F363079

General Info

Members Datasets Scaffolds Average Seq Length
252 169 251 227

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100000023|Ga0068853_10000002360
Length 248
Sequence MPQIFSRGANLVPAQIIAILAILGAAATGTVWYYFTPKYTKVGYMPPQPIPFSHKIHAGQLGLDCRYCHSFVETAAHSNIPAAQVCMNCHSQVQKDNPKLEPLRQAWATGQPIPWVQIHKTPDYAYFNHSVHVNRGVSCVSCHGRIDQMEVVYQEKPLSMKWCLECHRAPENALRPLDKVTDLAWTPPTNGGELAALLKAEMGPGPGQLNVKADSKLKPDEAQLLMGNFLKSRRDIHAPDANCAGCHR

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
78 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 3.97
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1006772 3300001977 Unclassified 1767
2 rootH2_10006455 3300003320 Bacteria 8937
3 rootH2_10010635 3300003320 Bacteria 4511
4 Ga0058863_10039178 3300004799 Bacteria 1188
5 Ga0065704_10006576 3300005289 Bacteria 4800
6 Ga0065712_10097557 3300005290 Unclassified 2147
7 Ga0065715_10134319 3300005293 Unclassified 1957
8 Ga0070676_10019063 3300005328 Bacteria 3812
9 Ga0070676_10114033 3300005328 Bacteria 1687
10 Ga0070683_100279645 3300005329 Bacteria 1587
11 Ga0070670_100069101 3300005331 Bacteria 3032
12 Ga0070670_100134199 3300005331 Unclassified 2139
13 Ga0070666_10014891 3300005335 Bacteria 4955
14 Ga0070666_10017556 3300005335 Bacteria 4588
15 Ga0070666_10252734 3300005335 Unclassified 1248
16 Ga0070660_100039791 3300005339 Unclassified 3574
17 Ga0070689_100098298 3300005340 Bacteria 2315
18 Ga0070689_100192286 3300005340 Unclassified 1662
19 Ga0070689_100292650 3300005340 Bacteria 1353
20 Ga0070668_100147399 3300005347 Bacteria 1900
21 Ga0070669_100077348 3300005353 Bacteria 2471
22 Ga0070669_100176796 3300005353 Bacteria 1668
23 Ga0070675_100034722 3300005354 Bacteria 4094
24 Ga0070671_100014377 3300005355 Bacteria 6394
25 Ga0070671_100087243 3300005355 Bacteria 2611
26 Ga0070673_100003375 3300005364 Bacteria 9938
27 Ga0070673_100291014 3300005364 Unclassified 1435
28 Ga0070688_100006902 3300005365 Bacteria 6095
29 Ga0070667_100069996 3300005367 Bacteria 2986
30 Ga0070667_100085147 3300005367 Bacteria 2711
31 Ga0070667_100257844 3300005367 Bacteria 1560
32 Ga0070713_100053022 3300005436 Unclassified 3360
33 Ga0070713_100329996 3300005436 Bacteria 1411
34 Ga0070710_10108634 3300005437 Unclassified 1663
35 Ga0070710_10440963 3300005437 Unclassified 881
36 Ga0070711_100052251 3300005439 Unclassified 2811
37 Ga0070700_100186558 3300005441 Bacteria 1447
38 Ga0070708_100265551 3300005445 Bacteria 1614
39 Ga0070678_100016486 3300005456 Bacteria 4729
40 Ga0070678_100037278 3300005456 Bacteria 3412
41 Ga0070662_100218143 3300005457 Bacteria 1521
42 Ga0070681_10020478 3300005458 Bacteria 6629
43 Ga0070706_100000462 3300005467 Bacteria 48224
44 Ga0070706_100318328 3300005467 Unclassified 1451
45 Ga0070679_100092446 3300005530 Bacteria 3013
46 Ga0070679_100268681 3300005530 Bacteria 1660
47 Ga0070684_100385362 3300005535 Unclassified 1291
48 Ga0070697_100466172 3300005536 Unclassified 1101
49 Ga0070697_100776256 3300005536 Unclassified 847
50 Ga0068853_100000023 3300005539 Bacteria 142301
51 Ga0070672_100010960 3300005543 Bacteria 6308
52 Ga0070672_100015039 3300005543 Bacteria 5499
53 Ga0070686_100531471 3300005544 Bacteria 917
54 Ga0070665_100000835 3300005548 Bacteria 40254
55 Ga0070665_100005247 3300005548 Bacteria 13398
56 Ga0070704_100185178 3300005549 Bacteria 1669
57 Ga0070704_100800564 3300005549 Bacteria 842
58 Ga0068855_100003868 3300005563 Bacteria 18297
59 Ga0068855_100178226 3300005563 Unclassified 2403
60 Ga0070664_100104120 3300005564 Unclassified 2471
61 Ga0070664_100270117 3300005564 Bacteria 1532
62 Ga0068854_100267582 3300005578 Unclassified 1371
63 Ga0068856_100557718 3300005614 Bacteria 1167
