F363079
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 169 | 251 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100000023|Ga0068853_10000002360 |
| Length | 248 |
| Sequence | MPQIFSRGANLVPAQIIAILAILGAAATGTVWYYFTPKYTKVGYMPPQPIPFSHKIHAGQLGLDCRYCHSFVETAAHSNIPAAQVCMNCHSQVQKDNPKLEPLRQAWATGQPIPWVQIHKTPDYAYFNHSVHVNRGVSCVSCHGRIDQMEVVYQEKPLSMKWCLECHRAPENALRPLDKVTDLAWTPPTNGGELAALLKAEMGPGPGQLNVKADSKLKPDEAQLLMGNFLKSRRDIHAPDANCAGCHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 76 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 77 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 78 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 131 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 132 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 133 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 134 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 161 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 162 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 163 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 164 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 168 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 169 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.4 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.14 |
| Nodule | 0 |
| Rhizoplane | 3.97 |
| Rhizosphere | 85.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1006772 | 3300001977 | Unclassified | 1767 |
| 2 | rootH2_10006455 | 3300003320 | Bacteria | 8937 |
| 3 | rootH2_10010635 | 3300003320 | Bacteria | 4511 |
| 4 | Ga0058863_10039178 | 3300004799 | Bacteria | 1188 |
| 5 | Ga0065704_10006576 | 3300005289 | Bacteria | 4800 |
| 6 | Ga0065712_10097557 | 3300005290 | Unclassified | 2147 |
| 7 | Ga0065715_10134319 | 3300005293 | Unclassified | 1957 |
| 8 | Ga0070676_10019063 | 3300005328 | Bacteria | 3812 |
| 9 | Ga0070676_10114033 | 3300005328 | Bacteria | 1687 |
| 10 | Ga0070683_100279645 | 3300005329 | Bacteria | 1587 |
| 11 | Ga0070670_100069101 | 3300005331 | Bacteria | 3032 |
| 12 | Ga0070670_100134199 | 3300005331 | Unclassified | 2139 |
| 13 | Ga0070666_10014891 | 3300005335 | Bacteria | 4955 |
| 14 | Ga0070666_10017556 | 3300005335 | Bacteria | 4588 |
| 15 | Ga0070666_10252734 | 3300005335 | Unclassified | 1248 |
| 16 | Ga0070660_100039791 | 3300005339 | Unclassified | 3574 |
| 17 | Ga0070689_100098298 | 3300005340 | Bacteria | 2315 |
| 18 | Ga0070689_100192286 | 3300005340 | Unclassified | 1662 |
| 19 | Ga0070689_100292650 | 3300005340 | Bacteria | 1353 |
| 20 | Ga0070668_100147399 | 3300005347 | Bacteria | 1900 |
| 21 | Ga0070669_100077348 | 3300005353 | Bacteria | 2471 |
| 22 | Ga0070669_100176796 | 3300005353 | Bacteria | 1668 |
| 23 | Ga0070675_100034722 | 3300005354 | Bacteria | 4094 |
| 24 | Ga0070671_100014377 | 3300005355 | Bacteria | 6394 |
| 25 | Ga0070671_100087243 | 3300005355 | Bacteria | 2611 |
| 26 | Ga0070673_100003375 | 3300005364 | Bacteria | 9938 |
| 27 | Ga0070673_100291014 | 3300005364 | Unclassified | 1435 |
| 28 | Ga0070688_100006902 | 3300005365 | Bacteria | 6095 |
| 29 | Ga0070667_100069996 | 3300005367 | Bacteria | 2986 |
| 30 | Ga0070667_100085147 | 3300005367 | Bacteria | 2711 |
| 31 | Ga0070667_100257844 | 3300005367 | Bacteria | 1560 |
| 32 | Ga0070713_100053022 | 3300005436 | Unclassified | 3360 |
| 33 | Ga0070713_100329996 | 3300005436 | Bacteria | 1411 |
| 34 | Ga0070710_10108634 | 3300005437 | Unclassified | 1663 |
| 35 | Ga0070710_10440963 | 3300005437 | Unclassified | 881 |
| 36 | Ga0070711_100052251 | 3300005439 | Unclassified | 2811 |
| 37 | Ga0070700_100186558 | 3300005441 | Bacteria | 1447 |
| 38 | Ga0070708_100265551 | 3300005445 | Bacteria | 1614 |
| 39 | Ga0070678_100016486 | 3300005456 | Bacteria | 4729 |
| 40 | Ga0070678_100037278 | 3300005456 | Bacteria | 3412 |
| 41 | Ga0070662_100218143 | 3300005457 | Bacteria | 1521 |
| 42 | Ga0070681_10020478 | 3300005458 | Bacteria | 6629 |
| 43 | Ga0070706_100000462 | 3300005467 | Bacteria | 48224 |
| 44 | Ga0070706_100318328 | 3300005467 | Unclassified | 1451 |
| 45 | Ga0070679_100092446 | 3300005530 | Bacteria | 3013 |
| 46 | Ga0070679_100268681 | 3300005530 | Bacteria | 1660 |
| 47 | Ga0070684_100385362 | 3300005535 | Unclassified | 1291 |
| 48 | Ga0070697_100466172 | 3300005536 | Unclassified | 1101 |
| 49 | Ga0070697_100776256 | 3300005536 | Unclassified | 847 |
| 50 | Ga0068853_100000023 | 3300005539 | Bacteria | 142301 |
| 51 | Ga0070672_100010960 | 3300005543 | Bacteria | 6308 |
| 52 | Ga0070672_100015039 | 3300005543 | Bacteria | 5499 |
| 53 | Ga0070686_100531471 | 3300005544 | Bacteria | 917 |
| 54 | Ga0070665_100000835 | 3300005548 | Bacteria | 40254 |
| 55 | Ga0070665_100005247 | 3300005548 | Bacteria | 13398 |
| 56 | Ga0070704_100185178 | 3300005549 | Bacteria | 1669 |
| 57 | Ga0070704_100800564 | 3300005549 | Bacteria | 842 |
| 58 | Ga0068855_100003868 | 3300005563 | Bacteria | 18297 |
| 59 | Ga0068855_100178226 | 3300005563 | Unclassified | 2403 |
| 60 | Ga0070664_100104120 | 3300005564 | Unclassified | 2471 |
| 61 | Ga0070664_100270117 | 3300005564 | Bacteria | 1532 |
| 62 | Ga0068854_100267582 | 3300005578 | Unclassified | 1371 |
| 63 | Ga0068856_100557718 | 3300005614 | Bacteria | 1167 |
| 64 | Ga0068852_100014571 | 3300005616 | Bacteria | 6059 |
| 65 | Ga0068859_100499034 | 3300005617 | Bacteria | 1312 |
| 66 | Ga0068864_100443821 | 3300005618 | Bacteria | 1240 |
| 67 | Ga0068863_100005618 | 3300005841 | Bacteria | 12324 |
| 68 | Ga0068858_100270433 | 3300005842 | Bacteria | 1617 |
| 69 | Ga0068860_100002812 | 3300005843 | Bacteria | 18095 |
| 70 | Ga0068860_100328945 | 3300005843 | Bacteria | 1501 |
| 71 | Ga0081539_10002666 | 3300005985 | Bacteria | 24293 |
| 72 | Ga0075363_100031446 | 3300006048 | Bacteria | 2752 |
| 73 | Ga0075362_10015312 | 3300006177 | Bacteria | 3116 |
| 74 | Ga0075362_10040905 | 3300006177 | Bacteria | 2042 |
| 75 | Ga0075366_10025872 | 3300006195 | Bacteria | 3433 |
| 76 | Ga0075366_10033468 | 3300006195 | Bacteria | 3028 |
| 77 | Ga0075366_10042554 | 3300006195 | Bacteria | 2689 |
| 78 | Ga0097621_100410280 | 3300006237 | Bacteria | 1214 |
| 79 | Ga0097621_100721921 | 3300006237 | Bacteria | 919 |
| 80 | Ga0075370_10006280 | 3300006353 | Bacteria | 5967 |
| 81 | Ga0068871_100132196 | 3300006358 | Unclassified | 2117 |
| 82 | Ga0075428_100000173 | 3300006844 | Bacteria | 59939 |
| 83 | Ga0075428_100182941 | 3300006844 | Unclassified | 2268 |
| 84 | Ga0075428_100265427 | 3300006844 | Unclassified | 1848 |
| 85 | Ga0075434_100343804 | 3300006871 | Bacteria | 1513 |
| 86 | Ga0075429_100297407 | 3300006880 | Bacteria | 1413 |
| 87 | Ga0097620_100499027 | 3300006931 | Bacteria | 1312 |
| 88 | Ga0105240_10000041 | 3300009093 | Bacteria | 264078 |
| 89 | Ga0105240_10014707 | 3300009093 | Bacteria | 10675 |
| 90 | Ga0105240_10024943 | 3300009093 | Bacteria | 7871 |
| 91 | Ga0105240_10047491 | 3300009093 | Bacteria | 5432 |
| 92 | Ga0111539_10031452 | 3300009094 | Bacteria | 6446 |
| 93 | Ga0111539_10166479 | 3300009094 | Bacteria | 2577 |
| 94 | Ga0105247_10163892 | 3300009101 | Unclassified | 1474 |
| 95 | Ga0105248_10040439 | 3300009177 | Bacteria | 5226 |
| 96 | Ga0105237_10536816 | 3300009545 | Unclassified | 1176 |
| 97 | Ga0105239_10672917 | 3300010375 | Bacteria | 1183 |
| 98 | Ga0157371_10439628 | 3300013102 | Bacteria | 958 |
| 99 | Ga0157370_10131293 | 3300013104 | Bacteria | 2336 |
| 100 | Ga0157370_10398809 | 3300013104 | Bacteria | 1266 |
| 101 | Ga0157374_10075175 | 3300013296 | Bacteria | 3192 |
| 102 | Ga0157374_10081609 | 3300013296 | Bacteria | 3069 |
| 103 | Ga0157374_10481883 | 3300013296 | Unclassified | 1244 |
| 104 | Ga0157374_11085942 | 3300013296 | Unclassified | 820 |
| 105 | Ga0157374_11233374 | 3300013296 | Bacteria | 769 |
| 106 | Ga0157378_10028126 | 3300013297 | Bacteria | 4958 |
| 107 | Ga0157378_10047435 | 3300013297 | Bacteria | 3820 |
| 108 | Ga0163162_10326474 | 3300013306 | Unclassified | 1667 |
| 109 | Ga0163162_10610141 | 3300013306 | Unclassified | 1217 |
| 110 | Ga0157372_10380707 | 3300013307 | Unclassified | 1644 |
| 111 | Ga0157375_10000025 | 3300013308 | Bacteria | 224384 |
| 112 | Ga0157375_10006688 | 3300013308 | Bacteria | 10038 |
| 113 | Ga0163163_10023565 | 3300014325 | Bacteria | 5844 |
| 114 | Ga0157380_11075682 | 3300014326 | Bacteria | 842 |
| 115 | Ga0157376_10033165 | 3300014969 | Bacteria | 4154 |
| 116 | Ga0157376_10891931 | 3300014969 | Bacteria | 907 |
| 117 | Ga0213872_10001819 | 3300021361 | Bacteria | 13252 |
| 118 | Ga0213876_10000668 | 3300021384 | Bacteria | 24442 |
| 119 | Ga0213876_10132499 | 3300021384 | Unclassified | 1325 |
| 120 | Ga0213871_10018117 | 3300021441 | Bacteria | 1719 |
| 121 | Ga0207673_1008122 | 3300025290 | Bacteria | 1325 |
| 122 | Ga0207697_10005825 | 3300025315 | Bacteria | 5667 |
| 123 | Ga0207682_10022050 | 3300025893 | Bacteria | 2507 |
| 124 | Ga0207692_10405642 | 3300025898 | Unclassified | 851 |
| 125 | Ga0207688_10010515 | 3300025901 | Bacteria | 5033 |
| 126 | Ga0207680_10307303 | 3300025903 | Unclassified | 1106 |
| 127 | Ga0207645_10011654 | 3300025907 | Bacteria | 5995 |
| 128 | Ga0207705_10032986 | 3300025909 | Unclassified | 3701 |
| 129 | Ga0207707_10389374 | 3300025912 | Bacteria | 1197 |
| 130 | Ga0207707_10506231 | 3300025912 | Bacteria | 1029 |
| 131 | Ga0207695_10000093 | 3300025913 | Bacteria | 270427 |
| 132 | Ga0207695_10005293 | 3300025913 | Bacteria | 17198 |
| 133 | Ga0207663_10297381 | 3300025916 | Unclassified | 1205 |
| 134 | Ga0207662_10147607 | 3300025918 | Bacteria | 1494 |
| 135 | Ga0207657_10036230 | 3300025919 | Bacteria | 4417 |
| 136 | Ga0207657_10254713 | 3300025919 | Unclassified | 1398 |
| 137 | Ga0207649_10142440 | 3300025920 | Bacteria | 1642 |
| 138 | Ga0207652_10121336 | 3300025921 | Bacteria | 2326 |
| 139 | Ga0207681_10026042 | 3300025923 | Bacteria | 3769 |
| 140 | Ga0207681_10170656 | 3300025923 | Bacteria | 1648 |
| 141 | Ga0207681_10338546 | 3300025923 | Unclassified | 1201 |
| 142 | Ga0207650_10192881 | 3300025925 | Bacteria | 1628 |
| 143 | Ga0207650_10193359 | 3300025925 | Bacteria | 1626 |
| 144 | Ga0207650_10476469 | 3300025925 | Bacteria | 1041 |
| 145 | Ga0207659_10105831 | 3300025926 | Bacteria | 2129 |
| 146 | Ga0207659_10107177 | 3300025926 | Bacteria | 2117 |
| 147 | Ga0207690_10365596 | 3300025932 | Bacteria | 1143 |
| 148 | Ga0207706_10049546 | 3300025933 | Bacteria | 3712 |
| 149 | Ga0207670_10384306 | 3300025936 | Bacteria | 1119 |
| 150 | Ga0207670_10640850 | 3300025936 | Unclassified | 875 |
| 151 | Ga0207665_10205430 | 3300025939 | Bacteria | 1437 |
| 152 | Ga0207691_10001056 | 3300025940 | Bacteria | 27359 |
| 153 | Ga0207691_10025833 | 3300025940 | Bacteria | 5512 |
| 154 | Ga0207661_10610360 | 3300025944 | Bacteria | 1002 |
| 155 | Ga0207667_10000965 | 3300025949 | Bacteria | 36640 |
| 156 | Ga0207667_10111538 | 3300025949 | Unclassified | 2821 |
| 157 | Ga0207651_10088227 | 3300025960 | Bacteria | 2260 |
| 158 | Ga0207651_10140716 | 3300025960 | Unclassified | 1863 |
| 159 | Ga0207668_10440699 | 3300025972 | Bacteria | 1109 |
| 160 | Ga0207658_10065366 | 3300025986 | Bacteria | 2731 |
| 161 | Ga0207658_10290904 | 3300025986 | Bacteria | 1404 |
| 162 | Ga0207703_10538683 | 3300026035 | Bacteria | 1100 |
| 163 | Ga0207639_10000040 | 3300026041 | Bacteria | 142397 |
| 164 | Ga0207708_10357115 | 3300026075 | Bacteria | 1200 |
| 165 | Ga0207702_10193507 | 3300026078 | Bacteria | 1881 |
| 166 | Ga0207702_10773210 | 3300026078 | Unclassified | 949 |
| 167 | Ga0207641_10001699 | 3300026088 | Bacteria | 21417 |
| 168 | Ga0207641_10168150 | 3300026088 | Bacteria | 1999 |
| 169 | Ga0207648_10106980 | 3300026089 | Bacteria | 2455 |
| 170 | Ga0207683_10013215 | 3300026121 | Bacteria | 7041 |
| 171 | Ga0207698_10092005 | 3300026142 | Bacteria | 2485 |
| 172 | Ga0268266_10000035 | 3300028379 | Bacteria | 351632 |
| 173 | Ga0268266_10001518 | 3300028379 | Bacteria | 27210 |
| 174 | Ga0268265_10089044 | 3300028380 | Bacteria | 2461 |
| 175 | Ga0268264_10000659 | 3300028381 | Bacteria | 40567 |
| 176 | Ga0268264_10441009 | 3300028381 | Bacteria | 1260 |
| 177 | Ga0265334_10000520 | 3300028573 | Bacteria | 19733 |
| 178 | Ga0265323_10000084 | 3300028653 | Bacteria | 53536 |
| 179 | Ga0265323_10028771 | 3300028653 | Bacteria | 2082 |
| 180 | Ga0265323_10049323 | 3300028653 | Bacteria | 1498 |
| 181 | Ga0265323_10066943 | 3300028653 | Unclassified | 1236 |
| 182 | Ga0265322_10001185 | 3300028654 | Bacteria | 8934 |
| 183 | Ga0265322_10006380 | 3300028654 | Bacteria | 3469 |
| 184 | Ga0265338_10025145 | 3300028800 | Bacteria | 6055 |
| 185 | Ga0265338_10035956 | 3300028800 | Unclassified | 4750 |
| 186 | Ga0265330_10003711 | 3300031235 | Bacteria | 7907 |
| 187 | Ga0265339_10198774 | 3300031249 | Bacteria | 990 |
| 188 | Ga0265316_10024706 | 3300031344 | Bacteria | 5026 |
| 189 | Ga0265316_10102036 | 3300031344 | Bacteria | 2179 |
| 190 | Ga0265316_10144247 | 3300031344 | Bacteria | 1786 |
| 191 | Ga0265342_10012725 | 3300031712 | Bacteria | 5685 |
| 192 | Ga0373954_0006779 | 3300035118 | Bacteria | 4998 |
| 193 | Ga0373935_0185832 | 3300035692 | Bacteria | 1429 |
| 194 | Ga0373935_0271940 | 3300035692 | Bacteria | 1191 |
| 195 | Ga0373925_0405047 | 3300037068 | Bacteria | 1113 |
| 196 | Ga0395905_0072657 | 3300037471 | Unclassified | 3225 |
| 197 | Ga0395905_0445005 | 3300037471 | Unclassified | 1193 |
| 198 | Ga0436365_1432120 | 3300039437 | Bacteria | 33957 |
| 199 | Ga0436360_0627618 | 3300039438 | Bacteria | 2305 |
| 200 | Ga0436360_1060084 | 3300039438 | Unclassified | 974 |
| 201 | Ga0451851_0578862 | 3300041507 | Bacteria | 1052 |
| 202 | Ga0451853_1437256 | 3300041512 | Bacteria | 823 |
| 203 | Ga0439446_0028439 | 3300042156 | Bacteria | 1609 |
| 204 | Ga0453683_0001303 | 3300044673 | Bacteria | 21995 |
| 205 | Ga0453683_0014308 | 3300044673 | Bacteria | 5154 |
| 206 | Ga0453684_0311193 | 3300044712 | Bacteria | 1787 |
| 207 | Ga0453684_0812056 | 3300044712 | Bacteria | 1008 |
| 208 | Ga0451576_0000183 | 3300045051 | Bacteria | 157422 |
| 209 | Ga0451576_0025626 | 3300045051 | Bacteria | 6353 |
| 210 | Ga0451576_0028687 | 3300045051 | Bacteria | 5959 |
| 211 | Ga0451576_0086248 | 3300045051 | Bacteria | 3265 |
| 212 | Ga0495592_0078785 | 3300046454 | Unclassified | 2386 |
| 213 | Ga0495651_0025382 | 3300046462 | Bacteria | 4613 |
| 214 | Ga0495653_0240218 | 3300046463 | Bacteria | 1208 |
| 215 | Ga0495628_0048607 | 3300046516 | Bacteria | 3362 |
| 216 | Ga0495643_0002851 | 3300046522 | Bacteria | 13148 |
| 217 | Ga0495652_0138648 | 3300046529 | Bacteria | 1915 |
| 218 | Ga0495658_0101412 | 3300046683 | Unclassified | 1719 |
| 219 | Ga0495613_0299377 | 3300046689 | Bacteria | 1114 |
| 220 | Ga0496100_0168321 | 3300048903 | Bacteria | 1576 |
| 221 | Ga0496101_0179891 | 3300048904 | Bacteria | 1628 |
| 222 | Ga0496102_0959116 | 3300048905 | Unclassified | 776 |
| 223 | Ga0496104_0039899 | 3300048907 | Bacteria | 4398 |
| 224 | Ga0496106_1162475 | 3300048909 | Unclassified | 603 |
| 225 | Ga0496109_0402769 | 3300048912 | Unclassified | 1293 |
| 226 | Ga0496109_0512535 | 3300048912 | Bacteria | 1132 |
| 227 | Ga0496112_0210257 | 3300048915 | Bacteria | 1903 |
| 228 | Ga0496114_0052266 | 3300048917 | Bacteria | 3404 |
| 229 | Ga0496115_0009779 | 3300048918 | Bacteria | 7142 |
| 230 | Ga0495682_0056328 | 3300049460 | Bacteria | 1425 |
| 231 | Ga0501033_0019056 | 3300049570 | Bacteria | 5188 |
| 232 | Ga0501047_0710884 | 3300049581 | Bacteria | 822 |
| 233 | Ga0501080_1020960 | 3300049742 | Bacteria | 717 |
| 234 | Ga0501035_0218953 | 3300049822 | Bacteria | 1626 |
| 235 | Ga0501044_0039962 | 3300049823 | Bacteria | 4891 |
| 236 | nmdc:mga03683_204_c1 | 3300050489 | Bacteria | 19575 |
| 237 | nmdc:mga03n38_345339_c1 | 3300050490 | Unclassified | 809 |
| 238 | nmdc:mga0k408_145279_c1 | 3300050493 | Bacteria | 1412 |
| 239 | nmdc:mga0k408_349735_c1 | 3300050493 | Bacteria | 881 |
| 240 | nmdc:mga0k408_4469_c1 | 3300050493 | Bacteria | 7421 |
| 241 | nmdc:mga0k408_51231_c1 | 3300050493 | Unclassified | 2391 |
| 242 | nmdc:mga0k408_9540_c1 | 3300050493 | Bacteria | 5236 |
| 243 | nmdc:mga07m45_3324_c2 | 3300050496 | Bacteria | 5875 |
| 244 | nmdc:mga09592_146595_c1 | 3300050508 | Bacteria | 2035 |
| 245 | nmdc:mga09592_412226_c1 | 3300050508 | Bacteria | 1167 |
| 246 | nmdc:mga09592_465452_c1 | 3300050508 | Bacteria | 1090 |
| 247 | nmdc:mga0n895_334491_c1 | 3300050512 | Bacteria | 1534 |
| 248 | Ga0495619_0020426 | 3300053085 | Bacteria | 4218 |
| 249 | Ga0500588_0067137 | 3300053146 | Bacteria | 1166 |
| 250 | Ga0500616_0015205 | 3300053153 | Unclassified | 4405 |
| 251 | Ga0500622_0012478 | 3300053156 | Bacteria | 4599 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050490 | nmdc:mga03n38_345339_c1 | nmdc:mga03n38_345339_c1_243_779 | 167 |
| 2 | 3300048909 | Ga0496106_1162475 | Ga0496106_1162475_36_542 | 168 |
| 3 | 3300005535 | Ga0070684_100385362 | Ga0070684_1003853622 | 196 |
| 4 | 3300005617 | Ga0068859_100499034 | Ga0068859_1004990341 | 196 |
| 5 | 3300006931 | Ga0097620_100499027 | Ga0097620_1004990272 | 196 |
| 6 | 3300006844 | Ga0075428_100000173 | Ga0075428_10000017336 | 200 |
| 7 | 3300009545 | Ga0105237_10536816 | Ga0105237_105368162 | 201 |
| 8 | 3300005289 | Ga0065704_10006576 | Ga0065704_100065764 | 202 |
| 9 | 3300044712 | Ga0453684_0812056 | Ga0453684_0812056_321_974 | 202 |
| 10 | 3300045051 | Ga0451576_0000183 | Ga0451576_0000183_88231_88884 | 202 |
| 11 | 3300004799 | Ga0058863_10039178 | Ga0058863_100391781 | 203 |
| 12 | 3300005340 | Ga0070689_100192286 | Ga0070689_1001922862 | 203 |
| 13 | 3300005458 | Ga0070681_10020478 | Ga0070681_100204782 | 203 |
| 14 | 3300005563 | Ga0068855_100178226 | Ga0068855_1001782262 | 203 |
| 15 | 3300013104 | Ga0157370_10131293 | Ga0157370_101312932 | 203 |
| 16 | 3300013307 | Ga0157372_10380707 | Ga0157372_103807072 | 203 |
| 17 | 3300025912 | Ga0207707_10389374 | Ga0207707_103893741 | 203 |
| 18 | 3300025921 | Ga0207652_10121336 | Ga0207652_101213361 | 203 |
| 19 | 3300025936 | Ga0207670_10640850 | Ga0207670_106408502 | 203 |
| 20 | 3300025949 | Ga0207667_10111538 | Ga0207667_101115382 | 203 |
| 21 | 3300026078 | Ga0207702_10773210 | Ga0207702_107732102 | 203 |
| 22 | 3300028800 | Ga0265338_10035956 | Ga0265338_100359566 | 203 |
| 23 | 3300006880 | Ga0075429_100297407 | Ga0075429_1002974072 | 204 |
| 24 | 3300050508 | nmdc:mga09592_146595_c1 | nmdc:mga09592_146595_c1_145_795 | 204 |
| 25 | 3300044673 | Ga0453683_0001303 | Ga0453683_0001303_7348_8001 | 205 |
| 26 | 3300044673 | Ga0453683_0014308 | Ga0453683_0014308_385_1038 | 205 |
| 27 | 3300044712 | Ga0453684_0311193 | Ga0453684_0311193_197_850 | 205 |
| 28 | 3300006048 | Ga0075363_100031446 | Ga0075363_1000314462 | 206 |
| 29 | 3300006177 | Ga0075362_10040905 | Ga0075362_100409052 | 206 |
| 30 | 3300006195 | Ga0075366_10042554 | Ga0075366_100425542 | 206 |
| 31 | 3300006353 | Ga0075370_10006280 | Ga0075370_100062802 | 206 |
| 32 | 3300050489 | nmdc:mga03683_204_c1 | nmdc:mga03683_204_c1_17329_17982 | 206 |
| 33 | 3300050493 | nmdc:mga0k408_9540_c1 | nmdc:mga0k408_9540_c1_3813_4466 | 206 |
| 34 | 3300050496 | nmdc:mga07m45_3324_c2 | nmdc:mga07m45_3324_c2_1822_2475 | 206 |
| 35 | 3300050493 | nmdc:mga0k408_349735_c1 | nmdc:mga0k408_349735_c1_62_715 | 207 |
| 36 | 3300050493 | nmdc:mga0k408_4469_c1 | nmdc:mga0k408_4469_c1_2647_3300 | 207 |
| 37 | 3300042156 | Ga0439446_0028439 | Ga0439446_0028439_312_971 | 209 |
| 38 | 3300005335 | Ga0070666_10252734 | Ga0070666_102527341 | 210 |
| 39 | 3300005364 | Ga0070673_100291014 | Ga0070673_1002910141 | 210 |
| 40 | 3300013296 | Ga0157374_10481883 | Ga0157374_104818831 | 210 |
| 41 | 3300013297 | Ga0157378_10047435 | Ga0157378_100474353 | 210 |
| 42 | 3300013306 | Ga0163162_10610141 | Ga0163162_106101411 | 210 |
| 43 | 3300013308 | Ga0157375_10000025 | Ga0157375_1000002580 | 210 |
| 44 | 3300014325 | Ga0163163_10023565 | Ga0163163_100235654 | 210 |
| 45 | 3300025903 | Ga0207680_10307303 | Ga0207680_103073032 | 210 |
| 46 | 3300025918 | Ga0207662_10147607 | Ga0207662_101476072 | 210 |
| 47 | 3300045051 | Ga0451576_0025626 | Ga0451576_0025626_5092_5760 | 210 |
| 48 | 3300045051 | Ga0451576_0086248 | Ga0451576_0086248_1748_2401 | 210 |
| 49 | 3300005437 | Ga0070710_10440963 | Ga0070710_104409632 | 211 |
| 50 | 3300005536 | Ga0070697_100776256 | Ga0070697_1007762561 | 211 |
| 51 | 3300025898 | Ga0207692_10405642 | Ga0207692_104056421 | 211 |
| 52 | 3300025939 | Ga0207665_10205430 | Ga0207665_102054301 | 211 |
| 53 | 3300048905 | Ga0496102_0959116 | Ga0496102_0959116_101_754 | 211 |
| 54 | 3300005340 | Ga0070689_100098298 | Ga0070689_1000982984 | 212 |
| 55 | 3300021361 | Ga0213872_10001819 | Ga0213872_100018199 | 212 |
| 56 | 3300021441 | Ga0213871_10018117 | Ga0213871_100181172 | 212 |
| 57 | 3300025936 | Ga0207670_10384306 | Ga0207670_103843061 | 212 |
| 58 | 3300039438 | Ga0436360_0627618 | Ga0436360_0627618_1426_2079 | 212 |
| 59 | iso_pu_bacteria | 2671180531 | 2673168423 | 213 |
| 60 | 3300005549 | Ga0070704_100185178 | Ga0070704_1001851782 | 214 |
| 61 | 3300005549 | Ga0070704_100800564 | Ga0070704_1008005641 | 214 |
| 62 | 3300006844 | Ga0075428_100182941 | Ga0075428_1001829412 | 214 |
| 63 | 3300009094 | Ga0111539_10031452 | Ga0111539_100314527 | 214 |
| 64 | 3300050508 | nmdc:mga09592_465452_c1 | nmdc:mga09592_465452_c1_317_967 | 214 |
| 65 | 3300003320 | rootH2_10010635 | rootH2_100106352 | 215 |
| 66 | 3300028573 | Ga0265334_10000520 | Ga0265334_1000052011 | 215 |
| 67 | 3300028653 | Ga0265323_10000084 | Ga0265323_1000008434 | 215 |
| 68 | 3300028653 | Ga0265323_10028771 | Ga0265323_100287712 | 215 |
| 69 | 3300028653 | Ga0265323_10049323 | Ga0265323_100493231 | 215 |
| 70 | 3300028653 | Ga0265323_10066943 | Ga0265323_100669431 | 215 |
| 71 | 3300028654 | Ga0265322_10001185 | Ga0265322_100011851 | 215 |
| 72 | 3300028654 | Ga0265322_10006380 | Ga0265322_100063802 | 215 |
| 73 | 3300031235 | Ga0265330_10003711 | Ga0265330_100037111 | 215 |
| 74 | 3300031344 | Ga0265316_10024706 | Ga0265316_100247064 | 215 |
| 75 | 3300031344 | Ga0265316_10102036 | Ga0265316_101020362 | 215 |
| 76 | 3300031344 | Ga0265316_10144247 | Ga0265316_101442472 | 215 |
| 77 | 3300031712 | Ga0265342_10012725 | Ga0265342_100127251 | 215 |
| 78 | 3300049581 | Ga0501047_0710884 | Ga0501047_0710884_32_703 | 215 |
| 79 | 3300049823 | Ga0501044_0039962 | Ga0501044_0039962_1513_2184 | 215 |
| 80 | 3300013102 | Ga0157371_10439628 | Ga0157371_104396282 | 216 |
| 81 | 3300003320 | rootH2_10006455 | rootH2_100064556 | 217 |
| 82 | 3300005530 | Ga0070679_100092446 | Ga0070679_1000924462 | 217 |
| 83 | 3300005530 | Ga0070679_100268681 | Ga0070679_1002686813 | 217 |
| 84 | 3300005548 | Ga0070665_100000835 | Ga0070665_1000008352 | 217 |
| 85 | 3300005614 | Ga0068856_100557718 | Ga0068856_1005577182 | 217 |
| 86 | 3300005841 | Ga0068863_100005618 | Ga0068863_10000561812 | 217 |
| 87 | 3300005843 | Ga0068860_100002812 | Ga0068860_1000028126 | 217 |
| 88 | 3300009093 | Ga0105240_10014707 | Ga0105240_100147079 | 217 |
| 89 | 3300009093 | Ga0105240_10024943 | Ga0105240_100249433 | 217 |
| 90 | 3300009093 | Ga0105240_10047491 | Ga0105240_100474912 | 217 |
| 91 | 3300009101 | Ga0105247_10163892 | Ga0105247_101638922 | 217 |
| 92 | 3300009177 | Ga0105248_10040439 | Ga0105248_100404396 | 217 |
| 93 | 3300013104 | Ga0157370_10398809 | Ga0157370_103988091 | 217 |
| 94 | 3300013296 | Ga0157374_11233374 | Ga0157374_112333742 | 217 |
| 95 | 3300014326 | Ga0157380_11075682 | Ga0157380_110756821 | 217 |
| 96 | 3300014969 | Ga0157376_10891931 | Ga0157376_108919312 | 217 |
| 97 | 3300021384 | Ga0213876_10000668 | Ga0213876_1000066819 | 217 |
| 98 | 3300021384 | Ga0213876_10132499 | Ga0213876_101324992 | 217 |
| 99 | 3300025912 | Ga0207707_10506231 | Ga0207707_105062311 | 217 |
| 100 | 3300025913 | Ga0207695_10005293 | Ga0207695_1000529315 | 217 |
| 101 | 3300025916 | Ga0207663_10297381 | Ga0207663_102973811 | 217 |
| 102 | 3300026035 | Ga0207703_10538683 | Ga0207703_105386832 | 217 |
| 103 | 3300026078 | Ga0207702_10193507 | Ga0207702_101935072 | 217 |
| 104 | 3300026088 | Ga0207641_10001699 | Ga0207641_100016994 | 217 |
| 105 | 3300028379 | Ga0268266_10000035 | Ga0268266_10000035166 | 217 |
| 106 | 3300028381 | Ga0268264_10000659 | Ga0268264_1000065939 | 217 |
| 107 | 3300028800 | Ga0265338_10025145 | Ga0265338_100251453 | 217 |
| 108 | 3300035118 | Ga0373954_0006779 | Ga0373954_0006779_3844_4497 | 217 |
| 109 | 3300035692 | Ga0373935_0185832 | Ga0373935_0185832_458_1150 | 217 |
| 110 | 3300039437 | Ga0436365_1432120 | Ga0436365_1432120_18583_19236 | 217 |
| 111 | 3300039438 | Ga0436360_1060084 | Ga0436360_1060084_136_789 | 217 |
| 112 | 3300041507 | Ga0451851_0578862 | Ga0451851_0578862_121_780 | 217 |
| 113 | 3300041512 | Ga0451853_1437256 | Ga0451853_1437256_125_784 | 217 |
| 114 | 3300046689 | Ga0495613_0299377 | Ga0495613_0299377_175_828 | 217 |
| 115 | 3300049460 | Ga0495682_0056328 | Ga0495682_0056328_592_1245 | 217 |
| 116 | 3300049570 | Ga0501033_0019056 | Ga0501033_0019056_1236_1889 | 217 |
| 117 | 3300049742 | Ga0501080_1020960 | Ga0501080_1020960_33_698 | 217 |
| 118 | 3300049822 | Ga0501035_0218953 | Ga0501035_0218953_108_773 | 217 |
| 119 | 3300053146 | Ga0500588_0067137 | Ga0500588_0067137_277_936 | 217 |
| 120 | 3300053156 | Ga0500622_0012478 | Ga0500622_0012478_3533_4192 | 217 |
| 121 | 3300031249 | Ga0265339_10198774 | Ga0265339_101987741 | 218 |
| 122 | 3300005544 | Ga0070686_100531471 | Ga0070686_1005314712 | 220 |
| 123 | 3300013296 | Ga0157374_11085942 | Ga0157374_110859421 | 220 |
| 124 | 3300005616 | Ga0068852_100014571 | Ga0068852_1000145712 | 221 |
| 125 | 3300009093 | Ga0105240_10000041 | Ga0105240_10000041197 | 221 |
| 126 | 3300025913 | Ga0207695_10000093 | Ga0207695_1000009383 | 221 |
| 127 | 3300026142 | Ga0207698_10092005 | Ga0207698_100920052 | 221 |
| 128 | 3300006177 | Ga0075362_10015312 | Ga0075362_100153122 | 223 |
| 129 | 3300006195 | Ga0075366_10025872 | Ga0075366_100258722 | 223 |
| 130 | 3300006195 | Ga0075366_10033468 | Ga0075366_100334682 | 223 |
| 131 | 3300025923 | Ga0207681_10338546 | Ga0207681_103385462 | 223 |
| 132 | 3300028381 | Ga0268264_10441009 | Ga0268264_104410092 | 223 |
| 133 | 3300050493 | nmdc:mga0k408_145279_c1 | nmdc:mga0k408_145279_c1_581_1255 | 223 |
| 134 | 3300050493 | nmdc:mga0k408_51231_c1 | nmdc:mga0k408_51231_c1_1331_2005 | 223 |
| 135 | 3300053153 | Ga0500616_0015205 | Ga0500616_0015205_3242_3919 | 223 |
| 136 | 3300048918 | Ga0496115_0009779 | Ga0496115_0009779_6436_7116 | 226 |
| 137 | 3300045051 | Ga0451576_0028687 | Ga0451576_0028687_4175_4900 | 239 |
| 138 | 3300005339 | Ga0070660_100039791 | Ga0070660_1000397912 | 240 |
| 139 | 3300025909 | Ga0207705_10032986 | Ga0207705_100329862 | 240 |
| 140 | 3300025919 | Ga0207657_10036230 | Ga0207657_100362304 | 240 |
| 141 | 3300025932 | Ga0207690_10365596 | Ga0207690_103655961 | 240 |
| 142 | 3300001977 | JGI24746J21847_1006772 | JGI24746J21847_10067722 | 241 |
| 143 | 3300005290 | Ga0065712_10097557 | Ga0065712_100975572 | 241 |
| 144 | 3300005293 | Ga0065715_10134319 | Ga0065715_101343192 | 241 |
| 145 | 3300005328 | Ga0070676_10019063 | Ga0070676_100190632 | 241 |
| 146 | 3300005328 | Ga0070676_10114033 | Ga0070676_101140331 | 241 |
| 147 | 3300005329 | Ga0070683_100279645 | Ga0070683_1002796452 | 241 |
| 148 | 3300005331 | Ga0070670_100069101 | Ga0070670_1000691012 | 241 |
| 149 | 3300005331 | Ga0070670_100134199 | Ga0070670_1001341992 | 241 |
| 150 | 3300005335 | Ga0070666_10014891 | Ga0070666_100148912 | 241 |
| 151 | 3300005335 | Ga0070666_10017556 | Ga0070666_100175563 | 241 |
| 152 | 3300005340 | Ga0070689_100292650 | Ga0070689_1002926502 | 241 |
| 153 | 3300005347 | Ga0070668_100147399 | Ga0070668_1001473992 | 241 |
| 154 | 3300005353 | Ga0070669_100077348 | Ga0070669_1000773482 | 241 |
| 155 | 3300005353 | Ga0070669_100176796 | Ga0070669_1001767962 | 241 |
| 156 | 3300005354 | Ga0070675_100034722 | Ga0070675_1000347222 | 241 |
| 157 | 3300005355 | Ga0070671_100014377 | Ga0070671_1000143776 | 241 |
| 158 | 3300005355 | Ga0070671_100087243 | Ga0070671_1000872433 | 241 |
| 159 | 3300005364 | Ga0070673_100003375 | Ga0070673_1000033755 | 241 |
| 160 | 3300005365 | Ga0070688_100006902 | Ga0070688_1000069022 | 241 |
| 161 | 3300005367 | Ga0070667_100069996 | Ga0070667_1000699962 | 241 |
| 162 | 3300005367 | Ga0070667_100085147 | Ga0070667_1000851472 | 241 |
| 163 | 3300005367 | Ga0070667_100257844 | Ga0070667_1002578442 | 241 |
| 164 | 3300005436 | Ga0070713_100053022 | Ga0070713_1000530222 | 241 |
| 165 | 3300005436 | Ga0070713_100329996 | Ga0070713_1003299961 | 241 |
| 166 | 3300005437 | Ga0070710_10108634 | Ga0070710_101086341 | 241 |
| 167 | 3300005439 | Ga0070711_100052251 | Ga0070711_1000522512 | 241 |
| 168 | 3300005441 | Ga0070700_100186558 | Ga0070700_1001865582 | 241 |
| 169 | 3300005445 | Ga0070708_100265551 | Ga0070708_1002655512 | 241 |
| 170 | 3300005456 | Ga0070678_100016486 | Ga0070678_1000164861 | 241 |
| 171 | 3300005456 | Ga0070678_100037278 | Ga0070678_1000372783 | 241 |
| 172 | 3300005457 | Ga0070662_100218143 | Ga0070662_1002181431 | 241 |
| 173 | 3300005467 | Ga0070706_100000462 | Ga0070706_10000046236 | 241 |
| 174 | 3300005467 | Ga0070706_100318328 | Ga0070706_1003183282 | 241 |
| 175 | 3300005536 | Ga0070697_100466172 | Ga0070697_1004661722 | 241 |
| 176 | 3300005539 | Ga0068853_100000023 | Ga0068853_10000002360 | 241 |
| 177 | 3300005543 | Ga0070672_100010960 | Ga0070672_1000109602 | 241 |
| 178 | 3300005543 | Ga0070672_100015039 | Ga0070672_1000150392 | 241 |
| 179 | 3300005548 | Ga0070665_100005247 | Ga0070665_1000052477 | 241 |
| 180 | 3300005563 | Ga0068855_100003868 | Ga0068855_10000386810 | 241 |
| 181 | 3300005564 | Ga0070664_100104120 | Ga0070664_1001041202 | 241 |
| 182 | 3300005564 | Ga0070664_100270117 | Ga0070664_1002701172 | 241 |
| 183 | 3300005578 | Ga0068854_100267582 | Ga0068854_1002675822 | 241 |
| 184 | 3300005618 | Ga0068864_100443821 | Ga0068864_1004438212 | 241 |
| 185 | 3300005842 | Ga0068858_100270433 | Ga0068858_1002704333 | 241 |
| 186 | 3300005843 | Ga0068860_100328945 | Ga0068860_1003289452 | 241 |
| 187 | 3300005985 | Ga0081539_10002666 | Ga0081539_1000266615 | 241 |
| 188 | 3300006237 | Ga0097621_100410280 | Ga0097621_1004102802 | 241 |
| 189 | 3300006237 | Ga0097621_100721921 | Ga0097621_1007219211 | 241 |
| 190 | 3300006358 | Ga0068871_100132196 | Ga0068871_1001321963 | 241 |
| 191 | 3300006844 | Ga0075428_100265427 | Ga0075428_1002654272 | 241 |
| 192 | 3300006871 | Ga0075434_100343804 | Ga0075434_1003438042 | 241 |
| 193 | 3300009094 | Ga0111539_10166479 | Ga0111539_101664792 | 241 |
| 194 | 3300010375 | Ga0105239_10672917 | Ga0105239_106729172 | 241 |
| 195 | 3300013296 | Ga0157374_10075175 | Ga0157374_100751752 | 241 |
| 196 | 3300013296 | Ga0157374_10081609 | Ga0157374_100816092 | 241 |
| 197 | 3300013297 | Ga0157378_10028126 | Ga0157378_100281262 | 241 |
| 198 | 3300013306 | Ga0163162_10326474 | Ga0163162_103264743 | 241 |
| 199 | 3300013308 | Ga0157375_10006688 | Ga0157375_100066883 | 241 |
| 200 | 3300014969 | Ga0157376_10033165 | Ga0157376_100331655 | 241 |
| 201 | 3300025290 | Ga0207673_1008122 | Ga0207673_10081222 | 241 |
| 202 | 3300025315 | Ga0207697_10005825 | Ga0207697_100058252 | 241 |
| 203 | 3300025893 | Ga0207682_10022050 | Ga0207682_100220502 | 241 |
| 204 | 3300025901 | Ga0207688_10010515 | Ga0207688_100105152 | 241 |
| 205 | 3300025907 | Ga0207645_10011654 | Ga0207645_100116542 | 241 |
| 206 | 3300025919 | Ga0207657_10254713 | Ga0207657_102547132 | 241 |
| 207 | 3300025920 | Ga0207649_10142440 | Ga0207649_101424402 | 241 |
| 208 | 3300025923 | Ga0207681_10026042 | Ga0207681_100260422 | 241 |
| 209 | 3300025923 | Ga0207681_10170656 | Ga0207681_101706562 | 241 |
| 210 | 3300025925 | Ga0207650_10192881 | Ga0207650_101928812 | 241 |
| 211 | 3300025925 | Ga0207650_10193359 | Ga0207650_101933592 | 241 |
| 212 | 3300025925 | Ga0207650_10476469 | Ga0207650_104764691 | 241 |
| 213 | 3300025926 | Ga0207659_10105831 | Ga0207659_101058311 | 241 |
| 214 | 3300025926 | Ga0207659_10107177 | Ga0207659_101071772 | 241 |
| 215 | 3300025933 | Ga0207706_10049546 | Ga0207706_100495461 | 241 |
| 216 | 3300025940 | Ga0207691_10001056 | Ga0207691_100010561 | 241 |
| 217 | 3300025940 | Ga0207691_10025833 | Ga0207691_100258332 | 241 |
| 218 | 3300025944 | Ga0207661_10610360 | Ga0207661_106103602 | 241 |
| 219 | 3300025949 | Ga0207667_10000965 | Ga0207667_1000096522 | 241 |
| 220 | 3300025960 | Ga0207651_10088227 | Ga0207651_100882273 | 241 |
| 221 | 3300025960 | Ga0207651_10140716 | Ga0207651_101407162 | 241 |
| 222 | 3300025972 | Ga0207668_10440699 | Ga0207668_104406992 | 241 |
| 223 | 3300025986 | Ga0207658_10065366 | Ga0207658_100653662 | 241 |
| 224 | 3300025986 | Ga0207658_10290904 | Ga0207658_102909042 | 241 |
| 225 | 3300026041 | Ga0207639_10000040 | Ga0207639_1000004059 | 241 |
| 226 | 3300026075 | Ga0207708_10357115 | Ga0207708_103571151 | 241 |
| 227 | 3300026088 | Ga0207641_10168150 | Ga0207641_101681501 | 241 |
| 228 | 3300026089 | Ga0207648_10106980 | Ga0207648_101069802 | 241 |
| 229 | 3300026121 | Ga0207683_10013215 | Ga0207683_100132155 | 241 |
| 230 | 3300028379 | Ga0268266_10001518 | Ga0268266_1000151819 | 241 |
| 231 | 3300028380 | Ga0268265_10089044 | Ga0268265_100890442 | 241 |
| 232 | 3300035692 | Ga0373935_0271940 | Ga0373935_0271940_421_1146 | 241 |
| 233 | 3300037068 | Ga0373925_0405047 | Ga0373925_0405047_256_981 | 241 |
| 234 | 3300037471 | Ga0395905_0072657 | Ga0395905_0072657_911_1645 | 241 |
| 235 | 3300037471 | Ga0395905_0445005 | Ga0395905_0445005_185_931 | 241 |
| 236 | 3300046454 | Ga0495592_0078785 | Ga0495592_0078785_348_1073 | 241 |
| 237 | 3300046462 | Ga0495651_0025382 | Ga0495651_0025382_1207_1932 | 241 |
| 238 | 3300046463 | Ga0495653_0240218 | Ga0495653_0240218_465_1190 | 241 |
| 239 | 3300046516 | Ga0495628_0048607 | Ga0495628_0048607_771_1496 | 241 |
| 240 | 3300046522 | Ga0495643_0002851 | Ga0495643_0002851_8231_8962 | 241 |
| 241 | 3300046529 | Ga0495652_0138648 | Ga0495652_0138648_435_1160 | 241 |
| 242 | 3300046683 | Ga0495658_0101412 | Ga0495658_0101412_738_1463 | 241 |
| 243 | 3300048903 | Ga0496100_0168321 | Ga0496100_0168321_261_986 | 241 |
| 244 | 3300048904 | Ga0496101_0179891 | Ga0496101_0179891_462_1187 | 241 |
| 245 | 3300048907 | Ga0496104_0039899 | Ga0496104_0039899_1655_2380 | 241 |
| 246 | 3300048912 | Ga0496109_0402769 | Ga0496109_0402769_530_1255 | 241 |
| 247 | 3300048912 | Ga0496109_0512535 | Ga0496109_0512535_381_1106 | 241 |
| 248 | 3300048915 | Ga0496112_0210257 | Ga0496112_0210257_1060_1785 | 241 |
| 249 | 3300048917 | Ga0496114_0052266 | Ga0496114_0052266_1754_2479 | 241 |
| 250 | 3300050508 | nmdc:mga09592_412226_c1 | nmdc:mga09592_412226_c1_23_748 | 241 |
| 251 | 3300050512 | nmdc:mga0n895_334491_c1 | nmdc:mga0n895_334491_c1_416_1141 | 241 |
| 252 | 3300053085 | Ga0495619_0020426 | Ga0495619_0020426_2905_3630 | 241 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f0k-assembly1.cif.gz_A | alternative complex iii | 0.8459 | 5 | 241 |
| 6f0k-assembly1.cif.gz_A | alternative complex iii | 0.8421 | 5 | 241 |
| 6loe-assembly1.cif.gz_A | cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii | 0.8084 | 4 | 241 |
| 6loe-assembly1.cif.gz_A | cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii | 0.8019 | 4 | 241 |
| 6btm-assembly1.cif.gz_A | structure of alternative complex iii from flavobacterium johnsoniae (wild type) | 0.5671 | 17 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8N3F8_2_109_1.10.418.10 | Mainly Alpha;Orthogonal Bundle;Actin-binding Protein, T-fimbrin; domain 1;Calponin-like domain | 0.32 | 163 | 229 | 1.10.418.10 |
| af_Q8N3F8_2_109_1.10.418.10 | Mainly Alpha;Orthogonal Bundle;Actin-binding Protein, T-fimbrin; domain 1;Calponin-like domain | 0.2136 | 163 | 229 | 1.10.418.10 |
| af_Q9Y141_2_547_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.122 | 44 | 227 | 3.40.50.1820 |
| af_Q9Y141_2_547_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.1197 | 44 | 227 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6DHQ7-F1-model_v4 | Cytochrome c-552/4 domain-containing protein | 0.9845 | 160 | 241 |
|
| AF-A0A2V6M790-F1-model_v4 | Cytochrome C | 0.9844 | 41 | 241 |
|
| AF-A0A2V5XVR8-F1-model_v4 | Cytochrome C | 0.9841 | 124 | 241 |
|
| AF-A0A838DGJ2-F1-model_v4 | Cytochrome c3 family protein | 0.9814 | 64 | 241 |
|
| AF-A0A2V6IJM1-F1-model_v4 | Cytochrome C | 0.9787 | 86 | 241 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar