F363029

General Info

Members Datasets Scaffolds Average Seq Length
252 194 504 146

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100238295|Ga0070713_1002382951
Length 167
Sequence MQNTIYAQEAIMNQIFNQHADGVGPGKPIEILLVEDNPEDASLTIETLRDGRIRNHVTHLDDGVPAMEFLRHRAQYSGAPRPDLILLDLKLQKMHGREVLAEIKSDPDLRRIPVVIMTTSSAEQDIFESYNLHANCYLTKPVELDEFIAVVRKIEDFWMTIVKLPAA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
117 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
185 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
186 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
187 2867428634 Streptomyces sp. RP5T Isolate Unclassified
188 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
189 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
190 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
191 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
192 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
193 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
194 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 1.98
Isolates 4.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 6.35
Rhizosphere 82.94
Stem 0
Stem Tuber 0
Unclassified 17.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100238295 3300005436 Unclassified 1656
2 rootH1_10206220 3300003323 Bacteria 1601
3 Ga0055540_1000104 3300003792 Bacteria 93795
4 Ga0065712_10139767 3300005290 Bacteria 1461
5 Ga0065715_10322670 3300005293 Unclassified 999
6 Ga0070658_11689917 3300005327 Bacteria 548
7 Ga0070670_100041226 3300005331 Bacteria 3968
8 Ga0068869_100120753 3300005334 Bacteria 2004
9 Ga0068869_101271387 3300005334 Unclassified 648
10 Ga0070666_11312982 3300005335 Unclassified 540
11 Ga0070680_100039622 3300005336 Bacteria 3812
12 Ga0070680_100072930 3300005336 Unclassified 2822
13 Ga0070680_100217786 3300005336 Bacteria 1611
14 Ga0070682_100786897 3300005337 Bacteria 771
15 Ga0070689_100463155 3300005340 Bacteria 1080
16 Ga0070691_10009200 3300005341 Bacteria 4516
17 Ga0070661_100374580 3300005344 Unclassified 1121
18 Ga0070668_100372392 3300005347 Bacteria 1214
19 Ga0070669_100407171 3300005353 Bacteria 1114
20 Ga0070671_100105118 3300005355 Bacteria 2370
21 Ga0070671_101719499 3300005355 Bacteria 557
22 Ga0070674_100237486 3300005356 Bacteria 1425
23 Ga0070674_100813097 3300005356 Unclassified 808
24 Ga0070659_100380215 3300005366 Unclassified 1189
25 Ga0070667_100267422 3300005367 Bacteria 1532
26 Ga0070710_10022202 3300005437 Unclassified 3316
27 Ga0070701_10068318 3300005438 Bacteria 1893
28 Ga0070700_100107985 3300005441 Bacteria 1845
29 Ga0070708_100355645 3300005445 Bacteria 1380
30 Ga0070663_100116818 3300005455 Bacteria 2011
31 Ga0070663_100358694 3300005455 Bacteria 1182
32 Ga0070662_100166847 3300005457 Bacteria 1726
33 Ga0070681_10050630 3300005458 Bacteria 4144
34 Ga0070681_10155626 3300005458 Unclassified 2211
35 Ga0070685_10260587 3300005466 Bacteria 1153
36 Ga0070706_100021338 3300005467 Bacteria 5965
37 Ga0070707_100409740 3300005468 Unclassified 1316
38 Ga0070679_100012854 3300005530 Bacteria 8011
39 Ga0070679_100813669 3300005530 Unclassified 877
40 Ga0070684_100907640 3300005535 Unclassified 825
41 Ga0070697_100069805 3300005536 Bacteria 2879
42 Ga0070697_100501542 3300005536 Bacteria 1061
43 Ga0070697_100607956 3300005536 Bacteria 961
44 Ga0070686_100001668 3300005544 Bacteria 12391
45 Ga0070686_100069164 3300005544 Bacteria 2305
46 Ga0070695_101068272 3300005545 Unclassified 659
47 Ga0070665_100078665 3300005548 Bacteria 3304
48 Ga0070665_100226475 3300005548 Bacteria 1870
49 Ga0070665_101082924 3300005548 Bacteria 813
50 Ga0070704_100165456 3300005549 Bacteria 1753
51 Ga0068855_100146656 3300005563 Bacteria 2686
52 Ga0068855_100511442 3300005563 Unclassified 1304
53 Ga0068857_100758310 3300005577 Unclassified 925
54 Ga0068859_100477398 3300005617 Bacteria 1342
55 Ga0068864_100052067 3300005618 Bacteria 3528
56 Ga0068864_100135238 3300005618 Bacteria 2219
57 Ga0068861_101536597 3300005719 Bacteria 654
58 Ga0068851_10114513 3300005834 Bacteria 1443
59 Ga0068870_10018923 3300005840 Bacteria 3334
60 Ga0068870_10608339 3300005840 Bacteria 743
61 Ga0068863_100996372 3300005841 Bacteria 840
62 Ga0068863_101955228 3300005841 Unclassified 596
63 Ga0068858_100892773 3300005842 Bacteria 869
64 Ga0068860_100256711 3300005843 Bacteria 1703
65 Ga0068860_100588039 3300005843 Bacteria 1118
66 Ga0068862_101652245 3300005844 Bacteria 648
67 Ga0075365_10013704 3300006038 Bacteria 4862
68 Ga0075365_10470149 3300006038 Bacteria 888
69 Ga0070716_100731763 3300006173 Unclassified 759
70 Ga0070712_100028611 3300006175 Unclassified 3729
71 Ga0097621_100774969 3300006237 Bacteria 887
72 Ga0075370_10660640 3300006353 Bacteria 635
73 Ga0075434_100065986 3300006871 Bacteria 3605
74 Ga0068865_101224114 3300006881 Bacteria 665
75 Ga0097620_100477423 3300006931 Bacteria 1342
76 Ga0105240_11016416 3300009093 Bacteria 886
77 Ga0111539_10633014 3300009094 Unclassified 1246
78 Ga0111539_10811631 3300009094 Bacteria 1089
79 Ga0105245_11566001 3300009098 Bacteria 710
80 Ga0105247_10207601 3300009101 Bacteria 1319
81 Ga0105243_10043013 3300009148 Bacteria 3540
82 Ga0105237_10015918 3300009545 Bacteria 7819
83 Ga0105237_10080484 3300009545 Bacteria 3248
84 Ga0105237_10142165 3300009545 Unclassified 2394
85 Ga0105238_10299727 3300009551 Unclassified 1591
86 Ga0105249_10012430 3300009553 Bacteria 7505
87 Ga0157373_10098227 3300013100 Bacteria 2061
88 Ga0157370_10324424 3300013104 Bacteria 1420
89 Ga0157370_10448167 3300013104 Bacteria 1187
90 Ga0157369_10080524 3300013105 Bacteria 3487
91 Ga0157369_11026898 3300013105 Bacteria 844
92 Ga0157378_11677039 3300013297 Unclassified 682
93 Ga0157378_12972453 3300013297 Unclassified 526
94 Ga0157372_10314607 3300013307 Bacteria 1822
95 Ga0157372_10580069 3300013307 Unclassified 1307
96 Ga0157375_11231452 3300013308 Bacteria 879
97 Ga0163163_10542557 3300014325 Bacteria 1225