64 Ga0068852_100014571 3300005616 Bacteria 6059
65 Ga0068859_100499034 3300005617 Bacteria 1312
66 Ga0068864_100443821 3300005618 Bacteria 1240
67 Ga0068863_100005618 3300005841 Bacteria 12324
68 Ga0068858_100270433 3300005842 Bacteria 1617
69 Ga0068860_100002812 3300005843 Bacteria 18095
70 Ga0068860_100328945 3300005843 Bacteria 1501
71 Ga0081539_10002666 3300005985 Bacteria 24293
72 Ga0075363_100031446 3300006048 Bacteria 2752
73 Ga0075362_10015312 3300006177 Bacteria 3116
74 Ga0075362_10040905 3300006177 Bacteria 2042
75 Ga0075366_10025872 3300006195 Bacteria 3433
76 Ga0075366_10033468 3300006195 Bacteria 3028
77 Ga0075366_10042554 3300006195 Bacteria 2689
78 Ga0097621_100410280 3300006237 Bacteria 1214
79 Ga0097621_100721921 3300006237 Bacteria 919
80 Ga0075370_10006280 3300006353 Bacteria 5967
81 Ga0068871_100132196 3300006358 Unclassified 2117
82 Ga0075428_100000173 3300006844 Bacteria 59939
83 Ga0075428_100182941 3300006844 Unclassified 2268
84 Ga0075428_100265427 3300006844 Unclassified 1848
85 Ga0075434_100343804 3300006871 Bacteria 1513
86 Ga0075429_100297407 3300006880 Bacteria 1413
87 Ga0097620_100499027 3300006931 Bacteria 1312
88 Ga0105240_10000041 3300009093 Bacteria 264078
89 Ga0105240_10014707 3300009093 Bacteria 10675
90 Ga0105240_10024943 3300009093 Bacteria 7871
91 Ga0105240_10047491 3300009093 Bacteria 5432
92 Ga0111539_10031452 3300009094 Bacteria 6446
93 Ga0111539_10166479 3300009094 Bacteria 2577
94 Ga0105247_10163892 3300009101 Unclassified 1474
95 Ga0105248_10040439 3300009177 Bacteria 5226
96 Ga0105237_10536816 3300009545 Unclassified 1176
97 Ga0105239_10672917 3300010375 Bacteria 1183
98 Ga0157371_10439628 3300013102 Bacteria 958
99 Ga0157370_10131293 3300013104 Bacteria 2336
100 Ga0157370_10398809 3300013104 Bacteria 1266
101 Ga0157374_10075175 3300013296 Bacteria 3192
102 Ga0157374_10081609 3300013296 Bacteria 3069
103 Ga0157374_10481883 3300013296 Unclassified 1244
104 Ga0157374_11085942 3300013296 Unclassified 820
105 Ga0157374_11233374 3300013296 Bacteria 769
106 Ga0157378_10028126 3300013297 Bacteria 4958
107 Ga0157378_10047435 3300013297 Bacteria 3820
108 Ga0163162_10326474 3300013306 Unclassified 1667
109 Ga0163162_10610141 3300013306 Unclassified 1217
110 Ga0157372_10380707 3300013307 Unclassified 1644
111 Ga0157375_10000025 3300013308 Bacteria 224384
112 Ga0157375_10006688 3300013308 Bacteria 10038
113 Ga0163163_10023565 3300014325 Bacteria 5844
114 Ga0157380_11075682 3300014326 Bacteria 842
115 Ga0157376_10033165 3300014969 Bacteria 4154
116 Ga0157376_10891931 3300014969 Bacteria 907
117 Ga0213872_10001819 3300021361 Bacteria 13252
118 Ga0213876_10000668 3300021384 Bacteria 24442
119 Ga0213876_10132499 3300021384 Unclassified 1325
120 Ga0213871_10018117 3300021441 Bacteria 1719
121 Ga0207673_1008122 3300025290 Bacteria 1325
122 Ga0207697_10005825 3300025315 Bacteria 5667
123 Ga0207682_10022050 3300025893 Bacteria 2507
124 Ga0207692_10405642 3300025898 Unclassified 851
125 Ga0207688_10010515 3300025901 Bacteria 5033
126 Ga0207680_10307303 3300025903 Unclassified 1106
127 Ga0207645_10011654 3300025907 Bacteria 5995
128 Ga0207705_10032986 3300025909 Unclassified 3701
129 Ga0207707_10389374 3300025912 Bacteria 1197
130 Ga0207707_10506231 3300025912 Bacteria 1029
131 Ga0207695_10000093 3300025913 Bacteria 270427
132 Ga0207695_10005293 3300025913 Bacteria 17198
133 Ga0207663_10297381 3300025916 Unclassified 1205
134 Ga0207662_10147607 3300025918 Bacteria 1494
135 Ga0207657_10036230 3300025919 Bacteria 4417
136 Ga0207657_10254713 3300025919 Unclassified 1398
137 Ga0207649_10142440 3300025920 Bacteria 1642
138 Ga0207652_10121336 3300025921 Bacteria 2326
139 Ga0207681_10026042 3300025923 Bacteria 3769
