F363009

General Info

Members Datasets Scaffolds Average Seq Length
252 160 504 297

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100048885|Ga0070688_1000488853
Length 325
Sequence VLAIFGYSTRLNSPRLTGNEQESVLKMKLGVALPVIDAEVGGDPGAIRDFAQAAEEIGYCDLSAPDHVLGVNAASRPGWDRNTSADLFQDPFVLFGFLAGCTRAIGFSTQVLILAQRQAVLVAKQAACLDVLCGGRFRLGIGVGWNEVEFVGLNESFRDRGRRSEEQVAVMKALWAEPHVTFKGKYHAIEDAGINPLPPRRSIPIWLGGHADATLRRVASWGDGWMPLSYGPGDEAKAAIDKMRAYAEAAGRDPADIGIDTRVTVGIGDEAAWRDTVRFWKSCGVTDLTLGTYSGRGHLRRIEGRSLSAHLAAIQRYWNAVADLL

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 93.25
Stem 0
Stem Tuber 0
Unclassified 11.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100048885 3300005365 Bacteria 2630
2 Ga0070670_100352105 3300005331 Bacteria 1294
3 Ga0068869_100018916 3300005334 Bacteria 4696
4 Ga0068869_100352216 3300005334 Bacteria 1200
5 Ga0070666_10133184 3300005335 Bacteria 1728
6 Ga0070680_100073690 3300005336 Bacteria 2808
7 Ga0070692_10145799 3300005345 Unclassified 1344
8 Ga0070669_100256415 3300005353 Bacteria 1394
9 Ga0070671_100014942 3300005355 Bacteria 6272
10 Ga0070671_100185159 3300005355 Archaea 1764
11 Ga0070703_10021665 3300005406 Bacteria 1881
12 Ga0070709_10034945 3300005434 Bacteria 3052
13 Ga0070709_10079598 3300005434 Bacteria 2135
14 Ga0070714_100028530 3300005435 Bacteria 4632
15 Ga0070714_100105653 3300005435 Bacteria 2487
16 Ga0070714_100354344 3300005435 Bacteria 1379
17 Ga0070713_100073325 3300005436 Bacteria 2898
18 Ga0070713_100168484 3300005436 Bacteria 1960
19 Ga0070713_100248226 3300005436 Unclassified 1623
20 Ga0070713_100276290 3300005436 Bacteria 1540
21 Ga0070713_100339508 3300005436 Bacteria 1391
22 Ga0070710_10021542 3300005437 Bacteria 3360
23 Ga0070710_10046143 3300005437 Bacteria 2425
24 Ga0070710_10273145 3300005437 Bacteria 1094
25 Ga0070701_10016161 3300005438 Bacteria 3463
26 Ga0070711_100005908 3300005439 Bacteria 7348
27 Ga0070711_100008603 3300005439 Bacteria 6259
28 Ga0070711_100035038 3300005439 Bacteria 3352
29 Ga0070711_100062101 3300005439 Bacteria 2603
30 Ga0070711_100161301 3300005439 Bacteria 1700
31 Ga0070705_100021366 3300005440 Bacteria 3442
32 Ga0070705_100024557 3300005440 Bacteria 3255
33 Ga0070705_100064608 3300005440 Unclassified 2187
34 Ga0070708_100388235 3300005445 Bacteria 1316
35 Ga0070678_100033423 3300005456 Bacteria 3571
36 Ga0070706_100170294 3300005467 Unclassified 2033
37 Ga0070707_100007012 3300005468 Bacteria 10451
38 Ga0070698_100012391 3300005471 Bacteria 9031
39 Ga0070698_100296940 3300005471 Bacteria 1546
40 Ga0070698_100317349 3300005471 Bacteria 1489
41 Ga0070679_100201021 3300005530 Bacteria 1959
42 Ga0070697_100600138 3300005536 Bacteria 968
43 Ga0070695_100034276 3300005545 Bacteria 3181
44 Ga0070696_100012244 3300005546 Bacteria 5749
45 Ga0070696_100044924 3300005546 Bacteria 3059
46 Ga0070696_100125655 3300005546 Unclassified 1861
47 Ga0070704_100054702 3300005549 Bacteria 2825
48 Ga0070704_100102093 3300005549 Bacteria 2163
49 Ga0068856_100032367 3300005614 Bacteria 5119
50 Ga0068856_100215590 3300005614 Bacteria 1935
51 Ga0070702_100280404 3300005615 Bacteria 1144
52 Ga0068859_100066853 3300005617 Bacteria 3629
53 Ga0068859_100177288 3300005617 Bacteria 2213
54 Ga0068859_100308848 3300005617 Bacteria 1675
55 Ga0068864_100533523 3300005618 Bacteria 1133
56 Ga0068863_100040617 3300005841 Bacteria 4424
57 Ga0068858_100264072 3300005842 Bacteria 1637
58 Ga0068860_100835225 3300005843 Bacteria 935
59 Ga0068862_100065887 3300005844 Bacteria 3120
60 Ga0068862_100359104 3300005844 Unclassified 1353
61 Ga0081455_10011740 3300005937 Bacteria 8776
62 Ga0070717_10009790 3300006028 Bacteria 7217
63 Ga0070717_10217897 3300006028 Unclassified 1677
64 Ga0070717_10346858 3300006028 Bacteria 1327
65 Ga0070717_10371407 3300006028 Unclassified 1281
66 Ga0070712_100084771 3300006175 Bacteria 2305
67 Ga0070712_100129193 3300006175 Bacteria 1913
68 Ga0070712_100161990 3300006175 Unclassified 1728
69 Ga0070712_100255153 3300006175 Unclassified 1403
70 Ga0075428_100011930 3300006844 Bacteria 9667
71 Ga0075428_100175953 3300006844 Unclassified 2318
72 Ga0075433_10169874 3300006852 Unclassified 1940
73 Ga0075434_100431173 3300006871 Unclassified 1339
74 Ga0097620_100066850 3300006931 Bacteria 3629
75 Ga0097620_100177296 3300006931 Bacteria 2213
76 Ga0097620_100308877 3300006931 Bacteria 1675
77 Ga0075435_100073853 3300007076 Bacteria 2789
78 Ga0099795_10015628 3300007788 Bacteria 2383
79 Ga0105240_10184464 3300009093 Bacteria 2459
80 Ga0114129_10674209 3300009147 Unclassified 1332
81 Ga0114129_11029697 3300009147 Bacteria 1035
82 Ga0105243_10086471 3300009148 Bacteria 2572
83 Ga0105243_10099032 3300009148 Bacteria 2416
84 Ga0105241_10066154 3300009174 Bacteria 2794
85 Ga0105242_10095275 3300009176 Bacteria 2512
86 Ga0105238_10129166 3300009551 Unclassified 2505
87 Ga0105238_10286598 3300009551 Bacteria 1629
88 Ga0105238_10459399 3300009551 Bacteria 1271
89 Ga0105249_10011118 3300009553 Bacteria 7908
90 Ga0105249_10061425 3300009553 Bacteria 3448
91 Ga0157370_10279910 3300013104 Bacteria 1541
92 Ga0163162_10502492 3300013306 Bacteria 1343
93 Ga0163163_10094838 3300014325 Bacteria 3002
94 Ga0182008_10056284 3300014497 Bacteria 1944
95 Ga0182008_10141668 3300014497 Unclassified 1203
96 Ga0157379_10246582 3300014968 Bacteria 1621
97 Ga0213872_10063829 3300021361 Bacteria 1664
98 Ga0213876_10029759 3300021384 Bacteria 2877
99 Ga0213876_10167649 3300021384 Unclassified 1168
100 Ga0213875_10001068 3300021388 Bacteria 19200
101 Ga0213875_10131471 3300021388 Bacteria 1170
102 Ga0224712_10016552 3300022467 Bacteria 2425
103 Ga0207653_10018387 3300025885 Bacteria 2201
104 Ga0207692_10058327 3300025898 Bacteria 1988
105 Ga0207699_10005641 3300025906 Bacteria 6007
106 Ga0207699_10051774 3300025906 Bacteria 2427
107 Ga0207684_10274880 3300025910 Unclassified 1453
108 Ga0207693_10016684 3300025915 Bacteria 5866
109 Ga0207693_10028257 3300025915 Bacteria 4431
110 Ga0207693_10071573 3300025915 Bacteria 2714
111 Ga0207693_10147098 3300025915 Bacteria 1852
112 Ga0207663_10001647 3300025916 Bacteria 10533
113 Ga0207663_10102354 3300025916 Bacteria 1926
114 Ga0207660_10009891 3300025917 Bacteria 6178
115 Ga0207646_10019992 3300025922 Bacteria 6211
116 Ga0207659_10214334 3300025926 Bacteria 1545
117 Ga0207700_10013626 3300025928 Bacteria 5298
118 Ga0207700_10039144 3300025928 Bacteria 3448
119 Ga0207700_10153886 3300025928 Bacteria 1903
120 Ga0207700_10266345 3300025928 Unclassified 1469
121 Ga0207664_10018555 3300025929 Bacteria 5125
122 Ga0207664_10102258 3300025929 Bacteria 2369
123 Ga0207664_10111100 3300025929 Bacteria 2280
124 Ga0207664_10279850 3300025929 Bacteria 1464
125 Ga0207644_10049933 3300025931 Bacteria 2997
126 Ga0207709_10069397 3300025935 Bacteria 2231
127 Ga0207670_10096809 3300025936 Bacteria 2100
128 Ga0207669_10161153 3300025937 Bacteria 1585
129 Ga0207665_10034002 3300025939 Bacteria 3382
130 Ga0207711_10083423 3300025941 Bacteria 2795
131 Ga0207689_10006917 3300025942 Bacteria 9977
132 Ga0207712_10076206 3300025961 Bacteria 2427
133 Ga0207712_10086629 3300025961 Bacteria 2295
134 Ga0207712_10545250 3300025961 Bacteria 997
135 Ga0207703_10453358 3300026035 Unclassified 1198
136 Ga0207703_10488039 3300026035 Bacteria 1155
137 Ga0207708_10024193 3300026075 Bacteria 4592
138 Ga0207702_10114173 3300026078 Bacteria 2407
139 Ga0207674_10527183 3300026116 Unclassified 1141
140 Ga0207683_10069804 3300026121 Bacteria 3103
141 Ga0209966_1000352 3300027695 Bacteria 14073
142 Ga0207428_10316740 3300027907 Unclassified 1153
143 Ga0268265_10514310 3300028380 Bacteria 1130
144 Ga0265334_10042986 3300028573 Bacteria 1759
145 Ga0265338_10063031 3300028800 Bacteria 3236
146 Ga0265338_10103583 3300028800 Bacteria 2311
147 Ga0373926_0008393 3300035083 Bacteria 3438
148 Ga0373926_0018333 3300035083 Bacteria 2406
149 Ga0373934_0052493 3300035086 Bacteria 1617
150 Ga0373945_0017422 3300035116 Bacteria 2433
151 Ga0373953_0002118 3300035117 Bacteria 5932
152 Ga0373953_0008119 3300035117 Bacteria 3553
153 Ga0373960_0070404 3300035121 Bacteria 1081
154 Ga0373946_0076606 3300035171 Bacteria 1456
155 Ga0373924_0085343 3300035410 Bacteria 1346
156 Ga0373924_0101707 3300035410 Bacteria 1237
157 Ga0373935_0022081 3300035692 Bacteria 3899
158 Ga0373927_0041124 3300035695 Bacteria 2998
159 Ga0373927_0084021 3300035695 Bacteria 2065
160 Ga0373927_0170413 3300035695 Bacteria 1427
161 Ga0373933_0024476 3300035724 Bacteria 3456
162 Ga0373933_0026468 3300035724 Bacteria 3331
163 Ga0373933_0091847 3300035724 Bacteria 1874
164 Ga0373947_0019329 3300035725 Bacteria 3927
165 Ga0373947_0200546 3300035725 Bacteria 1305
166 Ga0373937_0028795 3300036401 Bacteria 5029
167 Ga0373937_0031497 3300036401 Bacteria 4806
168 Ga0373937_0048127 3300036401 Bacteria 3902
169 Ga0373937_0088900 3300036401 Bacteria 2860
170 Ga0373937_0117572 3300036401 Bacteria 2476
171 Ga0373937_0311235 3300036401 Bacteria 1490
172 Ga0373925_0045518 3300037068 Bacteria 3260
173 Ga0436364_0207585 3300037853 Bacteria 136246
174 Ga0436364_0962581 3300037853 Bacteria 9356
175 Ga0436364_0997636 3300037853 Bacteria 3792
176 Ga0436365_0245780 3300039437 Unclassified 974
177 Ga0436365_1076942 3300039437 Viruses 1181
178 Ga0436365_1270311 3300039437 Bacteria 4214
179 Ga0436365_1868988 3300039437 Bacteria 11565
180 Ga0436360_0050777 3300039438 Bacteria 1205
181 Ga0436360_0080834 3300039438 Bacteria 1051
182 Ga0436360_1164861 3300039438 Unclassified 1348
183 Ga0436361_1009085 3300039447 Bacteria 3139
184 Ga0436363_0344545 3300039450 Bacteria 3323
185 Ga0436363_1016060 3300039450 Unclassified 1709
186 Ga0436363_1331666 3300039450 Bacteria 1033
187 Ga0436362_0242473 3300039453 Bacteria 2984
188 Ga0436362_1068982 3300039453 Bacteria 2079
189 Ga0436362_1072117 3300039453 Bacteria 1673
190 Ga0466963_0347527 3300044694 Bacteria 1044
191 Ga0495629_0091772 3300046459 Bacteria 2120
192 Ga0495629_0104019 3300046459 Bacteria 1981
193 Ga0495651_0009652 3300046462 Bacteria 7420
194 Ga0495653_0071415 3300046463 Bacteria 2596
195 Ga0495664_0016298 3300046477 Bacteria 4232
196 Ga0495608_0007623 3300046511 Bacteria 7630
197 Ga0495608_0117621 3300046511 Bacteria 1705
198 Ga0495628_0075785 3300046516 Bacteria 2619
199 Ga0495587_0015004 3300046536 Bacteria 4843
200 Ga0495645_0005851 3300046543 Bacteria 8489
201 Ga0495667_0069012 3300046559 Bacteria 2307
202 Ga0495667_0084858 3300046559 Bacteria 2055
203 Ga0495635_0157658 3300046663 Bacteria 1545
204 Ga0495646_0051014 3300046680 Bacteria 2505
205 Ga0495604_0017467 3300047317 Bacteria 5744
206 Ga0495674_0300100 3300047319 Unclassified 1312
207 Ga0495680_0066101 3300047322 Bacteria 2768
208 Ga0495684_0168512 3300047471 Bacteria 1630
209 Ga0495602_0005876 3300048088 Bacteria 12883
210 Ga0496104_0199181 3300048907 Bacteria 1915
211 Ga0496113_0021710 3300048916 Bacteria 4532
212 Ga0496115_0000213 3300048918 Bacteria 53968
213 Ga0501036_0187453 3300049572 Bacteria 1741
214 Ga0501039_0014768 3300049575 Bacteria 5974
215 Ga0501040_0002350 3300049576 Bacteria 12148
216 Ga0501041_0042630 3300049577 Bacteria 2758
217 Ga0501042_0128788 3300049578 Bacteria 1823
218 Ga0501046_0000084 3300049580 Bacteria 100971
219 Ga0501047_0104591 3300049581 Bacteria 2711
220 Ga0501047_0160233 3300049581 Bacteria 2122
221 Ga0501048_0035318 3300049582 Bacteria 3599
222 Ga0501068_0311544 3300049584 Bacteria 1008
223 Ga0501072_0169201 3300049588 Bacteria 1744
224 Ga0501073_0295861 3300049589 Bacteria 1117
225 Ga0501074_0073597 3300049590 Bacteria 2454
226 Ga0501075_0044866 3300049591 Bacteria 3317
227 Ga0501075_0058307 3300049591 Bacteria 2908
228 Ga0501076_0061407 3300049592 Bacteria 2991
229 Ga0501077_0028161 3300049593 Bacteria 3570
230 Ga0501079_0147999 3300049741 Bacteria 1830
231 Ga0501081_0006568 3300049743 Bacteria 7557
232 Ga0501081_0124712 3300049743 Bacteria 1837
233 Ga0501083_0105819 3300049744 Bacteria 1852
234 Ga0501045_0002899 3300049824 Bacteria 11717
235 nmdc:mga06r32_142107_c1 3300050510 Bacteria 2377
236 nmdc:mga08y16_85227_c1 3300050511 Bacteria 3293
237 nmdc:mga0n895_430780_c1 3300050512 Unclassified 1333
238 nmdc:mga0rr50_197675_c1 3300050513 Unclassified 1651
239 nmdc:mga0rr50_279273_c1 3300050513 Unclassified 1393
240 nmdc:mga0a205_349713_c1 3300050515 Unclassified 1346
241 Ga0495601_0010158 3300053077 Bacteria 5594
242 Ga0495595_0014982 3300053084 Bacteria 3300
243 Ga0495619_0147636 3300053085 Bacteria 1621
244 Ga0501084_0190037 3300054114 Bacteria 1732
245 Ga0587076_008788 3300059645 Bacteria 1419
246 Ga0587079_012048 3300059647 Bacteria 1404
247 Ga0587107_005603 3300059652 Bacteria 1335
248 Ga0501082_0000528 3300060353 Bacteria 34016
249 Ga0530510_0006319 3300061734 Bacteria 8241
250 Ga0530510_0009828 3300061734 Bacteria 6713
251 Ga0530510_0048703 3300061734 Bacteria 3063
252 Ga0530510_0131082 3300061734 Bacteria 1844
253 Ga0070688_100048885
254 Ga0070670_100352105
255 Ga0068869_100018916
256 Ga0068869_100352216
257 Ga0070666_10133184
258 Ga0070680_100073690
259 Ga0070692_10145799
260 Ga0070669_100256415
261 Ga0070671_100014942
262 Ga0070671_100185159
263 Ga0070703_10021665
264 Ga0070709_10034945
265 Ga0070709_10079598
266 Ga0070714_100028530
267 Ga0070714_100105653
268 Ga0070714_100354344
269 Ga0070713_100073325
270 Ga0070713_100168484
271 Ga0070713_100248226
272 Ga0070713_100276290
273 Ga0070713_100339508
274 Ga0070710_10021542
275 Ga0070710_10046143
276 Ga0070710_10273145
277 Ga0070701_10016161
278 Ga0070711_100005908
279 Ga0070711_100008603
280 Ga0070711_100035038
281 Ga0070711_100062101
282 Ga0070711_100161301
283 Ga0070705_100021366
284 Ga0070705_100024557
285 Ga0070705_100064608
286 Ga0070708_100388235
287 Ga0070678_100033423
288 Ga0070706_100170294
289 Ga0070707_100007012
290 Ga0070698_100012391
291 Ga0070698_100296940
292 Ga0070698_100317349
293 Ga0070679_100201021
294 Ga0070697_100600138
295 Ga0070695_100034276
296 Ga0070696_100012244
297 Ga0070696_100044924
298 Ga0070696_100125655
299 Ga0070704_100054702
300 Ga0070704_100102093
301 Ga0068856_100032367
302 Ga0068856_100215590
303 Ga0070702_100280404
304 Ga0068859_100066853
305 Ga0068859_100177288
306 Ga0068859_100308848
307 Ga0068864_100533523
308 Ga0068863_100040617
309 Ga0068858_100264072
310 Ga0068860_100835225
311 Ga0068862_100065887
312 Ga0068862_100359104
313 Ga0081455_10011740
314 Ga0070717_10009790
315 Ga0070717_10217897
316 Ga0070717_10346858
317 Ga0070717_10371407
318 Ga0070712_100084771
319 Ga0070712_100129193
320 Ga0070712_100161990
321 Ga0070712_100255153
322 Ga0075428_100011930
323 Ga0075428_100175953
324 Ga0075433_10169874
325 Ga0075434_100431173
326 Ga0097620_100066850
327 Ga0097620_100177296
328 Ga0097620_100308877
329 Ga0075435_100073853
330 Ga0099795_10015628
331 Ga0105240_10184464
332 Ga0114129_10674209
333 Ga0114129_11029697
334 Ga0105243_10086471
335 Ga0105243_10099032
336 Ga0105241_10066154
337 Ga0105242_10095275
338 Ga0105238_10129166
339 Ga0105238_10286598
340 Ga0105238_10459399
341 Ga0105249_10011118
342 Ga0105249_10061425
343 Ga0157370_10279910
344 Ga0163162_10502492
345 Ga0163163_10094838
346 Ga0182008_10056284
347 Ga0182008_10141668
348 Ga0157379_10246582
349 Ga0213872_10063829
350 Ga0213876_10029759
351 Ga0213876_10167649
352 Ga0213875_10001068
353 Ga0213875_10131471
354 Ga0224712_10016552
355 Ga0207653_10018387
356 Ga0207692_10058327
357 Ga0207699_10005641
358 Ga0207699_10051774
359 Ga0207684_10274880
360 Ga0207693_10016684
361 Ga0207693_10028257
362 Ga0207693_10071573
363 Ga0207693_10147098
364 Ga0207663_10001647
365 Ga0207663_10102354
366 Ga0207660_10009891
367 Ga0207646_10019992
368 Ga0207659_10214334
369 Ga0207700_10013626
370 Ga0207700_10039144
371 Ga0207700_10153886
372 Ga0207700_10266345
373 Ga0207664_10018555
374 Ga0207664_10102258
375 Ga0207664_10111100
376 Ga0207664_10279850
377 Ga0207644_10049933
378 Ga0207709_10069397
379 Ga0207670_10096809
380 Ga0207669_10161153
381 Ga0207665_10034002
382 Ga0207711_10083423
383 Ga0207689_10006917
384 Ga0207712_10076206
385 Ga0207712_10086629
386 Ga0207712_10545250
387 Ga0207703_10453358
388 Ga0207703_10488039
389 Ga0207708_10024193
390 Ga0207702_10114173
391 Ga0207674_10527183
392 Ga0207683_10069804
393 Ga0209966_1000352
394 Ga0207428_10316740
395 Ga0268265_10514310
396 Ga0265334_10042986
397 Ga0265338_10063031
398 Ga0265338_10103583
399 Ga0373926_0008393
400 Ga0373926_0018333
401 Ga0373934_0052493
402 Ga0373945_0017422
403 Ga0373953_0002118
404 Ga0373953_0008119
405 Ga0373960_0070404
406 Ga0373946_0076606
407 Ga0373924_0085343
408 Ga0373924_0101707
409 Ga0373935_0022081
410 Ga0373927_0041124
411 Ga0373927_0084021
412 Ga0373927_0170413
413 Ga0373933_0024476
414 Ga0373933_0026468
415 Ga0373933_0091847
416 Ga0373947_0019329
417 Ga0373947_0200546
418 Ga0373937_0028795
419 Ga0373937_0031497
420 Ga0373937_0048127
421 Ga0373937_0088900
422 Ga0373937_0117572
423 Ga0373937_0311235
424 Ga0373925_0045518
425 Ga0436364_0207585
426 Ga0436364_0962581
427 Ga0436364_0997636
428 Ga0436365_0245780
429 Ga0436365_1076942
430 Ga0436365_1270311
431 Ga0436365_1868988
432 Ga0436360_0050777
433 Ga0436360_0080834
434 Ga0436360_1164861
435 Ga0436361_1009085
436 Ga0436363_0344545
437 Ga0436363_1016060
438 Ga0436363_1331666
439 Ga0436362_0242473
440 Ga0436362_1068982
441 Ga0436362_1072117
442 Ga0466963_0347527
443 Ga0495629_0091772
444 Ga0495629_0104019
445 Ga0495651_0009652
446 Ga0495653_0071415
447 Ga0495664_0016298
448 Ga0495608_0007623
449 Ga0495608_0117621
450 Ga0495628_0075785
451 Ga0495587_0015004
452 Ga0495645_0005851
453 Ga0495667_0069012
454 Ga0495667_0084858
455 Ga0495635_0157658
456 Ga0495646_0051014
457 Ga0495604_0017467
458 Ga0495674_0300100
459 Ga0495680_0066101
460 Ga0495684_0168512
461 Ga0495602_0005876
462 Ga0496104_0199181
463 Ga0496113_0021710
464 Ga0496115_0000213
465 Ga0501036_0187453
466 Ga0501039_0014768
467 Ga0501040_0002350
468 Ga0501041_0042630
469 Ga0501042_0128788
470 Ga0501046_0000084
471 Ga0501047_0104591
472 Ga0501047_0160233
473 Ga0501048_0035318
474 Ga0501068_0311544
475 Ga0501072_0169201
476 Ga0501073_0295861
477 Ga0501074_0073597
478 Ga0501075_0044866
479 Ga0501075_0058307
480 Ga0501076_0061407
481 Ga0501077_0028161
482 Ga0501079_0147999
483 Ga0501081_0006568
484 Ga0501081_0124712
485 Ga0501083_0105819
486 Ga0501045_0002899
487 nmdc:mga06r32_142107_c1
488 nmdc:mga08y16_85227_c1
489 nmdc:mga0n895_430780_c1
490 nmdc:mga0rr50_197675_c1
491 nmdc:mga0rr50_279273_c1
492 nmdc:mga0a205_349713_c1
493 Ga0495601_0010158
494 Ga0495595_0014982
495 Ga0495619_0147636
496 Ga0501084_0190037
497 Ga0587076_008788
498 Ga0587079_012048
499 Ga0587107_005603
500 Ga0501082_0000528
501 Ga0530510_0006319
502 Ga0530510_0009828
503 Ga0530510_0048703
504 Ga0530510_0131082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

27

324

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b81-assembly2.cif.gz_C crystal structure of the luciferase-like monooxygenase from bacillus cereus 0.8101 1 285
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7855 1 296
1luc-assembly1.cif.gz_A bacterial luciferase 0.783 1 296
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.783 1 296
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7822 1 296
ID Description Score Start End Superfamily
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8427 20 292 3.20.20.30
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8367 20 292 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8217 1 293 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8189 2 296 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8181 2 262 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A382ZQK0-F1-model_v4 Luciferase-like domain-containing protein 0.9405 1 222 GO:0008726
GO:0046306
AF-A0A2E6YJT3-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9351 1 288 GO:0008726
GO:0046306
AF-A0A535FDR7-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9346 136 293 GO:0008726
GO:0046306
AF-A0A653ESX8-F1-model_v4 Pyrimidine monooxygenase RutA 0.9327 1 291 GO:0008726
GO:0046306
AF-A0A7W1NRX5-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9318 1 294 GO:0008726
GO:0046306

Map