ga0395899_0013779 | 3300037312 | Bacteria | 6180 |
| 179 | Ga0395900_0000493 | 3300037418 | Bacteria | 55751 |
| 180 | Ga0395900_0001751 | 3300037418 | Bacteria | 24946 |
| 181 | Ga0395900_0005952 | 3300037418 | Bacteria | 12734 |
| 182 | Ga0395898_0042542 | 3300037466 | Bacteria | 4481 |
| 183 | Ga0395898_0066854 | 3300037466 | Bacteria | 3481 |
| 184 | Ga0395905_0000461 | 3300037471 | Bacteria | 56680 |
| 185 | Ga0395905_0002338 | 3300037471 | Bacteria | 21140 |
| 186 | Ga0395901_0049355 | 3300038443 | Bacteria | 4372 |
| 187 | Ga0395901_0072331 | 3300038443 | Bacteria | 3595 |
| 188 | Ga0436361_0112281 | 3300039447 | Bacteria | 3381 |
| 189 | Ga0439457_002520 | 3300042014 | Bacteria | 5213 |
| 190 | Ga0439462_0009006 | 3300042015 | Bacteria | 2525 |
| 191 | Ga0466966_0000113 | 3300044684 | Bacteria | 49984 |
| 192 | Ga0466966_0060854 | 3300044684 | Bacteria | 2383 |
| 193 | Ga0466968_0036592 | 3300044735 | Bacteria | 2057 |
| 194 | Ga0466970_0089532 | 3300044765 | Bacteria | 1670 |
| 195 | Ga0466959_0000015 | 3300045049 | Bacteria | 149242 |
| 196 | Ga0495650_0051670 | 3300046471 | Bacteria | 1692 |
| 197 | Ga0495585_0000138 | 3300046492 | Bacteria | 79479 |
| 198 | Ga0495585_0000904 | 3300046492 | Bacteria | 25136 |
| 199 | Ga0495606_0010350 | 3300046507 | Bacteria | 7752 |
| 200 | Ga0495606_0010588 | 3300046507 | Bacteria | 7632 |
| 201 | Ga0495610_0000302 | 3300046512 | Bacteria | 51984 |
| 202 | Ga0495616_0009129 | 3300046513 | Bacteria | 5817 |
| 203 | Ga0495616_0012774 | 3300046513 | Bacteria | 4753 |
| 204 | Ga0495616_0022057 | 3300046513 | Bacteria | 3441 |
| 205 | Ga0495648_0001856 | 3300046524 | Bacteria | 20231 |
| 206 | Ga0495648_0013499 | 3300046524 | Bacteria | 6032 |
| 207 | Ga0495652_0115908 | 3300046529 | Bacteria | 2146 |
| 208 | Ga0495652_0125385 | 3300046529 | Bacteria | 2041 |
| 209 | Ga0495609_0032228 | 3300046538 | Bacteria | 2381 |
| 210 | Ga0495633_0000069 | 3300046558 | Bacteria | 135128 |
| 211 | Ga0495668_0000494 | 3300046616 | Bacteria | 49401 |
| 212 | Ga0495625_0000067 | 3300046660 | Bacteria | 171483 |
| 213 | Ga0495625_0002630 | 3300046660 | Bacteria | 19183 |
| 214 | Ga0495625_0003210 | 3300046660 | Bacteria | 16599 |
| 215 | Ga0495625_0010306 | 3300046660 | Bacteria | 7749 |
| 216 | Ga0495625_0010978 | 3300046660 | Bacteria | 7435 |
| 217 | Ga0495625_0025194 | 3300046660 | Bacteria | 4515 |
| 218 | Ga0495625_0114831 | 3300046660 | Bacteria | 1838 |
| 219 | Ga0495649_0000054 | 3300046694 | Bacteria | 107048 |
| 220 | Ga0495589_0042862 | 3300046794 | Bacteria | 2254 |
| 221 | Ga0495600_0106615 | 3300046809 | Bacteria | 1826 |
| 222 | Ga0495687_005648 | 3300047443 | Bacteria | 7900 |
| 223 | Ga0495686_0000083 | 3300047472 | Bacteria | 198933 |
| 224 | Ga0495686_0001829 | 3300047472 | Bacteria | 21405 |
| 225 | Ga0495686_0002235 | 3300047472 | Bacteria | 18711 |
| 226 | Ga0495686_0009256 | 3300047472 | Bacteria | 7114 |
| 227 | Ga0495686_0027974 | 3300047472 | Bacteria | 3676 |
