F362923

General Info

Members Datasets Scaffolds Average Seq Length
252 142 505 292

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10003765|Ga0065714_100037656
Length 295
Sequence MKVSGFTFIRNAVKNDYPIVEAITSILPLCDEFIVALGDSEDETENLINGIGSPKIKIVHTVWDTSVRDGGKVFADETDKAFDAISPDTDWAFYIQGDEVVHEKYLSLIKKEMEENLSDNKVEGLLFKYLHFYGSYDYYGHSRRWYRREIRIVRNNKSIRSYRDAQGFRWADNRKIRVKLINAYIYHYGWVKPPSGLANKLRNFNQFYHDDEWMAQNLPETFTFDYSHKNPDRLMHFTGTHPAVMQKRLAATNWSLDIDLKELDKKMSLRRKALQKIEDLTGWRVSEYRNYEIVK

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
120 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
121 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
122 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
123 2738541283 Pedobacter sp. OK701 Isolate Unclassified
124 2738541302 Pedobacter sp. CF074 Isolate Unclassified
125 2738543023 Pedobacter sp. OK628 Isolate Unclassified
126 2739367651 Pedobacter sp. OK291 Isolate Unclassified
127 2739367656 Pedobacter sp. CF523 Isolate Unclassified
128 2739367663 Pedobacter sp. YR510 Isolate Unclassified
129 2818991437 Pedobacter terrae 518 Isolate Unclassified
130 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
131 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
132 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
133 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
134 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
135 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
136 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
137 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
138 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
139 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
140 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
141 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
142 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.87
Metatranscriptomes 0.4
Isolates 8.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.94
Nodule 0
Rhizoplane 0.79
Rhizosphere 80.56
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10003765 3300005288 Bacteria 11166
2 JGI24736J21556_1000902 3300001904 Bacteria 5483
3 JGI24739J22299_10016677 3300001989 Bacteria 2655
4 JGI24737J22298_10005695 3300001990 Bacteria 4287
5 JGI24737J22298_10010970 3300001990 Bacteria 2976
6 JGI24735J21928_10000001 3300002067 Bacteria 650042
7 JGI25162J39368_1000141 3300002737 Bacteria 77973
8 JGI25152J39213_1000016 3300002773 Bacteria 110433
9 JGI25150J39212_1000003 3300002774 Bacteria 508651
10 JGI25150J39212_1000004 3300002774 Bacteria 417320
11 JGI25151J46595_10000002 3300003187 Bacteria 731381
12 JGI25153J46596_10000015 3300003215 Bacteria 289820
13 rootH1_10044460 3300003316 Bacteria 10176
14 rootH1_10044460 3300003323 Bacteria 12555
15 rootH1_10115464 3300003316 Unclassified 1351
16 rootH2_10335944 3300003320 Bacteria 1812
17 rootH1_10058585 3300003323 Bacteria 10156
18 rootH1_10085439 3300003323 Bacteria 2485
19 Ga0055536_1000006 3300003781 Bacteria 347733
20 Ga0055530_10000379 3300003791 Bacteria 40382
21 Ga0058863_11424898 3300004799 Bacteria 3668
22 Ga0065714_10002432 3300005288 Bacteria 18080
23 Ga0065714_10078973 3300005288 Bacteria 2554
24 Ga0065714_10080733 3300005288 Unclassified 2420
25 Ga0065714_10131827 3300005288 Bacteria 1243
26 Ga0070658_10028555 3300005327 Unclassified 4480
27 Ga0070680_100026859 3300005336 Bacteria 4606
28 Ga0070680_100204978 3300005336 Bacteria 1663
29 Ga0068868_100101099 3300005338 Bacteria 2333
30 Ga0070660_100030454 3300005339 Bacteria 4049
31 Ga0070660_100063344 3300005339 Bacteria 2875
32 Ga0070661_100190940 3300005344 Bacteria 1562
33 Ga0070710_10176104 3300005437 Bacteria 1336
34 Ga0070662_100006156 3300005457 Bacteria 7715
35 Ga0070662_100416785 3300005457 Bacteria 1110
36 Ga0070681_10009257 3300005458 Bacteria 9682
37 Ga0070679_100093209 3300005530 Bacteria 2999
38 Ga0070679_100487143 3300005530 Bacteria 1177
39 Ga0070684_100393565 3300005535 Unclassified 1277
40 Ga0068853_100215337 3300005539 Bacteria 1752
41 Ga0068853_100504505 3300005539 Bacteria 1142
42 Ga0068855_100000155 3300005563 Bacteria 86903
43 Ga0068855_100026390 3300005563 Bacteria 6948
44 Ga0068855_100045704 3300005563 Bacteria 5178
45 Ga0068855_100172516 3300005563 Bacteria 2449
46 Ga0068855_100799000 3300005563 Bacteria 1003
47 Ga0068857_100156470 3300005577 Bacteria 2067
48 Ga0068854_100007114 3300005578 Bacteria 7145
49 Ga0068856_100013088 3300005614 Bacteria 8036
50 Ga0068856_100547158 3300005614 Bacteria 1179
51 Ga0068852_100005008 3300005616 Bacteria 9424
52 Ga0068858_100014667 3300005842 Bacteria 7378
53 Ga0075366_10002457 3300006195 Bacteria 9486
54 Ga0097621_100517804 3300006237 Bacteria 1082
55 Ga0105240_10007257 3300009093 Bacteria 16134
56 Ga0105240_10010049 3300009093 Bacteria 13326
57 Ga0105240_10139443 3300009093 Bacteria 2900
58 Ga0105240_10157635 3300009093 Bacteria 2698
59 Ga0105240_10200812 3300009093 Bacteria 2337
60 Ga0105240_10244250 3300009093 Bacteria 2080
61 Ga0105241_10071221 3300009174 Bacteria 2698
62 Ga0105237_10000481 3300009545 Bacteria 56729
63 Ga0105237_10001840 3300009545 Bacteria 27293
64 Ga0105237_10036173 3300009545 Bacteria 4996
65 Ga0105237_10045561 3300009545 Bacteria 4413
66 Ga0105237_10070420 3300009545 Bacteria 3493
67 Ga0105237_10158297 3300009545 Bacteria 2262
68 Ga0105237_10630813 3300009545 Bacteria 1079
69 Ga0105238_10025265 3300009551 Bacteria 6054
70 Ga0105239_10000865 3300010375 Bacteria 43041
71 Ga0105239_10001327 3300010375 Bacteria 33331
72 Ga0105239_10004229 3300010375 Bacteria 17242
73 Ga0105239_10009782 3300010375 Bacteria 10777
74 Ga0105239_10041307 3300010375 Bacteria 5055
75 Ga0105239_10351993 3300010375 Bacteria 1663
76 Ga0105239_10359833 3300010375 Bacteria 1643
77 Ga0157373_10000090 3300013100 Bacteria 78142
78 Ga0157373_10018277 3300013100 Bacteria 5105
79 Ga0157373_10047711 3300013100 Unclassified 3054
80 Ga0157373_10108000 3300013100 Bacteria 1957
81 Ga0157371_10001813 3300013102 Bacteria 21557
82 Ga0157371_10002322 3300013102 Bacteria 18276
83 Ga0157371_10063594 3300013102 Bacteria 2615
84 Ga0157371_10073301 3300013102 Bacteria 2425
85 Ga0157371_10183648 3300013102 Bacteria 1496
86 Ga0157370_10005173 3300013104 Bacteria 14710
87 Ga0157370_10005382 3300013104 Bacteria 14371
88 Ga0157370_10008393 3300013104 Bacteria 11142
89 Ga0157370_10035528 3300013104 Bacteria 4842
90 Ga0157370_10039249 3300013104 Bacteria 4576
91 Ga0157370_10243717 3300013104 Bacteria 1663
92 Ga0157369_10000047 3300013105 Bacteria 172682
93 Ga0157369_10035923 3300013105 Bacteria 5431
94 Ga0157369_10069732 3300013105 Bacteria 3776
95 Ga0157374_10000742 3300013296 Bacteria 28401
96 Ga0157374_10173725 3300013296 Bacteria 2103
97 Ga0157378_10007744 3300013297 Bacteria 9374
98 Ga0163162_10000631 3300013306 Bacteria 32664
99 Ga0163162_10004006 3300013306 Bacteria 14134
100 Ga0163162_10028948 3300013306 Bacteria 5482
101 Ga0163162_10046336 3300013306 Bacteria 4357
102 Ga0157372_10002968 3300013307 Bacteria 18277
103 Ga0157372_10003495 3300013307 Bacteria 16933
104 Ga0157372_10065589 3300013307 Bacteria 4077
105 Ga0157372_10087078 3300013307 Bacteria 3543
106 Ga0157372_10169020 3300013307 Bacteria 2529
107 Ga0157372_10268939 3300013307 Bacteria 1980
108 Ga0157375_10018456 3300013308 Bacteria 6327
109 Ga0182008_10000169 3300014497 Bacteria 50985
110 Ga0182008_10000395 3300014497 Bacteria 33809
111 Ga0157377_10017714 3300014745 Bacteria 3689
112 Ga0182006_1000224 3300015261 Bacteria 54977
113 Ga0182006_1000637 3300015261 Bacteria 24868
114 Ga0182006_1008451 3300015261 Bacteria 4663
115 Ga0182007_10000005 3300015262 Bacteria 442702
116 Ga0182007_10038016 3300015262 Bacteria 1615
117 Ga0183373_1002 3300015682 Bacteria 990153
118 Ga0163161_10000158 3300017792 Bacteria 62560
119 Ga0163161_10001372 3300017792 Bacteria 18055
120 Ga0163161_10001688 3300017792 Bacteria 16210
121 Ga0163161_10036532 3300017792 Bacteria 3518
122 Ga0163161_10044010 3300017792 Bacteria 3214
123 Ga0163161_10053437 3300017792 Bacteria 2930
124 Ga0209437_100070 3300025233 Bacteria 306718
125 Ga0207425_1000003 3300025245 Bacteria 1145342
126 Ga0209026_1000404 3300025250 Bacteria 38293
127 Ga0209026_1001146 3300025250 Bacteria 12432
128 Ga0209129_1000014 3300025258 Bacteria 509018
129 Ga0209129_1013868 3300025258 Bacteria 1747
130 Ga0209676_1000039 3300025292 Bacteria 443158
131 Ga0209025_1000007 3300025294 Bacteria 1145109
132 Ga0209758_1000012 3300025297 Bacteria 949866
133 Ga0209050_1000033 3300025298 Bacteria 442615
134 Ga0207647_10000231 3300025904 Bacteria 46261
135 Ga0207647_10021224 3300025904 Bacteria 4338
136 Ga0207654_10062364 3300025911 Bacteria 2184
137 Ga0207707_10010461 3300025912 Bacteria 8050
138 Ga0207695_10000142 3300025913 Bacteria 214715
139 Ga0207695_10003692 3300025913 Bacteria 21326
140 Ga0207695_10038847 3300025913 Bacteria 5120
141 Ga0207695_10041021 3300025913 Unclassified 4956
142 Ga0207695_10042908 3300025913 Bacteria 4824
143 Ga0207695_10090453 3300025913 Bacteria 3076
144 Ga0207695_10254909 3300025913 Bacteria 1653
145 Ga0207695_10600462 3300025913 Bacteria 982
146 Ga0207671_10000815 3300025914 Bacteria 39441
147 Ga0207671_10010835 3300025914 Bacteria 7479
148 Ga0207671_10026656 3300025914 Bacteria 4327
149 Ga0207671_10048482 3300025914 Bacteria 3144
150 Ga0207660_10011657 3300025917 Bacteria 5732
151 Ga0207649_10212292 3300025920 Bacteria 1374
152 Ga0207652_10016052 3300025921 Bacteria 6106
153 Ga0207652_10468596 3300025921 Bacteria 1135
154 Ga0207706_10000406 3300025933 Bacteria 46320
155 Ga0207706_10299886 3300025933 Bacteria 1400
156 Ga0207667_10000015 3300025949 Bacteria 417534
157 Ga0207667_10000419 3300025949 Bacteria 57239
158 Ga0207667_10000953 3300025949 Bacteria 36919
159 Ga0207667_10026756 3300025949 Bacteria 6294
160 Ga0207667_10207466 3300025949 Bacteria 2009
161 Ga0207667_10233747 3300025949 Bacteria 1882
162 Ga0207640_10011600 3300025981 Bacteria 4994
163 Ga0207702_10000163 3300026078 Bacteria 79263
164 Ga0207702_10037229 3300026078 Bacteria 4071
165 Ga0207674_10042445 3300026116 Bacteria 4697
166 Ga0207674_10179806 3300026116 Bacteria 2067
167 Ga0207698_10007210 3300026142 Bacteria 6966
168 Ga0307515_10014856 3300028794 Bacteria 14394
169 Ga0307515_10076860 3300028794 Bacteria 4419
170 Ga0265327_10001093 3300031251 Bacteria 37634
171 Ga0307509_10046984 3300031507 Bacteria 4645
172 Ga0316576_10299939 3300031727 Unclassified 1201
173 Ga0307405_10000009 3300031731 Bacteria 259388
174 Ga0307407_10000001 3300031903 Bacteria 570048
175 Ga0307412_10206014 3300031911 Bacteria 1497
176 Ga0307409_100108779 3300031995 Bacteria 2319
177 Ga0307416_100000008 3300032002 Bacteria 401343
178 Ga0307507_10001815 3300033179 Bacteria 46860
179 Ga0395899_0000017 3300037312 Bacteria 440179
180 Ga0395900_0004237 3300037418 Bacteria 15226
181 Ga0395898_0032945 3300037466 Bacteria 5172
182 Ga0395901_0024980 3300038443 Bacteria 6132
183 Ga0466959_0059003 3300045049 Unclassified 2795
184 Ga0495650_0000014 3300046471 Bacteria 581606
185 Ga0495650_0028904 3300046471 Bacteria 2535
186 Ga0495585_0001451 3300046492 Bacteria 18615
187 Ga0495585_0002526 3300046492 Bacteria 13003
188 Ga0495607_0129101 3300046501 Bacteria 1318
189 Ga0495606_0000241 3300046507 Bacteria 96663
190 Ga0495606_0078108 3300046507 Bacteria 2065
191 Ga0495606_0193520 3300046507 Bacteria 1164
192 Ga0495610_0000338 3300046512 Bacteria 49305
193 Ga0495610_0001603 3300046512 Bacteria 19932
194 Ga0495610_0001644 3300046512 Bacteria 19645
195 Ga0495616_0001895 3300046513 Bacteria 14129
196 Ga0495616_0009577 3300046513 Bacteria 5654
197 Ga0495616_0084660 3300046513 Bacteria 1511
198 Ga0495631_0104445 3300046518 Bacteria 1219
199 Ga0495648_0008221 3300046524 Bacteria 8228
200 Ga0495652_0078079 3300046529 Bacteria 2742
201 Ga0495609_0001800 3300046538 Bacteria 13764
202 Ga0495633_0000027 3300046558 Bacteria 204613
203 Ga0495633_0053510 3300046558 Bacteria 1900
204 Ga0495633_0106553 3300046558 Bacteria 1300
205 Ga0495668_0000010 3300046616 Bacteria 487308
206 Ga0495668_0167178 3300046616 Bacteria 1205
207 Ga0495625_0000003 3300046660 Bacteria 686847
208 Ga0495625_0000381 3300046660 Bacteria 67732
209 Ga0495625_0003720 3300046660 Bacteria 14873
210 Ga0495625_0017279 3300046660 Bacteria 5648
211 Ga0495625_0053458 3300046660 Bacteria 2888
212 Ga0495625_0077632 3300046660 Bacteria 2319
213 Ga0495625_0117578 3300046660 Bacteria 1812
214 Ga0495661_0003567 3300046665 Bacteria 11452
215 Ga0495661_0014257 3300046665 Bacteria 5326
216 Ga0495661_0029907 3300046665 Bacteria 3473
217 Ga0495649_0000002 3300046694 Bacteria 1093458
218 Ga0495660_0029043 3300046810 Bacteria 3122
219 Ga0495660_0080350 3300046810 Bacteria 1711
220 Ga0495687_000785 3300047443 Bacteria 34129
221 Ga0495681_0179463 3300047470 Bacteria 871
222 Ga0495686_0001273 3300047472 Bacteria 28543
223 Ga0495614_0058976 3300048089 Bacteria 1648
224 Ga0496115_0210540 3300048918 Bacteria 1606
225 Ga0496122_0000836 3300048925 Bacteria 58266
226 Ga0496123_0003773 3300048926 Bacteria 16604
227 Ga0496125_0081992 3300048928 Unclassified 2461
228 Ga0501223_000905 3300049663 Bacteria 7019
229 nmdc:mga0k408_1219_c1 3300050493 Bacteria 14084
230 Ga0500622_0000302 3300053156 Bacteria 50416
231 Ga0500624_000397 3300053157 Bacteria 13683
232 2586206737 2585427687 Bacteria 5544917
233 2599477283 2599185184 Bacteria 6430550
234 2738759164 2738541283 Bacteria 7222293
235 2738854922 2738541302 Bacteria 5944758
236 2739303090 2738543023 Bacteria 6767879
237 2739586962 2739367651 Bacteria 6359826
238 2739614703 2739367656 Bacteria 5152243
239 2739648114 2739367663 Bacteria 5040914
240 2819547416 2818991437 Bacteria 5805520
241 2842727596 2842722452 Bacteria 6263924
242 2842911198 2842909656 Bacteria 6185908
243 2849283151 2849281842 Bacteria 6065644
244 2852626335 2852623160 Bacteria 4376875
245 2857631510 2857627736 Bacteria 5625397
246 2884934786 2884933994 Bacteria 4535041
247 2904447881 2904445276 Bacteria 5310396
248 2928079200 2928078545 Bacteria 6534839
249 2928148429 2928147474 Bacteria 6512076
250 2932085725 2932082852 Bacteria 6563563
251 2946003262 2945997725 Bacteria 6404843
252 2954020135 2954016120 Bacteria 6446024
253 2977235034 2977232053 Bacteria 5485925
254 Ga0065714_10003765
255 JGI24736J21556_1000902
256 JGI24739J22299_10016677
257 JGI24737J22298_10005695
258 JGI24737J22298_10010970
259 JGI24735J21928_10000001
260 JGI25162J39368_1000141
261 JGI25152J39213_1000016
262 JGI25150J39212_1000003
263 JGI25150J39212_1000004
264 JGI25151J46595_10000002
265 JGI25153J46596_10000015
266 rootH1_10044460
267 rootH1_10115464
268 rootH2_10335944
269 rootH1_10058585
270 rootH1_10085439
271 Ga0055536_1000006
272 Ga0055530_10000379
273 Ga0058863_11424898
274 Ga0065714_10002432
275 Ga0065714_10078973
276 Ga0065714_10080733
277 Ga0065714_10131827
278 Ga0070658_10028555
279 Ga0070680_100026859
280 Ga0070680_100204978
281 Ga0068868_100101099
282 Ga0070660_100030454
283 Ga0070660_100063344
284 Ga0070661_100190940
285 Ga0070710_10176104
286 Ga0070662_100006156
287 Ga0070662_100416785
288 Ga0070681_10009257
289 Ga0070679_100093209
290 Ga0070679_100487143
291 Ga0070684_100393565
292 Ga0068853_100215337
293 Ga0068853_100504505
294 Ga0068855_100000155
295 Ga0068855_100026390
296 Ga0068855_100045704
297 Ga0068855_100172516
298 Ga0068855_100799000
299 Ga0068857_100156470
300 Ga0068854_100007114
301 Ga0068856_100013088
302 Ga0068856_100547158
303 Ga0068852_100005008
304 Ga0068858_100014667
305 Ga0075366_10002457
306 Ga0097621_100517804
307 Ga0105240_10007257
308 Ga0105240_10010049
309 Ga0105240_10139443
310 Ga0105240_10157635
311 Ga0105240_10200812
312 Ga0105240_10244250
313 Ga0105241_10071221
314 Ga0105237_10000481
315 Ga0105237_10001840
316 Ga0105237_10036173
317 Ga0105237_10045561
318 Ga0105237_10070420
319 Ga0105237_10158297
320 Ga0105237_10630813
321 Ga0105238_10025265
322 Ga0105239_10000865
323 Ga0105239_10001327
324 Ga0105239_10004229
325 Ga0105239_10009782
326 Ga0105239_10041307
327 Ga0105239_10351993
328 Ga0105239_10359833
329 Ga0157373_10000090
330 Ga0157373_10018277
331 Ga0157373_10047711
332 Ga0157373_10108000
333 Ga0157371_10001813
334 Ga0157371_10002322
335 Ga0157371_10063594
336 Ga0157371_10073301
337 Ga0157371_10183648
338 Ga0157370_10005173
339 Ga0157370_10005382
340 Ga0157370_10008393
341 Ga0157370_10035528
342 Ga0157370_10039249
343 Ga0157370_10243717
344 Ga0157369_10000047
345 Ga0157369_10035923
346 Ga0157369_10069732
347 Ga0157374_10000742
348 Ga0157374_10173725
349 Ga0157378_10007744
350 Ga0163162_10000631
351 Ga0163162_10004006
352 Ga0163162_10028948
353 Ga0163162_10046336
354 Ga0157372_10002968
355 Ga0157372_10003495
356 Ga0157372_10065589
357 Ga0157372_10087078
358 Ga0157372_10169020
359 Ga0157372_10268939
360 Ga0157375_10018456
361 Ga0182008_10000169
362 Ga0182008_10000395
363 Ga0157377_10017714
364 Ga0182006_1000224
365 Ga0182006_1000637
366 Ga0182006_1008451
367 Ga0182007_10000005
368 Ga0182007_10038016
369 Ga0183373_1002
370 Ga0163161_10000158
371 Ga0163161_10001372
372 Ga0163161_10001688
373 Ga0163161_10036532
374 Ga0163161_10044010
375 Ga0163161_10053437
376 Ga0209437_100070
377 Ga0207425_1000003
378 Ga0209026_1000404
379 Ga0209026_1001146
380 Ga0209129_1000014
381 Ga0209129_1013868
382 Ga0209676_1000039
383 Ga0209025_1000007
384 Ga0209758_1000012
385 Ga0209050_1000033
386 Ga0207647_10000231
387 Ga0207647_10021224
388 Ga0207654_10062364
389 Ga0207707_10010461
390 Ga0207695_10000142
391 Ga0207695_10003692
392 Ga0207695_10038847
393 Ga0207695_10041021
394 Ga0207695_10042908
395 Ga0207695_10090453
396 Ga0207695_10254909
397 Ga0207695_10600462
398 Ga0207671_10000815
399 Ga0207671_10010835
400 Ga0207671_10026656
401 Ga0207671_10048482
402 Ga0207660_10011657
403 Ga0207649_10212292
404 Ga0207652_10016052
405 Ga0207652_10468596
406 Ga0207706_10000406
407 Ga0207706_10299886
408 Ga0207667_10000015
409 Ga0207667_10000419
410 Ga0207667_10000953
411 Ga0207667_10026756
412 Ga0207667_10207466
413 Ga0207667_10233747
414 Ga0207640_10011600
415 Ga0207702_10000163
416 Ga0207702_10037229
417 Ga0207674_10042445
418 Ga0207674_10179806
419 Ga0207698_10007210
420 Ga0307515_10014856
421 Ga0307515_10076860
422 Ga0265327_10001093
423 Ga0307509_10046984
424 Ga0316576_10299939
425 Ga0307405_10000009
426 Ga0307407_10000001
427 Ga0307412_10206014
428 Ga0307409_100108779
429 Ga0307416_100000008
430 Ga0307507_10001815
431 Ga0395899_0000017
432 Ga0395900_0004237
433 Ga0395898_0032945
434 Ga0395901_0024980
435 Ga0466959_0059003
436 Ga0495650_0000014
437 Ga0495650_0028904
438 Ga0495585_0001451
439 Ga0495585_0002526
440 Ga0495607_0129101
441 Ga0495606_0000241
442 Ga0495606_0078108
443 Ga0495606_0193520
444 Ga0495610_0000338
445 Ga0495610_0001603
446 Ga0495610_0001644
447 Ga0495616_0001895
448 Ga0495616_0009577
449 Ga0495616_0084660
450 Ga0495631_0104445
451 Ga0495648_0008221
452 Ga0495652_0078079
453 Ga0495609_0001800
454 Ga0495633_0000027
455 Ga0495633_0053510
456 Ga0495633_0106553
457 Ga0495668_0000010
458 Ga0495668_0167178
459 Ga0495625_0000003
460 Ga0495625_0000381
461 Ga0495625_0003720
462 Ga0495625_0017279
463 Ga0495625_0053458
464 Ga0495625_0077632
465 Ga0495625_0117578
466 Ga0495661_0003567
467 Ga0495661_0014257
468 Ga0495661_0029907
469 Ga0495649_0000002
470 Ga0495660_0029043
471 Ga0495660_0080350
472 Ga0495687_000785
473 Ga0495681_0179463
474 Ga0495686_0001273
475 Ga0495614_0058976
476 Ga0496115_0210540
477 Ga0496122_0000836
478 Ga0496123_0003773
479 Ga0496125_0081992
480 Ga0501223_000905
481 nmdc:mga0k408_1219_c1
482 Ga0500622_0000302
483 Ga0500624_000397
484 2586206737
485 2599477283
486 2738759164
487 2738854922
488 2739303090
489 2739586962
490 2739614703
491 2739648114
492 2819547416
493 2842727596
494 2842911198
495 2849283151
496 2852626335
497 2857631510
498 2884934786
499 2904447881
500 2928079200
501 2928148429
502 2932085725
503 2946003262
504 2954020135
505 2977235034

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msp-assembly2.cif.gz_B suns glycosin s-glycosyltransferase 0.7316 2 215
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.7289 2 133
1qgs-assembly1.cif.gz_A udp-magnesium complex of spsa from bacillus subtilis 0.7287 1 132
1h7l-assembly1.cif.gz_A dtdp-magnesium complex of spsa from bacillus subtilis 0.7274 1 132
3bcv-assembly1.cif.gz_B crystal structure of a putative glycosyltransferase from bacteroides fragilis 0.7054 2 128
ID Description Score Start End Superfamily
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7786 3 137 3.90.550.10
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7786 2 129 3.90.550.10
af_P71795_2_224_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7379 2 129 3.90.550.10
1h7lA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7274 1 132 3.90.550.10
af_P77414_1_259_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7212 3 132 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A5N7ZJ12-F1-model_v4 Glycosyltransferase family 2 protein 0.9967 1 101 GO:0016740
AF-A0A524IPX7-F1-model_v4 Glycosyltransferase 0.9912 1 132 GO:0016740
AF-A0A6N7M9C6-F1-model_v4 Glycosyltransferase family 2 protein 0.9878 1 177 GO:0016740
AF-A0A5N7ZJ12-F1-model_v4 Glycosyltransferase family 2 protein 0.987 1 101 GO:0016740
AF-A0A3D2XID0-F1-model_v4 Glycosyl transferase 0.9866 1 161 GO:0016740

Map