F363353

General Info

Members Datasets Scaffolds Average Seq Length
252 146 504 258

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100103626|Ga0307409_1001036262
Length 276
Sequence MQRQILIIDDHDDLASSLSDAFSSEGHEVSVLENRKEALAVDNIEGFDLVITDLDVTSQPDGSAVNGKGNGCLPDITAYSEPENIKAFKVCATNFRRDQFDESELKTLVETVLNYKIRFVDRTETVQNLHENIEFELPSSMAVMHSILDYLMKRVEKLGVVKAEQSNLFVALDEAFVNAVKHGNKFDVAKLVRITADVSRTEARFTIEDEGQGFDVNSIPDPLDPQNLFKSSGRGVLFIYNIMDEVKYNERGNRLTMVKRCEQHAVHKCDVEKPLA

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
133 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
136 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
137 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
138 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
139 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
140 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
141 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
142 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 0.4
Rhizosphere 98.02
Stem 0
Stem Tuber 0
Unclassified 28.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100103626 3300031995 Unclassified 2367
2 LJQas_1000154 3300000549 Bacteria 12179
3 rootL2_10023116 3300003322 Unclassified 1979
4 Ga0065712_10089971 3300005290 Bacteria 2444
5 Ga0065715_10013965 3300005293 Bacteria 3182
6 Ga0070658_10000923 3300005327 Bacteria 25135
7 Ga0070670_100125783 3300005331 Unclassified 2212
8 Ga0070670_100126648 3300005331 Bacteria 2205
9 Ga0070670_100135616 3300005331 Bacteria 2127
10 Ga0070670_100685572 3300005331 Unclassified 921
11 Ga0070666_10209389 3300005335 Bacteria 1373
12 Ga0068868_100370279 3300005338 Bacteria 1231
13 Ga0070689_100252057 3300005340 Bacteria 1457
14 Ga0070661_100284812 3300005344 Bacteria 1283
15 Ga0070668_100033925 3300005347 Bacteria 3889
16 Ga0070668_100436171 3300005347 Bacteria 1124
17 Ga0070675_100246106 3300005354 Bacteria 1563
18 Ga0070671_100085767 3300005355 Bacteria 2634
19 Ga0070671_100125705 3300005355 Bacteria 2159
20 Ga0070671_100244183 3300005355 Bacteria 1525
21 Ga0070673_100152177 3300005364 Bacteria 1960
22 Ga0070673_100160833 3300005364 Unclassified 1910
23 Ga0070688_100117268 3300005365 Bacteria 1778
24 Ga0070688_100236990 3300005365 Bacteria 1293
25 Ga0070662_100123901 3300005457 Unclassified 1984
26 Ga0070681_10046417 3300005458 Unclassified 4343
27 Ga0070685_10057627 3300005466 Bacteria 2262
28 Ga0070698_100213645 3300005471 Bacteria 1863
29 Ga0070684_100357298 3300005535 Unclassified 1344
30 Ga0070684_100580167 3300005535 Bacteria 1042
31 Ga0068853_100005458 3300005539 Bacteria 9963
32 Ga0068853_100005614 3300005539 Bacteria 9851
33 Ga0068853_100076018 3300005539 Bacteria 2932
34 Ga0070672_100176524 3300005543 Unclassified 1779
35 Ga0070695_100128962 3300005545 Bacteria 1741
36 Ga0070693_100125113 3300005547 Bacteria 1599
37 Ga0070665_100227479 3300005548 Unclassified 1865
38 Ga0070665_100675127 3300005548 Bacteria 1046
39 Ga0070704_100033491 3300005549 Unclassified 3474
40 Ga0068855_100104964 3300005563 Unclassified 3249
41 Ga0068855_100642010 3300005563 Bacteria 1141
42 Ga0070664_100006197 3300005564 Bacteria 9662
43 Ga0068857_100247469 3300005577 Unclassified 1633
44 Ga0068857_100301036 3300005577 Unclassified 1478
45 Ga0068854_100020716 3300005578 Unclassified 4456
46 Ga0068856_100209820 3300005614 Unclassified 1963
47 Ga0070702_100092348 3300005615 Bacteria 1838
48 Ga0068852_100571441 3300005616 Unclassified 1132
49 Ga0068859_100029186 3300005617 Bacteria 5535
50 Ga0068859_100110440 3300005617 Bacteria 2811
51 Ga0068859_100173881 3300005617 Bacteria 2235
52 Ga0068859_100400472 3300005617 Bacteria 1468
53 Ga0068864_100044423 3300005618 Bacteria 3808
54 Ga0068864_100128827 3300005618 Bacteria 2271
55 Ga0068864_100934714 3300005618 Unclassified 857
56 Ga0068866_10194908 3300005718 Bacteria 1206
57 Ga0068861_100304882 3300005719 Bacteria 1381
58 Ga0068851_10032449 3300005834 Bacteria 2599
59 Ga0068851_10165764 3300005834 Bacteria 1216
60 Ga0068870_10029671 3300005840 Unclassified 2757
61 Ga0068863_100095021 3300005841 Bacteria 2829
62 Ga0068863_100209295 3300005841 Bacteria 1878
63 Ga0068863_100289184 3300005841 Bacteria 1589
64 Ga0068863_100731660 3300005841 Unclassified 984
65 Ga0068858_100117709 3300005842 Bacteria 2483
66 Ga0068860_100030159 3300005843 Bacteria 5216
67 Ga0068860_100101548 3300005843 Bacteria 2744
68 Ga0068862_100050388 3300005844 Bacteria 3558
69 Ga0068862_100089687 3300005844 Bacteria 2676
70 Ga0068862_100166329 3300005844 Bacteria 1972
71 Ga0068862_100578027 3300005844 Bacteria 1076
72 Ga0068865_100126865 3300006881 Bacteria 1906
73 Ga0097620_100029186 3300006931 Bacteria 5535
74 Ga0097620_100110440 3300006931 Bacteria 2811
75 Ga0097620_100173882 3300006931 Bacteria 2235
76 Ga0097620_100400445 3300006931 Bacteria 1468
77 Ga0105251_10088088 3300009011 Bacteria 1428
78 Ga0105250_10054363 3300009092 Bacteria 1606
79 Ga0105240_10037991 3300009093 Bacteria 6182
80 Ga0111539_10217842 3300009094 Bacteria 2223
81 Ga0111539_10226267 3300009094 Bacteria 2179
82 Ga0105245_10755561 3300009098 Bacteria 1008
83 Ga0105247_10003859 3300009101 Bacteria 9700
84 Ga0105247_10026977 3300009101 Unclassified 3472
85 Ga0105243_10018295 3300009148 Bacteria 5305
86 Ga0105241_10057856 3300009174 Unclassified 2976
87 Ga0105248_10036289 3300009177 Bacteria 5513
88 Ga0105237_10458724 3300009545 Unclassified 1280
89 Ga0105238_10091168 3300009551 Bacteria 3035
90 Ga0105249_10084920 3300009553 Bacteria 2949
91 Ga0105249_10324584 3300009553 Bacteria 1551
92 Ga0105249_10354899 3300009553 Bacteria 1486
93 Ga0105249_10412125 3300009553 Bacteria 1383
94 Ga0105239_10078608 3300010375 Bacteria 3630
95 Ga0105239_10258915 3300010375 Unclassified 1955
96 Ga0105239_10393279 3300010375 Bacteria 1568
97 Ga0157373_10020236 3300013100 Bacteria 4840
98 Ga0157373_10059641 3300013100 Bacteria 2704
99 Ga0157370_10099559 3300013104 Bacteria 2724
100 Ga0157369_10070780 3300013105 Bacteria 3746
101 Ga0157378_10493236 3300013297 Bacteria 1222
102 Ga0163162_10019451 3300013306 Bacteria 6660
103 Ga0163162_10133928 3300013306 Bacteria 2588
104 Ga0163162_10527927 3300013306 Unclassified 1309
105 Ga0163162_10530214 3300013306 Unclassified 1307
106 Ga0163162_10623430 3300013306 Bacteria 1204
107 Ga0157372_10112755 3300013307 Bacteria 3116
108 Ga0157372_10281489 3300013307 Unclassified 1933
109 Ga0157372_10820826 3300013307 Bacteria 1080
110 Ga0157375_10272753 3300013308 Unclassified 1854
111 Ga0163163_10220468 3300014325 Bacteria 1945
112 Ga0163163_10295398 3300014325 Bacteria 1672
113 Ga0163163_10384417 3300014325 Bacteria 1461
114 Ga0157380_10042724 3300014326 Bacteria 3544
115 Ga0157379_10077957 3300014968 Bacteria 2967
116 Ga0157379_10129729 3300014968 Bacteria 2269
117 Ga0157376_10621910 3300014969 Unclassified 1077
118 Ga0163161_10000258 3300017792 Bacteria 46621
119 Ga0163161_10220601 3300017792 Bacteria 1468
120 Ga0207697_10059177 3300025315 Bacteria 1592
121 Ga0207656_10041989 3300025321 Unclassified 1945
122 Ga0207642_10164016 3300025899 Bacteria 1196
123 Ga0207710_10003312 3300025900 Bacteria 7197
124 Ga0207647_10053881 3300025904 Bacteria 2476
125 Ga0207643_10052725 3300025908 Bacteria 2311
126 Ga0207643_10064518 3300025908 Bacteria 2096
127 Ga0207705_10009122 3300025909 Bacteria 7232
128 Ga0207654_10131584 3300025911 Bacteria 1584
129 Ga0207707_10005180 3300025912 Bacteria 11428
130 Ga0207695_10333213 3300025913 Bacteria 1406
131 Ga0207671_10023143 3300025914 Unclassified 4687
132 Ga0207657_10008123 3300025919 Bacteria 10701
133 Ga0207649_10064484 3300025920 Unclassified 2316
134 Ga0207649_10127916 3300025920 Bacteria 1722
135 Ga0207652_10277113 3300025921 Unclassified 1513
136 Ga0207650_10028929 3300025925 Unclassified 3978
137 Ga0207650_10061565 3300025925 Bacteria 2802
138 Ga0207650_10133225 3300025925 Unclassified 1947
139 Ga0207650_10350640 3300025925 Bacteria 1214
140 Ga0207659_10033211 3300025926 Bacteria 3549
141 Ga0207659_10157998 3300025926 Bacteria 1777
142 Ga0207644_10060971 3300025931 Bacteria 2731
143 Ga0207644_10112213 3300025931 Bacteria 2063
144 Ga0207690_10029985 3300025932 Unclassified 3464
145 Ga0207706_10015484 3300025933 Bacteria 6890
146 Ga0207686_10193177 3300025934 Bacteria 1453
147 Ga0207709_10044469 3300025935 Unclassified 2683
148 Ga0207670_10127117 3300025936 Bacteria 1861
149 Ga0207669_10467233 3300025937 Unclassified 1003
150 Ga0207704_10109956 3300025938 Bacteria 1860
151 Ga0207691_10008325 3300025940 Bacteria 9960
152 Ga0207711_10185154 3300025941 Bacteria 1895
153 Ga0207689_10127757 3300025942 Unclassified 2091
154 Ga0207661_10430697 3300025944 Unclassified 1199
155 Ga0207679_10015364 3300025945 Bacteria 5057
156 Ga0207712_10081845 3300025961 Bacteria 2352
157 Ga0207712_10103368 3300025961 Bacteria 2123
158 Ga0207712_10153666 3300025961 Bacteria 1780
159 Ga0207712_10366591 3300025961 Bacteria 1202
160 Ga0207668_10156614 3300025972 Bacteria 1770
161 Ga0207668_10446353 3300025972 Bacteria 1103
162 Ga0207658_10038794 3300025986 Bacteria 3434
163 Ga0207639_10001944 3300026041 Bacteria 13871
164 Ga0207639_10011664 3300026041 Bacteria 6107
165 Ga0207639_10584746 3300026041 Unclassified 1028
166 Ga0207702_10488108 3300026078 Unclassified 1199
167 Ga0207641_10137673 3300026088 Bacteria 2199
168 Ga0207641_10375429 3300026088 Bacteria 1360
169 Ga0207676_10132799 3300026095 Bacteria 2119
170 Ga0207674_10024004 3300026116 Bacteria 6521
171 Ga0207674_10164522 3300026116 Unclassified 2172
172 Ga0207683_10006205 3300026121 Bacteria 10242
173 Ga0207683_10063958 3300026121 Bacteria 3241
174 Ga0207698_10186213 3300026142 Bacteria 1844
175 Ga0207698_10674554 3300026142 Bacteria 1026
176 Ga0210002_1006627 3300027617 Bacteria 1747
177 Ga0268266_10189069 3300028379 Unclassified 1879
178 Ga0268265_10081489 3300028380 Bacteria 2555
179 Ga0268265_10400957 3300028380 Bacteria 1268
180 Ga0268264_10005558 3300028381 Bacteria 10680
181 Ga0268264_10071856 3300028381 Bacteria 2933
182 Ga0307408_100063606 3300031548 Unclassified 2700
183 Ga0307408_100503159 3300031548 Bacteria 1061
184 Ga0307408_100527214 3300031548 Unclassified 1038
185 Ga0307405_10065997 3300031731 Unclassified 2306
186 Ga0307405_10173209 3300031731 Unclassified 1541
187 Ga0307413_10027589 3300031824 Bacteria 3148
188 Ga0307413_10085430 3300031824 Unclassified 2037
189 Ga0307413_10095777 3300031824 Unclassified 1947
190 Ga0307413_10408153 3300031824 Bacteria 1066
191 Ga0307410_10000563 3300031852 Bacteria 15221
192 Ga0307410_10002804 3300031852 Bacteria 8543
193 Ga0307410_10004633 3300031852 Bacteria 7140
194 Ga0307410_10031310 3300031852 Bacteria 3412
195 Ga0307410_10097157 3300031852 Bacteria 2104
196 Ga0307410_10133162 3300031852 Unclassified 1829
197 Ga0307410_10269323 3300031852 Unclassified 1332
198 Ga0307410_10698125 3300031852 Unclassified 855
199 Ga0307406_10020846 3300031901 Bacteria 3868
200 Ga0307406_10039524 3300031901 Unclassified 2928
201 Ga0307406_10043043 3300031901 Bacteria 2822
202 Ga0307406_10047355 3300031901 Bacteria 2710
203 Ga0307406_10360524 3300031901 Bacteria 1139
204 Ga0307407_10008384 3300031903 Bacteria 4738
205 Ga0307407_10027155 3300031903 Bacteria 3041
206 Ga0307407_10027661 3300031903 Bacteria 3021
207 Ga0307412_10045828 3300031911 Unclassified 2861
208 Ga0307412_10169640 3300031911 Unclassified 1630
209 Ga0307409_100014006 3300031995 Bacteria 5193
210 Ga0307409_100040877 3300031995 Bacteria 3457
211 Ga0307409_100086100 3300031995 Unclassified 2556
212 Ga0307409_100356570 3300031995 Bacteria 1382
213 Ga0307416_100020986 3300032002 Bacteria 4676
214 Ga0307416_100027095 3300032002 Bacteria 4237
215 Ga0307416_100146137 3300032002 Bacteria 2159
216 Ga0307414_10010831 3300032004 Bacteria 5317
217 Ga0307414_10097281 3300032004 Unclassified 2205
218 Ga0307414_10187176 3300032004 Bacteria 1671
219 Ga0307414_10470214 3300032004 Bacteria 1107
220 Ga0307411_10023037 3300032005 Bacteria 3680
221 Ga0307411_10026489 3300032005 Bacteria 3492
222 Ga0307411_10029268 3300032005 Unclassified 3360
223 Ga0307411_10186112 3300032005 Bacteria 1581
224 Ga0307415_100006550 3300032126 Bacteria 6295
225 Ga0307415_100018514 3300032126 Bacteria 4208
226 Ga0307415_100033117 3300032126 Bacteria 3352
227 Ga0307415_100113315 3300032126 Unclassified 2016
228 Ga0307415_100313874 3300032126 Bacteria 1304
229 Ga0307415_100588444 3300032126 Unclassified 988
230 Ga0373943_0139296 3300035170 Bacteria 1306
231 Ga0451853_1960454 3300041512 Unclassified 908
232 Ga0495621_0076327 3300046539 Bacteria 1243
233 Ga0495668_0002625 3300046616 Bacteria 14465
234 Ga0496113_0238188 3300048916 Unclassified 1452
235 Ga0501072_0021216 3300049588 Bacteria 5038
236 Ga0501202_009418 3300049652 Unclassified 1795
237 Ga0501223_016693 3300049663 Bacteria 1451
238 Ga0501235_025784 3300049669 Bacteria 1315
239 Ga0501235_041754 3300049669 Unclassified 1050
240 Ga0501239_011988 3300049672 Unclassified 975
241 Ga0501247_000370 3300049677 Bacteria 3417
242 Ga0501250_000667 3300049680 Bacteria 2463
243 Ga0501259_004856 3300049688 Unclassified 2130
244 Ga0501263_000704 3300049760 Unclassified 2748
245 Ga0501263_007966 3300049760 Unclassified 1255
246 Ga0501267_001392 3300049764 Unclassified 2067
247 Ga0501268_000117 3300049765 Bacteria 6661
248 Ga0501273_008187 3300049770 Unclassified 1247
249 nmdc:mga08y16_127213_c1 3300050511 Bacteria 2650
250 Ga0495601_0101451 3300053077 Bacteria 1859
251 Ga0500568_0084355 3300053139 Bacteria 1203
252 Ga0500577_0001300 3300053142 Bacteria 6380
253 Ga0307409_100103626
254 LJQas_1000154
255 rootL2_10023116
256 Ga0065712_10089971
257 Ga0065715_10013965
258 Ga0070658_10000923
259 Ga0070670_100125783
260 Ga0070670_100126648
261 Ga0070670_100135616
262 Ga0070670_100685572
263 Ga0070666_10209389
264 Ga0068868_100370279
265 Ga0070689_100252057
266 Ga0070661_100284812
267 Ga0070668_100033925
268 Ga0070668_100436171
269 Ga0070675_100246106
270 Ga0070671_100085767
271 Ga0070671_100125705
272 Ga0070671_100244183
273 Ga0070673_100152177
274 Ga0070673_100160833
275 Ga0070688_100117268
276 Ga0070688_100236990
277 Ga0070662_100123901
278 Ga0070681_10046417
279 Ga0070685_10057627
280 Ga0070698_100213645
281 Ga0070684_100357298
282 Ga0070684_100580167
283 Ga0068853_100005458
284 Ga0068853_100005614
285 Ga0068853_100076018
286 Ga0070672_100176524
287 Ga0070695_100128962
288 Ga0070693_100125113
289 Ga0070665_100227479
290 Ga0070665_100675127
291 Ga0070704_100033491
292 Ga0068855_100104964
293 Ga0068855_100642010
294 Ga0070664_100006197
295 Ga0068857_100247469
296 Ga0068857_100301036
297 Ga0068854_100020716
298 Ga0068856_100209820
299 Ga0070702_100092348
300 Ga0068852_100571441
301 Ga0068859_100029186
302 Ga0068859_100110440
303 Ga0068859_100173881
304 Ga0068859_100400472
305 Ga0068864_100044423
306 Ga0068864_100128827
307 Ga0068864_100934714
308 Ga0068866_10194908
309 Ga0068861_100304882
310 Ga0068851_10032449
311 Ga0068851_10165764
312 Ga0068870_10029671
313 Ga0068863_100095021
314 Ga0068863_100209295
315 Ga0068863_100289184
316 Ga0068863_100731660
317 Ga0068858_100117709
318 Ga0068860_100030159
319 Ga0068860_100101548
320 Ga0068862_100050388
321 Ga0068862_100089687
322 Ga0068862_100166329
323 Ga0068862_100578027
324 Ga0068865_100126865
325 Ga0097620_100029186
326 Ga0097620_100110440
327 Ga0097620_100173882
328 Ga0097620_100400445
329 Ga0105251_10088088
330 Ga0105250_10054363
331 Ga0105240_10037991
332 Ga0111539_10217842
333 Ga0111539_10226267
334 Ga0105245_10755561
335 Ga0105247_10003859
336 Ga0105247_10026977
337 Ga0105243_10018295
338 Ga0105241_10057856
339 Ga0105248_10036289
340 Ga0105237_10458724
341 Ga0105238_10091168
342 Ga0105249_10084920
343 Ga0105249_10324584
344 Ga0105249_10354899
345 Ga0105249_10412125
346 Ga0105239_10078608
347 Ga0105239_10258915
348 Ga0105239_10393279
349 Ga0157373_10020236
350 Ga0157373_10059641
351 Ga0157370_10099559
352 Ga0157369_10070780
353 Ga0157378_10493236
354 Ga0163162_10019451
355 Ga0163162_10133928
356 Ga0163162_10527927
357 Ga0163162_10530214
358 Ga0163162_10623430
359 Ga0157372_10112755
360 Ga0157372_10281489
361 Ga0157372_10820826
362 Ga0157375_10272753
363 Ga0163163_10220468
364 Ga0163163_10295398
365 Ga0163163_10384417
366 Ga0157380_10042724
367 Ga0157379_10077957
368 Ga0157379_10129729
369 Ga0157376_10621910
370 Ga0163161_10000258
371 Ga0163161_10220601
372 Ga0207697_10059177
373 Ga0207656_10041989
374 Ga0207642_10164016
375 Ga0207710_10003312
376 Ga0207647_10053881
377 Ga0207643_10052725
378 Ga0207643_10064518
379 Ga0207705_10009122
380 Ga0207654_10131584
381 Ga0207707_10005180
382 Ga0207695_10333213
383 Ga0207671_10023143
384 Ga0207657_10008123
385 Ga0207649_10064484
386 Ga0207649_10127916
387 Ga0207652_10277113
388 Ga0207650_10028929
389 Ga0207650_10061565
390 Ga0207650_10133225
391 Ga0207650_10350640
392 Ga0207659_10033211
393 Ga0207659_10157998
394 Ga0207644_10060971
395 Ga0207644_10112213
396 Ga0207690_10029985
397 Ga0207706_10015484
398 Ga0207686_10193177
399 Ga0207709_10044469
400 Ga0207670_10127117
401 Ga0207669_10467233
402 Ga0207704_10109956
403 Ga0207691_10008325
404 Ga0207711_10185154
405 Ga0207689_10127757
406 Ga0207661_10430697
407 Ga0207679_10015364
408 Ga0207712_10081845
409 Ga0207712_10103368
410 Ga0207712_10153666
411 Ga0207712_10366591
412 Ga0207668_10156614
413 Ga0207668_10446353
414 Ga0207658_10038794
415 Ga0207639_10001944
416 Ga0207639_10011664
417 Ga0207639_10584746
418 Ga0207702_10488108
419 Ga0207641_10137673
420 Ga0207641_10375429
421 Ga0207676_10132799
422 Ga0207674_10024004
423 Ga0207674_10164522
424 Ga0207683_10006205
425 Ga0207683_10063958
426 Ga0207698_10186213
427 Ga0207698_10674554
428 Ga0210002_1006627
429 Ga0268266_10189069
430 Ga0268265_10081489
431 Ga0268265_10400957
432 Ga0268264_10005558
433 Ga0268264_10071856
434 Ga0307408_100063606
435 Ga0307408_100503159
436 Ga0307408_100527214
437 Ga0307405_10065997
438 Ga0307405_10173209
439 Ga0307413_10027589
440 Ga0307413_10085430
441 Ga0307413_10095777
442 Ga0307413_10408153
443 Ga0307410_10000563
444 Ga0307410_10002804
445 Ga0307410_10004633
446 Ga0307410_10031310
447 Ga0307410_10097157
448 Ga0307410_10133162
449 Ga0307410_10269323
450 Ga0307410_10698125
451 Ga0307406_10020846
452 Ga0307406_10039524
453 Ga0307406_10043043
454 Ga0307406_10047355
455 Ga0307406_10360524
456 Ga0307407_10008384
457 Ga0307407_10027155
458 Ga0307407_10027661
459 Ga0307412_10045828
460 Ga0307412_10169640
461 Ga0307409_100014006
462 Ga0307409_100040877
463 Ga0307409_100086100
464 Ga0307409_100356570
465 Ga0307416_100020986
466 Ga0307416_100027095
467 Ga0307416_100146137
468 Ga0307414_10010831
469 Ga0307414_10097281
470 Ga0307414_10187176
471 Ga0307414_10470214
472 Ga0307411_10023037
473 Ga0307411_10026489
474 Ga0307411_10029268
475 Ga0307411_10186112
476 Ga0307415_100006550
477 Ga0307415_100018514
478 Ga0307415_100033117
479 Ga0307415_100113315
480 Ga0307415_100313874
481 Ga0307415_100588444
482 Ga0373943_0139296
483 Ga0451853_1960454
484 Ga0495621_0076327
485 Ga0495668_0002625
486 Ga0496113_0238188
487 Ga0501072_0021216
488 Ga0501202_009418
489 Ga0501223_016693
490 Ga0501235_025784
491 Ga0501235_041754
492 Ga0501239_011988
493 Ga0501247_000370
494 Ga0501250_000667
495 Ga0501259_004856
496 Ga0501263_000704
497 Ga0501263_007966
498 Ga0501267_001392
499 Ga0501268_000117
500 Ga0501273_008187
501 nmdc:mga08y16_127213_c1
502 Ga0495601_0101451
503 Ga0500568_0084355
504 Ga0500577_0001300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

137

259

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8881 113 243
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8837 113 243
3dgf-assembly1.cif.gz_C structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism 0.8785 2 40
2iyn-assembly3.cif.gz_C the co-factor-induced pre-active conformation in phob 0.8778 3 40
6m36-assembly2.cif.gz_M the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8763 113 241
ID Description Score Start End Superfamily
af_Q2G2G2_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9054 2 50 3.40.50.2300
af_Q9M9B9_30_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8821 2 52 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8815 2 50 3.40.50.2300
af_A0A0P0W8Y3_12_90_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8782 4 56 3.40.50.2300
2iynC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8778 3 40 3.40.50.2300
ID Description Score Start End GO Terms
AF-G2LEA6-F1-model_v4 Anti-sigma regulatory factor (Ser/Thr protein kinase) 0.9522 111 243 GO:0004674
AF-A0A2V2R6J5-F1-model_v4 Response regulatory domain-containing protein 0.9512 1 243 GO:0000160
GO:0004674
AF-A0A2E6AE52-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9481 149 241 GO:0004674
AF-A0A7V9NNM6-F1-model_v4 ATP-binding protein 0.9419 1 201 GO:0000160
GO:0005524
AF-A0A3M2D5F7-F1-model_v4 Response regulator 0.9407 1 243 GO:0004674

Map