| 228 | Ga0495686_0126675 | 3300047472 | Bacteria | 1518 |
| 229 | Ga0496115_0314628 | 3300048918 | Bacteria | 1281 |
| 230 | Ga0501036_0024031 | 3300049572 | Bacteria | 5137 |
| 231 | Ga0501044_0085689 | 3300049823 | Bacteria | 3183 |
| 232 | nmdc:mga0k408_53_c1 | 3300050493 | Bacteria | 57877 |
| 233 | nmdc:mga0k408_80_c1 | 3300050493 | Bacteria | 45357 |
| 234 | nmdc:mga05p37_2426_c1 | 3300050507 | Bacteria | 6274 |
| 235 | Ga0500578_0000457 | 3300053086 | Bacteria | 49613 |
| 236 | Ga0500578_0060472 | 3300053086 | Bacteria | 2420 |
| 237 | Ga0500583_0000028 | 3300053092 | Bacteria | 108276 |
| 238 | Ga0500608_005504 | 3300053122 | Bacteria | 5043 |
| 239 | Ga0500618_000002 | 3300053125 | Bacteria | 370822 |
| 240 | Ga0500652_076675 | 3300053131 | Bacteria | 1390 |
| 241 | Ga0500622_0000333 | 3300053156 | Bacteria | 46554 |
| 242 | Ga0500622_0045879 | 3300053156 | Bacteria | 2261 |
| 243 | Ga0500636_0118851 | 3300053177 | Bacteria | 1485 |
| 244 | Ga0501084_0008228 | 3300054114 | Bacteria | 8603 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0089532 | Ga0466970_0089532_610_1650 | 344 |
| 2 | 3300005563 | Ga0068855_100009031 | Ga0068855_10000903112 | 346 |
| 3 | 3300005471 | Ga0070698_100001608 | Ga0070698_10000160812 | 347 |
| 4 | 3300047472 | Ga0495686_0027974 | Ga0495686_0027974_2093_3217 | 374 |
| 5 | 3300048918 | Ga0496115_0314628 | Ga0496115_0314628_20_1183 | 384 |
| 6 | 3300005336 | Ga0070680_100001180 | Ga0070680_1000011803 | 387 |
| 7 | 3300005337 | Ga0070682_100000632 | Ga0070682_10000063216 | 387 |
| 8 | 3300005341 | Ga0070691_10001554 | Ga0070691_100015547 | 387 |
| 9 | 3300005458 | Ga0070681_10003681 | Ga0070681_100036812 | 387 |
| 10 | 3300005530 | Ga0070679_100034759 | Ga0070679_1000347592 | 387 |
| 11 | 3300005563 | Ga0068855_100033806 | Ga0068855_1000338063 | 387 |
| 12 | 3300009093 | Ga0105240_10001256 | Ga0105240_1000125619 | 387 |
| 13 | 3300009174 | Ga0105241_10000832 | Ga0105241_1000083225 | 387 |
| 14 | 3300013104 | Ga0157370_10000440 | Ga0157370_1000044025 | 387 |
| 15 | 3300013105 | Ga0157369_10127403 | Ga0157369_101274033 | 387 |
| 16 | 3300025911 | Ga0207654_10000480 | Ga0207654_100004805 | 387 |
| 17 | 3300025912 | Ga0207707_10000026 | Ga0207707_1000002662 | 387 |
| 18 | 3300025912 | Ga0207707_10000067 | Ga0207707_1000006773 | 387 |
| 19 | 3300025913 | Ga0207695_10008564 | Ga0207695_100085645 | 387 |
| 20 | 3300025917 | Ga0207660_10008151 | Ga0207660_100081517 | 387 |
| 21 | 3300025921 | Ga0207652_10000109 | Ga0207652_100001097 | 387 |
| 22 | 3300025949 | Ga0207667_10024953 | Ga0207667_100249532 | 387 |
| 23 | 3300049823 | Ga0501044_0085689 | Ga0501044_0085689_447_1613 | 387 |
| 24 | 3300054114 | Ga0501084_0008228 | Ga0501084_0008228_681_1847 | 387 |
| 25 | 3300005577 | Ga0068857_100063872 | Ga0068857_1000638723 | 388 |
| 26 | 3300009147 | Ga0114129_10004260 | Ga0114129_100042606 | 388 |
| 27 | 3300025246 | Ga0209646_1004200 | Ga0209646_10042002 | 388 |