98 Ga0157380_10359377 3300014326 Bacteria 1366
99 Ga0157380_10963201 3300014326 Bacteria 884
100 Ga0157380_11261286 3300014326 Unclassified 785
101 Ga0157377_10980591 3300014745 Bacteria 638
102 Ga0157376_10961340 3300014969 Bacteria 875
103 Ga0157376_11796868 3300014969 Unclassified 649
104 Ga0206351_10371060 3300020077 Bacteria 622
105 Ga0224712_10034954 3300022467 Bacteria 1852
106 Ga0207682_10071787 3300025893 Bacteria 1468
107 Ga0207692_10015680 3300025898 Unclassified 3341
108 Ga0207643_10546618 3300025908 Bacteria 743
109 Ga0207707_10030840 3300025912 Bacteria 4690
110 Ga0207707_10058754 3300025912 Bacteria 3346
111 Ga0207695_10430291 3300025913 Bacteria 1204
112 Ga0207671_10105054 3300025914 Bacteria 2142
113 Ga0207671_10857908 3300025914 Unclassified 719
114 Ga0207660_10060723 3300025917 Bacteria 2719
115 Ga0207660_10072278 3300025917 Bacteria 2512
116 Ga0207660_10078760 3300025917 Bacteria 2416
117 Ga0207660_10337361 3300025917 Archaea 1206
118 Ga0207649_10394600 3300025920 Unclassified 1034
119 Ga0207652_10266055 3300025921 Bacteria 1547
120 Ga0207652_10466945 3300025921 Unclassified 1137
121 Ga0207646_10061664 3300025922 Bacteria 3347
122 Ga0207681_10209336 3300025923 Bacteria 1502
123 Ga0207644_10295694 3300025931 Bacteria 1303
124 Ga0207709_10020633 3300025935 Bacteria 3721
125 Ga0207670_10158679 3300025936 Bacteria 1686
126 Ga0207669_10444729 3300025937 Bacteria 1026
127 Ga0207689_10119634 3300025942 Bacteria 2167
128 Ga0207667_10393750 3300025949 Bacteria 1411
129 Ga0207712_10029513 3300025961 Bacteria 3680
130 Ga0207640_11785788 3300025981 Bacteria 556
131 Ga0207658_10333391 3300025986 Bacteria 1317
132 Ga0207658_10967987 3300025986 Bacteria 776
133 Ga0207677_10761582 3300026023 Bacteria 864
134 Ga0207678_10121144 3300026067 Bacteria 2232
135 Ga0207678_10338175 3300026067 Bacteria 1297
136 Ga0207708_10113430 3300026075 Bacteria 2106
137 Ga0207641_10406598 3300026088 Bacteria 1308
138 Ga0207676_10084364 3300026095 Bacteria 2589
139 Ga0207674_10287621 3300026116 Bacteria 1592
140 Ga0207683_11242194 3300026121 Unclassified 690
141 Ga0207428_11248956 3300027907 Unclassified 516
142 Ga0268266_10843434 3300028379 Bacteria 886
143 Ga0268266_11243875 3300028379 Bacteria 720
144 Ga0268265_11436377 3300028380 Bacteria 692
145 Ga0268264_10198482 3300028381 Bacteria 1834
146 Ga0268264_10419878 3300028381 Bacteria 1289
147 Ga0265323_10085952 3300028653 Unclassified 1057
148 Ga0265338_10168881 3300028800 Bacteria 1680
149 Ga0265327_10000604 3300031251 Bacteria 59613
150 Ga0307408_100000004 3300031548 Bacteria 572889
151 Ga0307508_10022114 3300031616 Bacteria 5781
152 Ga0307410_10255781 3300031852 Bacteria 1364
153 Ga0307409_101282674 3300031995 Bacteria 757
154 Ga0307409_102093945 3300031995 Unclassified 595
155 Ga0307416_100781097 3300032002 Bacteria 1050
156 Ga0316212_1001918 3300033547 Bacteria 2919
157 Ga0265778_018856 3300036457 Unclassified 841