140 Ga0207681_10170656 3300025923 Bacteria 1648
141 Ga0207681_10338546 3300025923 Unclassified 1201
142 Ga0207650_10192881 3300025925 Bacteria 1628
143 Ga0207650_10193359 3300025925 Bacteria 1626
144 Ga0207650_10476469 3300025925 Bacteria 1041
145 Ga0207659_10105831 3300025926 Bacteria 2129
146 Ga0207659_10107177 3300025926 Bacteria 2117
147 Ga0207690_10365596 3300025932 Bacteria 1143
148 Ga0207706_10049546 3300025933 Bacteria 3712
149 Ga0207670_10384306 3300025936 Bacteria 1119
150 Ga0207670_10640850 3300025936 Unclassified 875
151 Ga0207665_10205430 3300025939 Bacteria 1437
152 Ga0207691_10001056 3300025940 Bacteria 27359
153 Ga0207691_10025833 3300025940 Bacteria 5512
154 Ga0207661_10610360 3300025944 Bacteria 1002
155 Ga0207667_10000965 3300025949 Bacteria 36640
156 Ga0207667_10111538 3300025949 Unclassified 2821
157 Ga0207651_10088227 3300025960 Bacteria 2260
158 Ga0207651_10140716 3300025960 Unclassified 1863
159 Ga0207668_10440699 3300025972 Bacteria 1109
160 Ga0207658_10065366 3300025986 Bacteria 2731
161 Ga0207658_10290904 3300025986 Bacteria 1404
162 Ga0207703_10538683 3300026035 Bacteria 1100
163 Ga0207639_10000040 3300026041 Bacteria 142397
164 Ga0207708_10357115 3300026075 Bacteria 1200
165 Ga0207702_10193507 3300026078 Bacteria 1881
166 Ga0207702_10773210 3300026078 Unclassified 949
167 Ga0207641_10001699 3300026088 Bacteria 21417
168 Ga0207641_10168150 3300026088 Bacteria 1999
169 Ga0207648_10106980 3300026089 Bacteria 2455
170 Ga0207683_10013215 3300026121 Bacteria 7041
171 Ga0207698_10092005 3300026142 Bacteria 2485
172 Ga0268266_10000035 3300028379 Bacteria 351632
173 Ga0268266_10001518 3300028379 Bacteria 27210
174 Ga0268265_10089044 3300028380 Bacteria 2461
175 Ga0268264_10000659 3300028381 Bacteria 40567
176 Ga0268264_10441009 3300028381 Bacteria 1260
177 Ga0265334_10000520 3300028573 Bacteria 19733
178 Ga0265323_10000084 3300028653 Bacteria 53536
179 Ga0265323_10028771 3300028653 Bacteria 2082
180 Ga0265323_10049323 3300028653 Bacteria 1498
181 Ga0265323_10066943 3300028653 Unclassified 1236
182 Ga0265322_10001185 3300028654 Bacteria 8934
183 Ga0265322_10006380 3300028654 Bacteria 3469
184 Ga0265338_10025145 3300028800 Bacteria 6055
185 Ga0265338_10035956 3300028800 Unclassified 4750
186 Ga0265330_10003711 3300031235 Bacteria 7907
187 Ga0265339_10198774 3300031249 Bacteria 990
188 Ga0265316_10024706 3300031344 Bacteria 5026
189 Ga0265316_10102036 3300031344 Bacteria 2179
190 Ga0265316_10144247 3300031344 Bacteria 1786
191 Ga0265342_10012725 3300031712 Bacteria 5685
192 Ga0373954_0006779 3300035118 Bacteria 4998
193 Ga0373935_0185832 3300035692 Bacteria 1429
194 Ga0373935_0271940 3300035692 Bacteria 1191
195 Ga0373925_0405047 3300037068 Bacteria 1113
196 Ga0395905_0072657 3300037471 Unclassified 3225
197 Ga0395905_0445005 3300037471 Unclassified 1193
198 Ga0436365_1432120 3300039437 Bacteria 33957
199 Ga0436360_0627618 3300039438 Bacteria 2305
200 Ga0436360_1060084 3300039438 Unclassified 974
201 Ga0451851_0578862 3300041507 Bacteria 1052
202 Ga0451853_1437256 3300041512 Bacteria 823
203 Ga0439446_0028439 3300042156 Bacteria 1609
204 Ga0453683_0001303 3300044673 Bacteria 21995
205 Ga0453683_0014308 3300044673 Bacteria 5154
206 Ga0453684_0311193 3300044712 Bacteria 1787
207 Ga0453684_0812056 3300044712 Bacteria 1008
208 Ga0451576_0000183 3300045051 Bacteria 157422
209 Ga0451576_0025626 3300045051 Bacteria 6353
210 Ga0451576_0028687 3300045051 Bacteria 5959
211 Ga0451576_0086248 3300045051 Bacteria 3265
212 Ga0495592_0078785 3300046454 Unclassified 2386
213 Ga0495651_0025382 3300046462 Bacteria 4613
214 Ga0495653_0240218 3300046463 Bacteria 1208
215 Ga0495628_0048607 3300046516 Bacteria 3362