| 28 | 3300042014 | Ga0439457_002520 | Ga0439457_002520_1901_3070 | 388 |
| 29 | 3300042015 | Ga0439462_0009006 | Ga0439462_0009006_472_1641 | 388 |
| 30 | 3300044684 | Ga0466966_0000113 | Ga0466966_0000113_6134_7306 | 388 |
| 31 | 3300044735 | Ga0466968_0036592 | Ga0466968_0036592_162_1337 | 388 |
| 32 | 3300045049 | Ga0466959_0000015 | Ga0466959_0000015_12947_14119 | 388 |
| 33 | 3300050507 | nmdc:mga05p37_2426_c1 | nmdc:mga05p37_2426_c1_4468_5637 | 388 |
| 34 | 3300053086 | Ga0500578_0000457 | Ga0500578_0000457_28249_29421 | 388 |
| 35 | 3300053086 | Ga0500578_0060472 | Ga0500578_0060472_556_1725 | 388 |
| 36 | 3300053092 | Ga0500583_0000028 | Ga0500583_0000028_20485_21654 | 388 |
| 37 | 3300053156 | Ga0500622_0045879 | Ga0500622_0045879_432_1601 | 388 |
| 38 | 3300053177 | Ga0500636_0118851 | Ga0500636_0118851_206_1375 | 388 |
| 39 | 3300013297 | Ga0157378_10057614 | Ga0157378_100576142 | 389 |
| 40 | 3300049572 | Ga0501036_0024031 | Ga0501036_0024031_3400_4656 | 389 |
| 41 | iso_pu_bacteria | 2852623160 | 2852625122 | 389 |
| 42 | iso_pu_bacteria | 2884933994 | 2884934139 | 389 |
| 43 | iso_pu_bacteria | 2852627209 | 2852629883 | 392 |
| 44 | iso_pu_bacteria | 2919186247 | 2919188046 | 392 |
| 45 | iso_pu_bacteria | 2939664404 | 2939664687 | 392 |
| 46 | 3300003323 | rootH1_10035299 | rootH1_1003529932 | 393 |
| 47 | 3300009093 | Ga0105240_10077499 | Ga0105240_100774992 | 393 |
| 48 | 3300009545 | Ga0105237_10003398 | Ga0105237_1000339820 | 393 |
| 49 | 3300010375 | Ga0105239_10000010 | Ga0105239_1000001061 | 393 |
| 50 | 3300025914 | Ga0207671_10039782 | Ga0207671_100397823 | 393 |
| 51 | 3300046507 | Ga0495606_0010588 | Ga0495606_0010588_4464_5651 | 393 |
| 52 | iso_pu_bacteria | 2919437846 | 2919439185 | 393 |
| 53 | iso_pu_bacteria | 2919437846 | 2919439322 | 393 |
| 54 | iso_pu_bacteria | 2977232053 | 2977232077 | 393 |
| 55 | 3300005366 | Ga0070659_100014255 | Ga0070659_1000142554 | 395 |
| 56 | 3300005563 | Ga0068855_100245017 | Ga0068855_1002450172 | 395 |
| 57 | 3300005577 | Ga0068857_100039587 | Ga0068857_1000395872 | 395 |
| 58 | 3300009545 | Ga0105237_10024030 | Ga0105237_100240304 | 395 |
| 59 | 3300025261 | Ga0209233_1002896 | Ga0209233_10028962 | 395 |
| 60 | 3300025272 | Ga0209455_1007878 | Ga0209455_10078783 | 395 |
| 61 | 3300025904 | Ga0207647_10000128 | Ga0207647_1000012833 | 395 |
| 62 | 3300025932 | Ga0207690_10209060 | Ga0207690_102090602 | 395 |
| 63 | 3300026116 | Ga0207674_10037579 | Ga0207674_100375792 | 395 |
| 64 | 3300031507 | Ga0307509_10070219 | Ga0307509_100702192 | 395 |
| 65 | 3300038443 | Ga0395901_0072331 | Ga0395901_0072331_834_2021 | 395 |
| 66 | 3300004799 | Ga0058863_11774510 | Ga0058863_117745101 | 396 |
| 67 | 3300005327 | Ga0070658_10072052 | Ga0070658_100720522 | 396 |
| 68 | 3300005458 | Ga0070681_10003572 | Ga0070681_100035727 | 396 |
| 69 | 3300005530 | Ga0070679_100002597 | Ga0070679_1000025975 | 396 |
| 70 | 3300006195 | Ga0075366_10000884 | Ga0075366_100008847 | 396 |