158 Ga0373925_0661073 3300037068 Unclassified 861
159 Ga0395898_0155385 3300037466 Bacteria 2188
160 Ga0436364_0707683 3300037853 Unclassified 625
161 Ga0436364_1205253 3300037853 Bacteria 2460
162 Ga0400489_44600 3300039093 Bacteria 8504
163 Ga0436365_0425069 3300039437 Bacteria 1774
164 Ga0451851_0137676 3300041507 Bacteria 586
165 Ga0451853_2289554 3300041512 Bacteria 982
166 Ga0439431_0030172 3300041997 Bacteria 1342
167 Ga0450916_001388 3300042530 Bacteria 2412
168 Ga0451577_0000044 3300042876 Bacteria 329357
169 Ga0451577_0000089 3300042876 Bacteria 202609
170 Ga0453683_0000699 3300044673 Bacteria 34983
171 Ga0453683_0000808 3300044673 Bacteria 30584
172 Ga0466966_0401018 3300044684 Bacteria 824
173 Ga0466963_0512890 3300044694 Bacteria 847
174 Ga0453684_0000283 3300044712 Bacteria 219542
175 Ga0453684_0000346 3300044712 Bacteria 192656
176 Ga0453684_0139198 3300044712 Bacteria 2901
177 Ga0453684_0140726 3300044712 Bacteria 2882
178 Ga0453684_0719776 3300044712 Bacteria 1083
179 Ga0453684_1252073 3300044712 Unclassified 776
180 Ga0466968_0029676 3300044735 Bacteria 2262
181 Ga0466959_0118195 3300045049 Bacteria 1887
182 Ga0451576_0000047 3300045051 Bacteria 329357
183 Ga0451576_0171919 3300045051 Bacteria 2261
184 Ga0495629_0021903 3300046459 Bacteria 4560
185 Ga0495580_0496609 3300046472 Unclassified 815
186 Ga0495605_0001511 3300046474 Bacteria 15117
187 Ga0495639_0031998 3300046475 Bacteria 2345
188 Ga0495594_0063279 3300046499 Bacteria 2050
189 Ga0495606_0039809 3300046507 Bacteria 3162
190 Ga0495608_0377345 3300046511 Bacteria 870
191 Ga0495630_0187280 3300046517 Bacteria 1579
192 Ga0495665_0204410 3300046531 Bacteria 1023
193 Ga0495633_0087134 3300046558 Bacteria 1452
194 Ga0495667_0136058 3300046559 Bacteria 1584
195 Ga0495667_0743289 3300046559 Unclassified 607
196 Ga0495634_0468468 3300046642 Bacteria 741
197 Ga0495611_0067367 3300046648 Bacteria 1633
198 Ga0495672_0107208 3300047320 Bacteria 1505
199 Ga0495683_0019644 3300047323 Bacteria 3486
200 Ga0496100_0000612 3300048903 Bacteria 16891
201 Ga0496100_0045659 3300048903 Bacteria 2813
202 Ga0496101_0000021 3300048904 Bacteria 217090
203 Ga0496101_1048952 3300048904 Bacteria 641
204 Ga0496102_0000001 3300048905 Bacteria 873433
205 Ga0496102_0136878 3300048905 Bacteria 2295
206 Ga0496103_0000007 3300048906 Bacteria 354915
207 Ga0496104_0091368 3300048907 Bacteria 2910
208 Ga0496104_0691561 3300048907 Bacteria 928
209 Ga0496105_0636292 3300048908 Bacteria 824
210 Ga0496106_0603264 3300048909 Bacteria 879
211 Ga0496107_0032798 3300048910 Bacteria 3713
212 Ga0496108_0078631 3300048911 Bacteria 2792
213 Ga0496109_0111729 3300048912 Bacteria 2541
214 Ga0496112_0419574 3300048915 Unclassified 1277
215 Ga0496114_0084281 3300048917 Bacteria 2691
216 Ga0496116_0000018 3300048919 Bacteria 545877
217 Ga0496117_0000015 3300048920 Bacteria 583316
218 Ga0496118_0000012 3300048921 Bacteria 583316
219 Ga0496119_0000947 3300048922 Bacteria 37356
220 Ga0496120_0000195 3300048923 Bacteria 104031
221 Ga0496121_0000177 3300048924 Bacteria 141456
222 Ga0496126_0001075 3300048929 Bacteria 45977
223 Ga0496126_0156796 3300048929 Bacteria 1948
224 Ga0501314_018148 3300049530 Bacteria 714
225 Ga0501032_0025547 3300049569 Bacteria 4071
226 Ga0501034_0024212 3300049571 Bacteria 6175
227 Ga0501034_0156217 3300049571 Bacteria 2255
228 Ga0501037_0101291 3300049573 Bacteria 2079
229 Ga0501039_0789107 3300049575 Bacteria 741
230 Ga0501046_0123569 3300049580 Bacteria 1968
231 Ga0501047_0067398 3300049581 Bacteria 3449
232 Ga0501047_0455805 3300049581 Bacteria 1108
233 Ga0501035_0001983 3300049822 Bacteria 20484
234 Ga0501044_0002257 3300049823 Bacteria 22025
235 Ga0501226_000017 3300049853 Bacteria 150879
236 nmdc:mga0yw44_163438_c1 3300050492 Bacteria 1458
237 nmdc:mga0yw44_9515_c1 3300050492 Bacteria 4920
238 nmdc:mga05p37_2236202_c1 3300050507 Bacteria 506
239 nmdc:mga08y16_378805_c1 3300050511 Bacteria 1450
240 nmdc:mga0n895_95884_c1 3300050512 Bacteria 2971
241 Ga0587082_126354 3300059504 Unclassified 583
242 2585308061 2582581313 Bacteria 10042643
243 2784591186 2784132148 Bacteria 8627943
244 2785366016 2784746768 Bacteria 10036182
245 2867434650 2867428634 Bacteria 9590268
246 2877684479 2877676314 Bacteria 9512378
247 2954719333 2954711539 Bacteria 10867210
248 2954729303 2954721474 Bacteria 10456478
249 2954732505 2954731030 Bacteria 10243860
250 2954748204 2954740390 Bacteria 10229294
251 2954751384 2954749733 Bacteria 10366972
252 2954767329 2954759201 Bacteria 9358192
253 Ga0070713_100238295
254 rootH1_10206220
255 Ga0055540_1000104
256 Ga0065712_10139767
257 Ga0065715_10322670
258 Ga0070658_11689917
259 Ga0070670_100041226
260 Ga0068869_100120753
261 Ga0068869_101271387
262 Ga0070666_11312982
263 Ga0070680_100039622
264 Ga0070680_100072930
265 Ga0070680_100217786
266 Ga0070682_100786897
267 Ga0070689_100463155
268 Ga0070691_10009200
269 Ga0070661_100374580
270 Ga0070668_100372392
271 Ga0070669_100407171
272 Ga0070671_100105118
273 Ga0070671_101719499
274 Ga0070674_100237486
275 Ga0070674_100813097
276 Ga0070659_100380215
277 Ga0070667_100267422
278 Ga0070710_10022202
279 Ga0070701_10068318
280 Ga0070700_100107985
281 Ga0070708_100355645
282 Ga0070663_100116818
283 Ga0070663_100358694
284 Ga0070662_100166847
285 Ga0070681_10050630
286 Ga0070681_10155626
287 Ga0070685_10260587
288 Ga0070706_100021338
289 Ga0070707_100409740
290 Ga0070679_100012854
291 Ga0070679_100813669
292 Ga0070684_100907640
293 Ga0070697_100069805
294 Ga0070697_100501542
295 Ga0070697_100607956
296 Ga0070686_100001668
297 Ga0070686_100069164
298 Ga0070695_101068272
299 Ga0070665_100078665
300 Ga0070665_100226475
301 Ga0070665_101082924
302 Ga0070704_100165456
303 Ga0068855_100146656
304 Ga0068855_100511442
305 Ga0068857_100758310
306 Ga0068859_100477398
307 Ga0068864_100052067
308 Ga0068864_100135238
309 Ga0068861_101536597
310 Ga0068851_10114513
311 Ga0068870_10018923
312 Ga0068870_10608339
313 Ga0068863_100996372
314 Ga0068863_101955228
315 Ga0068858_100892773
316 Ga0068860_100256711
317 Ga0068860_100588039
318 Ga0068862_101652245
319 Ga0075365_10013704
320 Ga0075365_10470149
321 Ga0070716_100731763
322 Ga0070712_100028611
323 Ga0097621_100774969
324 Ga0075370_10660640
325 Ga0075434_100065986
326 Ga0068865_101224114
327 Ga0097620_100477423
328 Ga0105240_11016416
329 Ga0111539_10633014
330 Ga0111539_10811631
331 Ga0105245_11566001
332 Ga0105247_10207601
333 Ga0105243_10043013
334 Ga0105237_10015918
335 Ga0105237_10080484
336 Ga0105237_10142165
337 Ga0105238_10299727
338 Ga0105249_10012430
339 Ga0157373_10098227
340 Ga0157370_10324424
341 Ga0157370_10448167
342 Ga0157369_10080524
343 Ga0157369_11026898
344 Ga0157378_11677039
345 Ga0157378_12972453
346 Ga0157372_10314607
347 Ga0157372_10580069
348 Ga0157375_11231452
349 Ga0163163_10542557
350 Ga0157380_10359377
351 Ga0157380_10963201
352 Ga0157380_11261286
353 Ga0157377_10980591
354 Ga0157376_10961340
355 Ga0157376_11796868
356 Ga0206351_10371060
357 Ga0224712_10034954
358 Ga0207682_10071787
359 Ga0207692_10015680
360 Ga0207643_10546618
361 Ga0207707_10030840
362 Ga0207707_10058754
363 Ga0207695_10430291
364 Ga0207671_10105054
365 Ga0207671_10857908
366 Ga0207660_10060723
367 Ga0207660_10072278
368 Ga0207660_10078760
369 Ga0207660_10337361
370 Ga0207649_10394600
371 Ga0207652_10266055
372 Ga0207652_10466945
373 Ga0207646_10061664
374 Ga0207681_10209336
375 Ga0207644_10295694
376 Ga0207709_10020633
377 Ga0207670_10158679
378 Ga0207669_10444729
379 Ga0207689_10119634
380 Ga0207667_10393750
381 Ga0207712_10029513
382 Ga0207640_11785788
383 Ga0207658_10333391
384 Ga0207658_10967987
385 Ga0207677_10761582
386 Ga0207678_10121144
387 Ga0207678_10338175
388 Ga0207708_10113430
389 Ga0207641_10406598
390 Ga0207676_10084364
391 Ga0207674_10287621
392 Ga0207683_11242194
393 Ga0207428_11248956
394 Ga0268266_10843434
395 Ga0268266_11243875
396 Ga0268265_11436377
397 Ga0268264_10198482
398 Ga0268264_10419878
399 Ga0265323_10085952
400 Ga0265338_10168881
401 Ga0265327_10000604
402 Ga0307408_100000004
403 Ga0307508_10022114
404 Ga0307410_10255781
405 Ga0307409_101282674
406 Ga0307409_102093945
407 Ga0307416_100781097
408 Ga0316212_1001918
409 Ga0265778_018856
410 Ga0373925_0661073
411 Ga0395898_0155385
412 Ga0436364_0707683
413 Ga0436364_1205253
414 Ga0400489_44600
415 Ga0436365_0425069
416 Ga0451851_0137676
417 Ga0451853_2289554
418 Ga0439431_0030172
419 Ga0450916_001388
420 Ga0451577_0000044
421 Ga0451577_0000089
422 Ga0453683_0000699
423 Ga0453683_0000808
424 Ga0466966_0401018
425 Ga0466963_0512890
426 Ga0453684_0000283
427 Ga0453684_0000346
428 Ga0453684_0139198
429 Ga0453684_0140726
430 Ga0453684_0719776
431 Ga0453684_1252073
432 Ga0466968_0029676
433 Ga0466959_0118195
434 Ga0451576_0000047
435 Ga0451576_0171919
436 Ga0495629_0021903
437 Ga0495580_0496609
438 Ga0495605_0001511
439 Ga0495639_0031998
440 Ga0495594_0063279
441 Ga0495606_0039809
442 Ga0495608_0377345
443 Ga0495630_0187280
444 Ga0495665_0204410
445 Ga0495633_0087134
446 Ga0495667_0136058
447 Ga0495667_0743289
448 Ga0495634_0468468
449 Ga0495611_0067367
450 Ga0495672_0107208
451 Ga0495683_0019644
452 Ga0496100_0000612
453 Ga0496100_0045659
454 Ga0496101_0000021
455 Ga0496101_1048952
456 Ga0496102_0000001
457 Ga0496102_0136878
458 Ga0496103_0000007
459 Ga0496104_0091368
460 Ga0496104_0691561
461 Ga0496105_0636292
462 Ga0496106_0603264
463 Ga0496107_0032798
464 Ga0496108_0078631
465 Ga0496109_0111729
466 Ga0496112_0419574
467 Ga0496114_0084281
468 Ga0496116_0000018
469 Ga0496117_0000015
470 Ga0496118_0000012
471 Ga0496119_0000947
472 Ga0496120_0000195
473 Ga0496121_0000177
474 Ga0496126_0001075
475 Ga0496126_0156796
476 Ga0501314_018148
477 Ga0501032_0025547
478 Ga0501034_0024212
479 Ga0501034_0156217
480 Ga0501037_0101291
481 Ga0501039_0789107
482 Ga0501046_0123569
483 Ga0501047_0067398
484 Ga0501047_0455805
485 Ga0501035_0001983
486 Ga0501044_0002257
487 Ga0501226_000017
488 nmdc:mga0yw44_163438_c1
489 nmdc:mga0yw44_9515_c1
490 nmdc:mga05p37_2236202_c1
491 nmdc:mga08y16_378805_c1
492 nmdc:mga0n895_95884_c1
493 Ga0587082_126354
494 2585308061
495 2784591186
496 2785366016
497 2867434650
498 2877684479
499 2954719333
500 2954729303
501 2954732505
502 2954748204
503 2954751384
504 2954767329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

31

152

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xvu-assembly2.cif.gz_C bacteriophytochrome response regulator from deinococcus radiodurans 0.964 10 145
3h1f-assembly1.cif.gz_A crystal structure of chey mutant d53a of helicobacter pylori 0.9403 13 133
3h1g-assembly1.cif.gz_A crystal structure of chey mutant t84a of helicobacter pylori 0.9387 13 133
6xvu-assembly2.cif.gz_C bacteriophytochrome response regulator from deinococcus radiodurans 0.9373 10 145
3h1e-assembly1.cif.gz_A crystal structure of mg(2+) and beh(3)(-)-bound chey of helicobacter pylori 0.9371 13 133
ID Description Score Start End Superfamily
3h1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9371 13 133 3.40.50.2300
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9354 9 144 3.40.50.2300
4zylA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9289 12 144 3.40.50.2300
1k66B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9237 9 147 3.40.50.2300
af_P0AEC5_652_786_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9065 11 137 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1U7ETD9-F1-model_v4 Receiver box response regulator 0.9931 10 144 GO:0000160
AF-A0A327RJU6-F1-model_v4 Response regulator receiver domain-containing protein 0.9853 10 135 GO:0000160
AF-A0A2U3B0M2-F1-model_v4 Response regulator 0.9847 9 138 GO:0000160
AF-A0A2N3HIG8-F1-model_v4 Response regulator 0.9834 9 137 GO:0000160
AF-A0A1T1BNJ3-F1-model_v4 Response regulatory domain-containing protein 0.9826 14 133 GO:0000160

Map