216 Ga0495643_0002851 3300046522 Bacteria 13148
217 Ga0495652_0138648 3300046529 Bacteria 1915
218 Ga0495658_0101412 3300046683 Unclassified 1719
219 Ga0495613_0299377 3300046689 Bacteria 1114
220 Ga0496100_0168321 3300048903 Bacteria 1576
221 Ga0496101_0179891 3300048904 Bacteria 1628
222 Ga0496102_0959116 3300048905 Unclassified 776
223 Ga0496104_0039899 3300048907 Bacteria 4398
224 Ga0496106_1162475 3300048909 Unclassified 603
225 Ga0496109_0402769 3300048912 Unclassified 1293
226 Ga0496109_0512535 3300048912 Bacteria 1132
227 Ga0496112_0210257 3300048915 Bacteria 1903
228 Ga0496114_0052266 3300048917 Bacteria 3404
229 Ga0496115_0009779 3300048918 Bacteria 7142
230 Ga0495682_0056328 3300049460 Bacteria 1425
231 Ga0501033_0019056 3300049570 Bacteria 5188
232 Ga0501047_0710884 3300049581 Bacteria 822
233 Ga0501080_1020960 3300049742 Bacteria 717
234 Ga0501035_0218953 3300049822 Bacteria 1626
235 Ga0501044_0039962 3300049823 Bacteria 4891
236 nmdc:mga03683_204_c1 3300050489 Bacteria 19575
237 nmdc:mga03n38_345339_c1 3300050490 Unclassified 809
238 nmdc:mga0k408_145279_c1 3300050493 Bacteria 1412
239 nmdc:mga0k408_349735_c1 3300050493 Bacteria 881
240 nmdc:mga0k408_4469_c1 3300050493 Bacteria 7421
241 nmdc:mga0k408_51231_c1 3300050493 Unclassified 2391
242 nmdc:mga0k408_9540_c1 3300050493 Bacteria 5236
243 nmdc:mga07m45_3324_c2 3300050496 Bacteria 5875
244 nmdc:mga09592_146595_c1 3300050508 Bacteria 2035
245 nmdc:mga09592_412226_c1 3300050508 Bacteria 1167
246 nmdc:mga09592_465452_c1 3300050508 Bacteria 1090
247 nmdc:mga0n895_334491_c1 3300050512 Bacteria 1534
248 Ga0495619_0020426 3300053085 Bacteria 4218
249 Ga0500588_0067137 3300053146 Bacteria 1166
250 Ga0500616_0015205 3300053153 Unclassified 4405
251 Ga0500622_0012478 3300053156 Bacteria 4599

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_345339_c1 nmdc:mga03n38_345339_c1_243_779 167
2 3300048909 Ga0496106_1162475 Ga0496106_1162475_36_542 168
3 3300005535 Ga0070684_100385362 Ga0070684_1003853622 196
4 3300005617 Ga0068859_100499034 Ga0068859_1004990341 196
5 3300006931 Ga0097620_100499027 Ga0097620_1004990272 196
6 3300006844 Ga0075428_100000173 Ga0075428_10000017336 200
7 3300009545 Ga0105237_10536816 Ga0105237_105368162 201
8 3300005289 Ga0065704_10006576 Ga0065704_100065764 202
9 3300044712 Ga0453684_0812056 Ga0453684_0812056_321_974 202
10 3300045051 Ga0451576_0000183 Ga0451576_0000183_88231_88884 202
11 3300004799 Ga0058863_10039178 Ga0058863_100391781 203
12 3300005340 Ga0070689_100192286 Ga0070689_1001922862 203
13 3300005458 Ga0070681_10020478 Ga0070681_100204782 203
14 3300005563 Ga0068855_100178226 Ga0068855_1001782262 203
15 3300013104 Ga0157370_10131293 Ga0157370_101312932 203
16 3300013307 Ga0157372_10380707 Ga0157372_103807072 203
17 3300025912 Ga0207707_10389374 Ga0207707_103893741 203
18 3300025921 Ga0207652_10121336 Ga0207652_101213361 203
19 3300025936 Ga0207670_10640850 Ga0207670_106408502 203
20 3300025949 Ga0207667_10111538 Ga0207667_101115382 203
21 3300026078 Ga0207702_10773210 Ga0207702_107732102 203
22 3300028800 Ga0265338_10035956 Ga0265338_100359566 203
23 3300006880 Ga0075429_100297407 Ga0075429_1002974072 204
24 3300050508 nmdc:mga09592_146595_c1 nmdc:mga09592_146595_c1_145_795 204
25 3300044673 Ga0453683_0001303 Ga0453683_0001303_7348_8001 205
26 3300044673 Ga0453683_0014308 Ga0453683_0014308_385_1038 205
27 3300044712 Ga0453684_0311193 Ga0453684_0311193_197_850 205
28 3300006048 Ga0075363_100031446 Ga0075363_1000314462 206
29 3300006177 Ga0075362_10040905 Ga0075362_100409052 206
30 3300006195 Ga0075366_10042554 Ga0075366_100425542 206
31 3300006353 Ga0075370_10006280 Ga0075370_100062802 206
32 3300050489 nmdc:mga03683_204_c1 nmdc:mga03683_204_c1_17329_17982 206
33 3300050493 nmdc:mga0k408_9540_c1 nmdc:mga0k408_9540_c1_3813_4466 206
34 3300050496 nmdc:mga07m45_3324_c2 nmdc:mga07m45_3324_c2_1822_2475 206
35 3300050493 nmdc:mga0k408_349735_c1 nmdc:mga0k408_349735_c1_62_715 207
36 3300050493 nmdc:mga0k408_4469_c1 nmdc:mga0k408_4469_c1_2647_3300 207
37 3300042156 Ga0439446_0028439 Ga0439446_0028439_312_971 209
38 3300005335 Ga0070666_10252734 Ga0070666_102527341 210
39 3300005364 Ga0070673_100291014 Ga0070673_1002910141 210
40 3300013296 Ga0157374_10481883 Ga0157374_104818831 210
41 3300013297 Ga0157378_10047435 Ga0157378_100474353 210
42 3300013306 Ga0163162_10610141 Ga0163162_106101411 210
43 3300013308 Ga0157375_10000025 Ga0157375_1000002580 210
44 3300014325 Ga0163163_10023565 Ga0163163_100235654 210
45 3300025903 Ga0207680_10307303 Ga0207680_103073032 210
46 3300025918 Ga0207662_10147607 Ga0207662_101476072 210
47 3300045051 Ga0451576_0025626 Ga0451576_0025626_5092_5760 210
48 3300045051 Ga0451576_0086248 Ga0451576_0086248_1748_2401 210
49 3300005437 Ga0070710_10440963 Ga0070710_104409632 211
50 3300005536 Ga0070697_100776256 Ga0070697_1007762561 211
51 3300025898 Ga0207692_10405642 Ga0207692_104056421 211
52 3300025939 Ga0207665_10205430 Ga0207665_102054301 211
53 3300048905 Ga0496102_0959116 Ga0496102_0959116_101_754 211
54 3300005340 Ga0070689_100098298 Ga0070689_1000982984 212
55 3300021361 Ga0213872_10001819 Ga0213872_100018199 212
56 3300021441 Ga0213871_10018117 Ga0213871_100181172 212
57 3300025936 Ga0207670_10384306 Ga0207670_103843061 212
58 3300039438 Ga0436360_0627618 Ga0436360_0627618_1426_2079 212
59 iso_pu_bacteria 2671180531 2673168423 213
60 3300005549 Ga0070704_100185178 Ga0070704_1001851782 214
61 3300005549 Ga0070704_100800564 Ga0070704_1008005641 214
62 3300006844 Ga0075428_100182941 Ga0075428_1001829412 214
63 3300009094 Ga0111539_10031452 Ga0111539_100314527 214
64 3300050508 nmdc:mga09592_465452_c1 nmdc:mga09592_465452_c1_317_967 214
65 3300003320 rootH2_10010635 rootH2_100106352 215
66 3300028573 Ga0265334_10000520 Ga0265334_1000052011 215
67 3300028653 Ga0265323_10000084 Ga0265323_1000008434 215
68 3300028653 Ga0265323_10028771 Ga0265323_100287712 215
69 3300028653 Ga0265323_10049323 Ga0265323_100493231 215
70 3300028653 Ga0265323_10066943 Ga0265323_100669431 215
71 3300028654 Ga0265322_10001185 Ga0265322_100011851 215
72 3300028654 Ga0265322_10006380 Ga0265322_100063802 215
73 3300031235 Ga0265330_10003711 Ga0265330_100037111 215
74 3300031344 Ga0265316_10024706 Ga0265316_100247064 215
75 3300031344 Ga0265316_10102036 Ga0265316_101020362 215
76 3300031344 Ga0265316_10144247 Ga0265316_101442472 215
77 3300031712 Ga0265342_10012725 Ga0265342_100127251 215
78 3300049581 Ga0501047_0710884 Ga0501047_0710884_32_703 215
79 3300049823 Ga0501044_0039962 Ga0501044_0039962_1513_2184 215
80 3300013102 Ga0157371_10439628 Ga0157371_104396282 216
81 3300003320 rootH2_10006455 rootH2_100064556 217
82 3300005530 Ga0070679_100092446 Ga0070679_1000924462 217
83 3300005530 Ga0070679_100268681 Ga0070679_1002686813 217
84 3300005548 Ga0070665_100000835 Ga0070665_1000008352 217
85 3300005614 Ga0068856_100557718 Ga0068856_1005577182 217
86 3300005841 Ga0068863_100005618 Ga0068863_10000561812 217
87 3300005843 Ga0068860_100002812 Ga0068860_1000028126 217
88 3300009093 Ga0105240_10014707 Ga0105240_100147079 217
89 3300009093 Ga0105240_10024943 Ga0105240_100249433 217
90 3300009093 Ga0105240_10047491 Ga0105240_100474912 217
91 3300009101 Ga0105247_10163892 Ga0105247_101638922 217
92 3300009177 Ga0105248_10040439 Ga0105248_100404396 217
93 3300013104 Ga0157370_10398809 Ga0157370_103988091 217
94 3300013296 Ga0157374_11233374 Ga0157374_112333742 217
95 3300014326 Ga0157380_11075682 Ga0157380_110756821 217
96 3300014969 Ga0157376_10891931 Ga0157376_108919312 217
97 3300021384 Ga0213876_10000668 Ga0213876_1000066819 217
98 3300021384 Ga0213876_10132499 Ga0213876_101324992 217
99 3300025912 Ga0207707_10506231 Ga0207707_105062311 217
100 3300025913 Ga0207695_10005293 Ga0207695_1000529315 217
101 3300025916 Ga0207663_10297381 Ga0207663_102973811 217
102 3300026035 Ga0207703_10538683 Ga0207703_105386832 217
103 3300026078 Ga0207702_10193507 Ga0207702_101935072 217
104 3300026088 Ga0207641_10001699 Ga0207641_100016994 217
105 3300028379 Ga0268266_10000035 Ga0268266_10000035166 217
106 3300028381 Ga0268264_10000659 Ga0268264_1000065939 217
107 3300028800 Ga0265338_10025145 Ga0265338_100251453 217
108 3300035118 Ga0373954_0006779 Ga0373954_0006779_3844_4497 217
109 3300035692 Ga0373935_0185832 Ga0373935_0185832_458_1150 217
110 3300039437 Ga0436365_1432120 Ga0436365_1432120_18583_19236 217
111 3300039438 Ga0436360_1060084 Ga0436360_1060084_136_789 217
112 3300041507 Ga0451851_0578862 Ga0451851_0578862_121_780 217
113 3300041512 Ga0451853_1437256 Ga0451853_1437256_125_784 217
114 3300046689 Ga0495613_0299377 Ga0495613_0299377_175_828 217
115 3300049460 Ga0495682_0056328 Ga0495682_0056328_592_1245 217
116 3300049570 Ga0501033_0019056 Ga0501033_0019056_1236_1889 217
117 3300049742 Ga0501080_1020960 Ga0501080_1020960_33_698 217
118 3300049822 Ga0501035_0218953 Ga0501035_0218953_108_773 217
119 3300053146 Ga0500588_0067137 Ga0500588_0067137_277_936 217
120 3300053156 Ga0500622_0012478 Ga0500622_0012478_3533_4192 217
121 3300031249 Ga0265339_10198774 Ga0265339_101987741 218
122 3300005544 Ga0070686_100531471 Ga0070686_1005314712 220
123 3300013296 Ga0157374_11085942 Ga0157374_110859421 220
124 3300005616 Ga0068852_100014571 Ga0068852_1000145712 221
125 3300009093 Ga0105240_10000041 Ga0105240_10000041197 221
126 3300025913 Ga0207695_10000093 Ga0207695_1000009383 221
127 3300026142 Ga0207698_10092005 Ga0207698_100920052 221
128 3300006177 Ga0075362_10015312 Ga0075362_100153122 223
129 3300006195 Ga0075366_10025872 Ga0075366_100258722 223
130 3300006195 Ga0075366_10033468 Ga0075366_100334682 223
131 3300025923 Ga0207681_10338546 Ga0207681_103385462 223
132 3300028381 Ga0268264_10441009 Ga0268264_104410092 223
133 3300050493 nmdc:mga0k408_145279_c1 nmdc:mga0k408_145279_c1_581_1255 223
134 3300050493 nmdc:mga0k408_51231_c1 nmdc:mga0k408_51231_c1_1331_2005 223
135 3300053153 Ga0500616_0015205 Ga0500616_0015205_3242_3919 223
136 3300048918 Ga0496115_0009779 Ga0496115_0009779_6436_7116 226
137 3300045051 Ga0451576_0028687 Ga0451576_0028687_4175_4900 239
138 3300005339 Ga0070660_100039791 Ga0070660_1000397912 240
139 3300025909 Ga0207705_10032986 Ga0207705_100329862 240
140 3300025919 Ga0207657_10036230 Ga0207657_100362304 240
141 3300025932 Ga0207690_10365596 Ga0207690_103655961 240
142 3300001977 JGI24746J21847_1006772 JGI24746J21847_10067722 241
143 3300005290 Ga0065712_10097557 Ga0065712_100975572 241
144 3300005293 Ga0065715_10134319 Ga0065715_101343192 241
145 3300005328 Ga0070676_10019063 Ga0070676_100190632 241
146 3300005328 Ga0070676_10114033 Ga0070676_101140331 241
147 3300005329 Ga0070683_100279645 Ga0070683_1002796452 241
148 3300005331 Ga0070670_100069101 Ga0070670_1000691012 241
149 3300005331 Ga0070670_100134199 Ga0070670_1001341992 241
150 3300005335 Ga0070666_10014891 Ga0070666_100148912 241
151 3300005335 Ga0070666_10017556 Ga0070666_100175563 241
152 3300005340 Ga0070689_100292650 Ga0070689_1002926502 241
153 3300005347 Ga0070668_100147399 Ga0070668_1001473992 241
154 3300005353 Ga0070669_100077348 Ga0070669_1000773482 241
155 3300005353 Ga0070669_100176796 Ga0070669_1001767962 241
156 3300005354 Ga0070675_100034722 Ga0070675_1000347222 241
157 3300005355 Ga0070671_100014377 Ga0070671_1000143776 241
158 3300005355 Ga0070671_100087243 Ga0070671_1000872433 241
159 3300005364 Ga0070673_100003375 Ga0070673_1000033755 241
160 3300005365 Ga0070688_100006902 Ga0070688_1000069022 241
161 3300005367 Ga0070667_100069996 Ga0070667_1000699962 241
162 3300005367 Ga0070667_100085147 Ga0070667_1000851472 241
163 3300005367 Ga0070667_100257844 Ga0070667_1002578442 241
164 3300005436 Ga0070713_100053022 Ga0070713_1000530222 241
165 3300005436 Ga0070713_100329996 Ga0070713_1003299961 241
166 3300005437 Ga0070710_10108634 Ga0070710_101086341 241
167 3300005439 Ga0070711_100052251 Ga0070711_1000522512 241
168 3300005441 Ga0070700_100186558 Ga0070700_1001865582 241
169 3300005445 Ga0070708_100265551 Ga0070708_1002655512 241
170 3300005456 Ga0070678_100016486 Ga0070678_1000164861 241
171 3300005456 Ga0070678_100037278 Ga0070678_1000372783 241
172 3300005457 Ga0070662_100218143 Ga0070662_1002181431 241
173 3300005467 Ga0070706_100000462 Ga0070706_10000046236 241
174 3300005467 Ga0070706_100318328 Ga0070706_1003183282 241
175 3300005536 Ga0070697_100466172 Ga0070697_1004661722 241
176 3300005539 Ga0068853_100000023 Ga0068853_10000002360 241
177 3300005543 Ga0070672_100010960 Ga0070672_1000109602 241
178 3300005543 Ga0070672_100015039 Ga0070672_1000150392 241
179 3300005548 Ga0070665_100005247 Ga0070665_1000052477 241
180 3300005563 Ga0068855_100003868 Ga0068855_10000386810 241
181 3300005564 Ga0070664_100104120 Ga0070664_1001041202 241
182 3300005564 Ga0070664_100270117 Ga0070664_1002701172 241
183 3300005578 Ga0068854_100267582 Ga0068854_1002675822 241
184 3300005618 Ga0068864_100443821 Ga0068864_1004438212 241
185 3300005842 Ga0068858_100270433 Ga0068858_1002704333 241
186 3300005843 Ga0068860_100328945 Ga0068860_1003289452 241
187 3300005985 Ga0081539_10002666 Ga0081539_1000266615 241
188 3300006237 Ga0097621_100410280 Ga0097621_1004102802 241
189 3300006237 Ga0097621_100721921 Ga0097621_1007219211 241
190 3300006358 Ga0068871_100132196 Ga0068871_1001321963 241
191 3300006844 Ga0075428_100265427 Ga0075428_1002654272 241
192 3300006871 Ga0075434_100343804 Ga0075434_1003438042 241
193 3300009094 Ga0111539_10166479 Ga0111539_101664792 241
194 3300010375 Ga0105239_10672917 Ga0105239_106729172 241
195 3300013296 Ga0157374_10075175 Ga0157374_100751752 241
196 3300013296 Ga0157374_10081609 Ga0157374_100816092 241
197 3300013297 Ga0157378_10028126 Ga0157378_100281262 241
198 3300013306 Ga0163162_10326474 Ga0163162_103264743 241
199 3300013308 Ga0157375_10006688 Ga0157375_100066883 241
200 3300014969 Ga0157376_10033165 Ga0157376_100331655 241
201 3300025290 Ga0207673_1008122 Ga0207673_10081222 241
202 3300025315 Ga0207697_10005825 Ga0207697_100058252 241
203 3300025893 Ga0207682_10022050 Ga0207682_100220502 241
204 3300025901 Ga0207688_10010515 Ga0207688_100105152 241
205 3300025907 Ga0207645_10011654 Ga0207645_100116542 241
206 3300025919 Ga0207657_10254713 Ga0207657_102547132 241
207 3300025920 Ga0207649_10142440 Ga0207649_101424402 241
208 3300025923 Ga0207681_10026042 Ga0207681_100260422 241
209 3300025923 Ga0207681_10170656 Ga0207681_101706562 241
210 3300025925 Ga0207650_10192881 Ga0207650_101928812 241
211 3300025925 Ga0207650_10193359 Ga0207650_101933592 241
212 3300025925 Ga0207650_10476469 Ga0207650_104764691 241
213 3300025926 Ga0207659_10105831 Ga0207659_101058311 241
214 3300025926 Ga0207659_10107177 Ga0207659_101071772 241
215 3300025933 Ga0207706_10049546 Ga0207706_100495461 241
216 3300025940 Ga0207691_10001056 Ga0207691_100010561 241
217 3300025940 Ga0207691_10025833 Ga0207691_100258332 241
218 3300025944 Ga0207661_10610360 Ga0207661_106103602 241
219 3300025949 Ga0207667_10000965 Ga0207667_1000096522 241
220 3300025960 Ga0207651_10088227 Ga0207651_100882273 241
221 3300025960 Ga0207651_10140716 Ga0207651_101407162 241
222 3300025972 Ga0207668_10440699 Ga0207668_104406992 241
223 3300025986 Ga0207658_10065366 Ga0207658_100653662 241
224 3300025986 Ga0207658_10290904 Ga0207658_102909042 241
225 3300026041 Ga0207639_10000040 Ga0207639_1000004059 241
226 3300026075 Ga0207708_10357115 Ga0207708_103571151 241
227 3300026088 Ga0207641_10168150 Ga0207641_101681501 241
228 3300026089 Ga0207648_10106980 Ga0207648_101069802 241
229 3300026121 Ga0207683_10013215 Ga0207683_100132155 241
230 3300028379 Ga0268266_10001518 Ga0268266_1000151819 241
231 3300028380 Ga0268265_10089044 Ga0268265_100890442 241
232 3300035692 Ga0373935_0271940 Ga0373935_0271940_421_1146 241
233 3300037068 Ga0373925_0405047 Ga0373925_0405047_256_981 241
234 3300037471 Ga0395905_0072657 Ga0395905_0072657_911_1645 241
235 3300037471 Ga0395905_0445005 Ga0395905_0445005_185_931 241
236 3300046454 Ga0495592_0078785 Ga0495592_0078785_348_1073 241
237 3300046462 Ga0495651_0025382 Ga0495651_0025382_1207_1932 241
238 3300046463 Ga0495653_0240218 Ga0495653_0240218_465_1190 241
239 3300046516 Ga0495628_0048607 Ga0495628_0048607_771_1496 241
240 3300046522 Ga0495643_0002851 Ga0495643_0002851_8231_8962 241
241 3300046529 Ga0495652_0138648 Ga0495652_0138648_435_1160 241
242 3300046683 Ga0495658_0101412 Ga0495658_0101412_738_1463 241
243 3300048903 Ga0496100_0168321 Ga0496100_0168321_261_986 241
244 3300048904 Ga0496101_0179891 Ga0496101_0179891_462_1187 241
245 3300048907 Ga0496104_0039899 Ga0496104_0039899_1655_2380 241
246 3300048912 Ga0496109_0402769 Ga0496109_0402769_530_1255 241
247 3300048912 Ga0496109_0512535 Ga0496109_0512535_381_1106 241
248 3300048915 Ga0496112_0210257 Ga0496112_0210257_1060_1785 241
249 3300048917 Ga0496114_0052266 Ga0496114_0052266_1754_2479 241
250 3300050508 nmdc:mga09592_412226_c1 nmdc:mga09592_412226_c1_23_748 241
251 3300050512 nmdc:mga0n895_334491_c1 nmdc:mga0n895_334491_c1_416_1141 241
252 3300053085 Ga0495619_0020426 Ga0495619_0020426_2905_3630 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

50

106

0.84

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

125

187

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f0k-assembly1.cif.gz_A alternative complex iii 0.8459 5 241
6f0k-assembly1.cif.gz_A alternative complex iii 0.8421 5 241
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8084 4 241
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8019 4 241
6btm-assembly1.cif.gz_A structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.5671 17 241
ID Description Score Start End Superfamily
af_Q8N3F8_2_109_1.10.418.10 Mainly Alpha;Orthogonal Bundle;Actin-binding Protein, T-fimbrin; domain 1;Calponin-like domain 0.32 163 229 1.10.418.10
af_Q8N3F8_2_109_1.10.418.10 Mainly Alpha;Orthogonal Bundle;Actin-binding Protein, T-fimbrin; domain 1;Calponin-like domain 0.2136 163 229 1.10.418.10
af_Q9Y141_2_547_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.122 44 227 3.40.50.1820
af_Q9Y141_2_547_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.1197 44 227 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V6DHQ7-F1-model_v4 Cytochrome c-552/4 domain-containing protein 0.9845 160 241
AF-A0A2V6M790-F1-model_v4 Cytochrome C 0.9844 41 241
AF-A0A2V5XVR8-F1-model_v4 Cytochrome C 0.9841 124 241
AF-A0A838DGJ2-F1-model_v4 Cytochrome c3 family protein 0.9814 64 241
AF-A0A2V6IJM1-F1-model_v4 Cytochrome C 0.9787 86 241

Feature Viewer

pLDDT pTM Quality
89.62 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map