| 71 | 3300010375 | Ga0105239_10000001 | Ga0105239_10000001164 | 396 |
| 72 | 3300013100 | Ga0157373_10001737 | Ga0157373_100017375 | 396 |
| 73 | 3300013104 | Ga0157370_10023652 | Ga0157370_100236523 | 396 |
| 74 | 3300013104 | Ga0157370_10114730 | Ga0157370_101147302 | 396 |
| 75 | 3300013307 | Ga0157372_10001436 | Ga0157372_100014364 | 396 |
| 76 | 3300013307 | Ga0157372_10138186 | Ga0157372_101381862 | 396 |
| 77 | 3300025250 | Ga0209026_1007297 | Ga0209026_10072972 | 396 |
| 78 | 3300025909 | Ga0207705_10061570 | Ga0207705_100615702 | 396 |
| 79 | 3300028794 | Ga0307515_10003035 | Ga0307515_1000303511 | 396 |
| 80 | 3300028794 | Ga0307515_10004651 | Ga0307515_1000465114 | 396 |
| 81 | 3300033179 | Ga0307507_10000015 | Ga0307507_10000015142 | 396 |
| 82 | 3300046492 | Ga0495585_0000904 | Ga0495585_0000904_11680_12876 | 396 |
| 83 | 3300046524 | Ga0495648_0001856 | Ga0495648_0001856_19008_20204 | 396 |
| 84 | 3300046524 | Ga0495648_0013499 | Ga0495648_0013499_3747_4940 | 396 |
| 85 | 3300046529 | Ga0495652_0125385 | Ga0495652_0125385_432_1628 | 396 |
| 86 | 3300046538 | Ga0495609_0032228 | Ga0495609_0032228_923_2119 | 396 |
| 87 | 3300046558 | Ga0495633_0000069 | Ga0495633_0000069_58700_59896 | 396 |
| 88 | 3300046616 | Ga0495668_0000494 | Ga0495668_0000494_41373_42569 | 396 |
| 89 | 3300046660 | Ga0495625_0002630 | Ga0495625_0002630_89_1285 | 396 |
| 90 | 3300046660 | Ga0495625_0003210 | Ga0495625_0003210_15291_16487 | 396 |
| 91 | 3300046660 | Ga0495625_0025194 | Ga0495625_0025194_2470_3666 | 396 |
| 92 | 3300046660 | Ga0495625_0114831 | Ga0495625_0114831_449_1639 | 396 |
| 93 | 3300046809 | Ga0495600_0106615 | Ga0495600_0106615_368_1564 | 396 |
| 94 | 3300047472 | Ga0495686_0001829 | Ga0495686_0001829_1814_3004 | 396 |
| 95 | 3300047472 | Ga0495686_0126675 | Ga0495686_0126675_198_1388 | 396 |
| 96 | 3300050493 | nmdc:mga0k408_53_c1 | nmdc:mga0k408_53_c1_37251_38447 | 396 |
| 97 | 3300053122 | Ga0500608_005504 | Ga0500608_005504_1194_2390 | 396 |
| 98 | 3300053156 | Ga0500622_0000333 | Ga0500622_0000333_43776_44966 | 396 |
| 99 | 3300001991 | JGI24743J22301_10012607 | JGI24743J22301_100126071 | 397 |
| 100 | 3300002737 | JGI25162J39368_1000012 | JGI25162J39368_100001268 | 397 |
| 101 | 3300003316 | rootH1_10005394 | rootH1_1000539413 | 397 |
| 102 | 3300003320 | rootH2_10036808 | rootH2_1003680810 | 397 |
| 103 | 3300003322 | rootL2_10165306 | rootL2_101653062 | 397 |
| 104 | 3300003322 | rootL2_10212956 | rootL2_102129562 | 397 |
| 105 | 3300003323 | rootH1_10062487 | rootH1_100624872 | 397 |
| 106 | 3300003323 | rootH1_10157693 | rootH1_101576932 | 397 |
| 107 | 3300003323 | rootH1_10279903 | rootH1_102799032 | 397 |
| 108 | 3300005288 | Ga0065714_10018180 | Ga0065714_100181801 | 397 |
| 109 | 3300005327 | Ga0070658_10000113 | Ga0070658_1000011368 | 397 |
| 110 | 3300005328 | Ga0070676_10000430 | Ga0070676_1000043015 | 397 |
| 111 | 3300005329 | Ga0070683_100338598 | Ga0070683_1003385982 | 397 |
| 112 | 3300005338 | Ga0068868_100004489 | Ga0068868_1000044893 | 397 |
| 113 | 3300005338 | Ga0068868_100007397 | Ga0068868_1000073973 | 397 |
| 114 | 3300005339 | Ga0070660_100015440 | Ga0070660_1000154402 | 397 |
| 115 | 3300005355 | Ga0070671_100014322 | Ga0070671_1000143224 | 397 |
| 116 | 3300005366 | Ga0070659_100000119 | Ga0070659_10000011936 | 397 |
| 117 | 3300005366 | Ga0070659_100001920 | Ga0070659_1000019208 | 397 |
| 118 | 3300005366 | Ga0070659_100061997 | Ga0070659_1000619971 | 397 |
| 119 | 3300005456 | Ga0070678_100021914 | Ga0070678_1000219144 | 397 |
| 120 | 3300005457 | Ga0070662_100000003 | Ga0070662_100000003192 | 397 |
| 121 | 3300005459 | Ga0068867_100000725 | Ga0068867_10000072512 | 397 |
| 122 | 3300005535 | Ga0070684_100028398 | Ga0070684_1000283982 | 397 |
| 123 | 3300005539 | Ga0068853_100002099 | Ga0068853_1000020992 | 397 |
| 124 | 3300005539 | Ga0068853_100002412 | Ga0068853_1000024126 | 397 |
| 125 | 3300005548 | Ga0070665_100000012 | Ga0070665_1000000128 | 397 |
| 126 | 3300005563 | Ga0068855_100000019 | Ga0068855_100000019128 | 397 |
| 127 | 3300005563 | Ga0068855_100002739 | Ga0068855_10000273910 | 397 |
| 128 | 3300005563 | Ga0068855_100005291 | Ga0068855_10000529110 | 397 |
| 129 | 3300005563 | Ga0068855_100042148 | Ga0068855_1000421484 | 397 |
| 130 | 3300005563 | Ga0068855_100080114 | Ga0068855_1000801142 | 397 |
| 131 | 3300005578 | Ga0068854_100120797 | Ga0068854_1001207971 | 397 |
| 132 | 3300005614 | Ga0068856_100000014 | Ga0068856_100000014132 | 397 |
| 133 | 3300005614 | Ga0068856_100004414 | Ga0068856_1000044148 | 397 |
| 134 | 3300005614 | Ga0068856_100242444 | Ga0068856_1002424442 | 397 |
| 135 | 3300005616 | Ga0068852_100001570 | Ga0068852_1000015704 | 397 |
| 136 | 3300006195 | Ga0075366_10008311 | Ga0075366_100083115 | 397 |
| 137 | 3300006237 | Ga0097621_100000076 | Ga0097621_10000007636 | 397 |
| 138 | 3300006358 | Ga0068871_100000070 | Ga0068871_1000000707 | 397 |
| 139 | 3300006881 | Ga0068865_100000763 | Ga0068865_1000007636 | 397 |
| 140 | 3300009093 | Ga0105240_10000515 | Ga0105240_1000051513 | 397 |
| 141 | 3300009093 | Ga0105240_10038058 | Ga0105240_100380585 | 397 |
| 142 | 3300009174 | Ga0105241_10003983 | Ga0105241_100039835 | 397 |
| 143 | 3300009174 | Ga0105241_10018989 | Ga0105241_100189892 | 397 |
| 144 | 3300009176 | Ga0105242_10073812 | Ga0105242_100738122 | 397 |
| 145 | 3300009545 | Ga0105237_10000709 | Ga0105237_1000070915 | 397 |
| 146 | 3300009545 | Ga0105237_10000779 | Ga0105237_1000077940 | 397 |
| 147 | 3300009545 | Ga0105237_10001498 | Ga0105237_1000149815 | 397 |
| 148 | 3300009545 | Ga0105237_10002541 | Ga0105237_100025413 | 397 |
| 149 | 3300009545 | Ga0105237_10007988 | Ga0105237_100079886 | 397 |
| 150 | 3300009545 | Ga0105237_10012354 | Ga0105237_1001235410 | 397 |
| 151 | 3300009545 | Ga0105237_10012690 | Ga0105237_1001269010 | 397 |
| 152 | 3300009551 | Ga0105238_10001588 | Ga0105238_1000158811 | 397 |
| 153 | 3300009551 | Ga0105238_10127126 | Ga0105238_101271263 | 397 |
| 154 | 3300009551 | Ga0105238_10179454 | Ga0105238_101794542 | 397 |
| 155 | 3300010375 | Ga0105239_10000117 | Ga0105239_1000011770 | 397 |
| 156 | 3300010375 | Ga0105239_10001338 | Ga0105239_1000133820 | 397 |
| 157 | 3300010375 | Ga0105239_10001441 | Ga0105239_100014415 | 397 |
| 158 | 3300010375 | Ga0105239_10009681 | Ga0105239_100096815 | 397 |
| 159 | 3300010375 | Ga0105239_10148052 | Ga0105239_101480522 | 397 |
| 160 | 3300013100 | Ga0157373_10000045 | Ga0157373_1000004575 | 397 |
| 161 | 3300013102 | Ga0157371_10002765 | Ga0157371_100027659 | 397 |
| 162 | 3300013102 | Ga0157371_10034616 | Ga0157371_100346163 | 397 |
| 163 | 3300013105 | Ga0157369_10003209 | Ga0157369_100032096 | 397 |
| 164 | 3300013105 | Ga0157369_10054288 | Ga0157369_100542881 | 397 |
| 165 | 3300013296 | Ga0157374_10000147 | Ga0157374_1000014734 | 397 |
| 166 | 3300013296 | Ga0157374_10002011 | Ga0157374_1000201116 | 397 |
| 167 | 3300013296 | Ga0157374_10002735 | Ga0157374_100027355 | 397 |
| 168 | 3300013306 | Ga0163162_10000044 | Ga0163162_1000004499 | 397 |
| 169 | 3300013306 | Ga0163162_10048214 | Ga0163162_100482142 | 397 |
| 170 | 3300013307 | Ga0157372_10000015 | Ga0157372_10000015161 | 397 |
| 171 | 3300013307 | Ga0157372_10002432 | Ga0157372_1000243211 | 397 |
| 172 | 3300013307 | Ga0157372_10008737 | Ga0157372_100087375 | 397 |
| 173 | 3300013307 | Ga0157372_10173782 | Ga0157372_101737822 | 397 |
| 174 | 3300013308 | Ga0157375_10052879 | Ga0157375_100528793 | 397 |
| 175 | 3300015261 | Ga0182006_1000313 | Ga0182006_100031326 | 397 |
| 176 | 3300025233 | Ga0209437_100041 | Ga0209437_100041113 | 397 |
| 177 | 3300025250 | Ga0209026_1000507 | Ga0209026_10005076 | 397 |
| 178 | 3300025250 | Ga0209026_1001979 | Ga0209026_10019795 | 397 |
| 179 | 3300025904 | Ga0207647_10000049 | Ga0207647_100000497 | 397 |
| 180 | 3300025907 | Ga0207645_10000300 | Ga0207645_1000030032 | 397 |
| 181 | 3300025909 | Ga0207705_10000160 | Ga0207705_100001608 | 397 |
| 182 | 3300025911 | Ga0207654_10003537 | Ga0207654_100035373 | 397 |
| 183 | 3300025911 | Ga0207654_10003927 | Ga0207654_100039275 | 397 |
| 184 | 3300025913 | Ga0207695_10000267 | Ga0207695_1000026721 | 397 |
| 185 | 3300025913 | Ga0207695_10026137 | Ga0207695_100261374 | 397 |
| 186 | 3300025913 | Ga0207695_10028933 | Ga0207695_100289335 | 397 |
| 187 | 3300025913 | Ga0207695_10042219 | Ga0207695_100422194 | 397 |
| 188 | 3300025913 | Ga0207695_10206848 | Ga0207695_102068482 | 397 |
| 189 | 3300025914 | Ga0207671_10000244 | Ga0207671_1000024485 | 397 |
| 190 | 3300025914 | Ga0207671_10001051 | Ga0207671_1000105117 | 397 |
| 191 | 3300025914 | Ga0207671_10004337 | Ga0207671_100043375 | 397 |
| 192 | 3300025914 | Ga0207671_10009252 | Ga0207671_100092529 | 397 |
| 193 | 3300025919 | Ga0207657_10100717 | Ga0207657_101007172 | 397 |
| 194 | 3300025924 | Ga0207694_10010575 | Ga0207694_100105754 | 397 |
| 195 | 3300025924 | Ga0207694_10284477 | Ga0207694_102844771 | 397 |
| 196 | 3300025931 | Ga0207644_10024838 | Ga0207644_100248382 | 397 |
| 197 | 3300025932 | Ga0207690_10001206 | Ga0207690_100012069 | 397 |
| 198 | 3300025933 | Ga0207706_10000111 | Ga0207706_100001116 | 397 |
| 199 | 3300025938 | Ga0207704_10000016 | Ga0207704_1000001667 | 397 |
| 200 | 3300025944 | Ga0207661_10075502 | Ga0207661_100755021 | 397 |
| 201 | 3300025949 | Ga0207667_10000020 | Ga0207667_1000002041 | 397 |
| 202 | 3300025949 | Ga0207667_10003000 | Ga0207667_1000300010 | 397 |
| 203 | 3300025960 | Ga0207651_10009234 | Ga0207651_100092342 | 397 |
| 204 | 3300025981 | Ga0207640_10102672 | Ga0207640_101026721 | 397 |
| 205 | 3300026023 | Ga0207677_10010114 | Ga0207677_100101143 | 397 |
| 206 | 3300026023 | Ga0207677_10033257 | Ga0207677_100332572 | 397 |
| 207 | 3300026041 | Ga0207639_10001710 | Ga0207639_1000171012 | 397 |
| 208 | 3300026041 | Ga0207639_10014325 | Ga0207639_100143251 | 397 |
| 209 | 3300026078 | Ga0207702_10000036 | Ga0207702_100000365 | 397 |
| 210 | 3300026078 | Ga0207702_10026139 | Ga0207702_100261393 | 397 |
| 211 | 3300026089 | Ga0207648_10000661 | Ga0207648_1000066122 | 397 |
| 212 | 3300026121 | Ga0207683_10005303 | Ga0207683_100053031 | 397 |
| 213 | 3300026142 | Ga0207698_10008542 | Ga0207698_100085424 | 397 |
| 214 | 3300028379 | Ga0268266_10000080 | Ga0268266_100000808 | 397 |
| 215 | 3300028794 | Ga0307515_10158386 | Ga0307515_101583862 | 397 |
| 216 | 3300028800 | Ga0265338_10070972 | Ga0265338_100709722 | 397 |
| 217 | 3300031251 | Ga0265327_10012357 | Ga0265327_100123573 | 397 |
| 218 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_121715_122917 | 397 |
| 219 | 3300037312 | Ga0395899_0000050 | Ga0395899_0000050_93472_94665 | 397 |
| 220 | 3300037312 | Ga0395899_0000534 | Ga0395899_0000534_30615_31808 | 397 |
| 221 | 3300037312 | Ga0395899_0000615 | Ga0395899_0000615_20347_21540 | 397 |
| 222 | 3300037312 | Ga0395899_0013779 | Ga0395899_0013779_631_1824 | 397 |
| 223 | 3300037418 | Ga0395900_0000493 | Ga0395900_0000493_51736_52929 | 397 |
| 224 | 3300037418 | Ga0395900_0001751 | Ga0395900_0001751_20660_21853 | 397 |
| 225 | 3300037418 | Ga0395900_0005952 | Ga0395900_0005952_6324_7517 | 397 |
| 226 | 3300037466 | Ga0395898_0042542 | Ga0395898_0042542_3234_4427 | 397 |
| 227 | 3300037466 | Ga0395898_0066854 | Ga0395898_0066854_2178_3371 | 397 |
| 228 | 3300037471 | Ga0395905_0000461 | Ga0395905_0000461_52394_53587 | 397 |
| 229 | 3300037471 | Ga0395905_0002338 | Ga0395905_0002338_19051_20244 | 397 |
| 230 | 3300038443 | Ga0395901_0049355 | Ga0395901_0049355_86_1279 | 397 |
| 231 | 3300039447 | Ga0436361_0112281 | Ga0436361_0112281_935_2128 | 397 |
| 232 | 3300044684 | Ga0466966_0060854 | Ga0466966_0060854_1110_2312 | 397 |
| 233 | 3300046471 | Ga0495650_0051670 | Ga0495650_0051670_22_1215 | 397 |
| 234 | 3300046492 | Ga0495585_0000138 | Ga0495585_0000138_49289_50482 | 397 |
| 235 | 3300046507 | Ga0495606_0010350 | Ga0495606_0010350_1034_2239 | 397 |
| 236 | 3300046512 | Ga0495610_0000302 | Ga0495610_0000302_13514_14707 | 397 |
| 237 | 3300046513 | Ga0495616_0009129 | Ga0495616_0009129_586_1779 | 397 |
| 238 | 3300046513 | Ga0495616_0012774 | Ga0495616_0012774_625_1824 | 397 |
| 239 | 3300046513 | Ga0495616_0022057 | Ga0495616_0022057_1697_2920 | 397 |
| 240 | 3300046529 | Ga0495652_0115908 | Ga0495652_0115908_165_1358 | 397 |
| 241 | 3300046660 | Ga0495625_0000067 | Ga0495625_0000067_14132_15325 | 397 |
| 242 | 3300046660 | Ga0495625_0010306 | Ga0495625_0010306_4687_5883 | 397 |
| 243 | 3300046660 | Ga0495625_0010978 | Ga0495625_0010978_3030_4226 | 397 |
| 244 | 3300046694 | Ga0495649_0000054 | Ga0495649_0000054_14144_15337 | 397 |
| 245 | 3300046794 | Ga0495589_0042862 | Ga0495589_0042862_300_1493 | 397 |
| 246 | 3300047443 | Ga0495687_005648 | Ga0495687_005648_4567_5760 | 397 |
| 247 | 3300047472 | Ga0495686_0000083 | Ga0495686_0000083_18740_19933 | 397 |
| 248 | 3300047472 | Ga0495686_0002235 | Ga0495686_0002235_4219_5415 | 397 |
| 249 | 3300047472 | Ga0495686_0009256 | Ga0495686_0009256_3677_4873 | 397 |
| 250 | 3300050493 | nmdc:mga0k408_80_c1 | nmdc:mga0k408_80_c1_44055_45248 | 397 |
| 251 | 3300053125 | Ga0500618_000002 | Ga0500618_000002_12399_13598 | 397 |
| 252 | 3300053131 | Ga0500652_076675 | Ga0500652_076675_135_1328 | 397 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eay-assembly1.cif.gz_A | crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate | 0.9718 | 3 | 397 |
| 4eay-assembly1.cif.gz_A | crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate | 0.9694 | 3 | 397 |
| 3ban-assembly1.cif.gz_B | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.9204 | 3 | 394 |
| 3ban-assembly1.cif.gz_A | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.9042 | 3 | 397 |
| 1tz9-assembly1.cif.gz_B | crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 | 0.8999 | 5 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9752 | 3 | 397 | 3.20.20.150 |
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9679 | 3 | 397 | 3.20.20.150 |
| af_P24215_172_393_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9601 | 177 | 397 | 3.20.20.150 |
| af_P24215_172_393_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9517 | 177 | 397 | 3.20.20.150 |
| 3banB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9204 | 3 | 394 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X0DXS7-F1-model_v4 | Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) | 0.9915 | 1 | 395 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A4R4GZ66-F1-model_v4 | deleted | 0.9914 | 207 | 317 |
|
| AF-A0A530M004-F1-model_v4 | deleted | 0.9905 | 261 | 344 |
|
| AF-A0A7X0DXS7-F1-model_v4 | Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) | 0.989 | 1 | 395 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A7Y2DG78-F1-model_v4 | Mannonate dehydratase (EC 4.2.1.8) | 0.987 | 5 | 291 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar