F362923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 142 | 505 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10003765|Ga0065714_100037656 |
| Length | 295 |
| Sequence | MKVSGFTFIRNAVKNDYPIVEAITSILPLCDEFIVALGDSEDETENLINGIGSPKIKIVHTVWDTSVRDGGKVFADETDKAFDAISPDTDWAFYIQGDEVVHEKYLSLIKKEMEENLSDNKVEGLLFKYLHFYGSYDYYGHSRRWYRREIRIVRNNKSIRSYRDAQGFRWADNRKIRVKLINAYIYHYGWVKPPSGLANKLRNFNQFYHDDEWMAQNLPETFTFDYSHKNPDRLMHFTGTHPAVMQKRLAATNWSLDIDLKELDKKMSLRRKALQKIEDLTGWRVSEYRNYEIVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 81 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 82 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 83 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 84 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 87 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 88 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 93 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 114 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 115 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 116 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 117 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 118 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 119 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 120 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 121 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 122 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 123 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 124 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 125 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 126 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 127 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 128 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 129 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 130 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 131 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 132 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 133 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 134 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 135 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 136 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 137 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 138 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 139 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 140 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 141 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 142 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.87 |
| Metatranscriptomes | 0.4 |
| Isolates | 8.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.94 |
| Nodule | 0 |
| Rhizoplane | 0.79 |
| Rhizosphere | 80.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10003765 | 3300005288 | Bacteria | 11166 |
| 2 | JGI24736J21556_1000902 | 3300001904 | Bacteria | 5483 |
| 3 | JGI24739J22299_10016677 | 3300001989 | Bacteria | 2655 |
| 4 | JGI24737J22298_10005695 | 3300001990 | Bacteria | 4287 |
| 5 | JGI24737J22298_10010970 | 3300001990 | Bacteria | 2976 |
| 6 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 7 | JGI25162J39368_1000141 | 3300002737 | Bacteria | 77973 |
| 8 | JGI25152J39213_1000016 | 3300002773 | Bacteria | 110433 |
| 9 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 10 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 11 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 12 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 13 | rootH1_10044460 | 3300003316 | Bacteria | 10176 |
| 14 | rootH1_10044460 | 3300003323 | Bacteria | 12555 |
| 15 | rootH1_10115464 | 3300003316 | Unclassified | 1351 |
| 16 | rootH2_10335944 | 3300003320 | Bacteria | 1812 |
| 17 | rootH1_10058585 | 3300003323 | Bacteria | 10156 |
| 18 | rootH1_10085439 | 3300003323 | Bacteria | 2485 |
| 19 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 20 | Ga0055530_10000379 | 3300003791 | Bacteria | 40382 |
| 21 | Ga0058863_11424898 | 3300004799 | Bacteria | 3668 |
| 22 | Ga0065714_10002432 | 3300005288 | Bacteria | 18080 |
| 23 | Ga0065714_10078973 | 3300005288 | Bacteria | 2554 |
| 24 | Ga0065714_10080733 | 3300005288 | Unclassified | 2420 |
| 25 | Ga0065714_10131827 | 3300005288 | Bacteria | 1243 |
| 26 | Ga0070658_10028555 | 3300005327 | Unclassified | 4480 |
| 27 | Ga0070680_100026859 | 3300005336 | Bacteria | 4606 |
| 28 | Ga0070680_100204978 | 3300005336 | Bacteria | 1663 |
| 29 | Ga0068868_100101099 | 3300005338 | Bacteria | 2333 |
| 30 | Ga0070660_100030454 | 3300005339 | Bacteria | 4049 |
| 31 | Ga0070660_100063344 | 3300005339 | Bacteria | 2875 |
| 32 | Ga0070661_100190940 | 3300005344 | Bacteria | 1562 |
| 33 | Ga0070710_10176104 | 3300005437 | Bacteria | 1336 |
| 34 | Ga0070662_100006156 | 3300005457 | Bacteria | 7715 |
| 35 | Ga0070662_100416785 | 3300005457 | Bacteria | 1110 |
| 36 | Ga0070681_10009257 | 3300005458 | Bacteria | 9682 |
| 37 | Ga0070679_100093209 | 3300005530 | Bacteria | 2999 |
| 38 | Ga0070679_100487143 | 3300005530 | Bacteria | 1177 |
| 39 | Ga0070684_100393565 | 3300005535 | Unclassified | 1277 |
| 40 | Ga0068853_100215337 | 3300005539 | Bacteria | 1752 |
| 41 | Ga0068853_100504505 | 3300005539 | Bacteria | 1142 |
| 42 | Ga0068855_100000155 | 3300005563 | Bacteria | 86903 |
| 43 | Ga0068855_100026390 | 3300005563 | Bacteria | 6948 |
| 44 | Ga0068855_100045704 | 3300005563 | Bacteria | 5178 |
| 45 | Ga0068855_100172516 | 3300005563 | Bacteria | 2449 |
| 46 | Ga0068855_100799000 | 3300005563 | Bacteria | 1003 |
| 47 | Ga0068857_100156470 | 3300005577 | Bacteria | 2067 |
| 48 | Ga0068854_100007114 | 3300005578 | Bacteria | 7145 |
| 49 | Ga0068856_100013088 | 3300005614 | Bacteria | 8036 |
| 50 | Ga0068856_100547158 | 3300005614 | Bacteria | 1179 |
| 51 | Ga0068852_100005008 | 3300005616 | Bacteria | 9424 |
| 52 | Ga0068858_100014667 | 3300005842 | Bacteria | 7378 |
| 53 | Ga0075366_10002457 | 3300006195 | Bacteria | 9486 |
| 54 | Ga0097621_100517804 | 3300006237 | Bacteria | 1082 |
| 55 | Ga0105240_10007257 | 3300009093 | Bacteria | 16134 |
| 56 | Ga0105240_10010049 | 3300009093 | Bacteria | 13326 |
| 57 | Ga0105240_10139443 | 3300009093 | Bacteria | 2900 |
| 58 | Ga0105240_10157635 | 3300009093 | Bacteria | 2698 |
| 59 | Ga0105240_10200812 | 3300009093 | Bacteria | 2337 |
| 60 | Ga0105240_10244250 | 3300009093 | Bacteria | 2080 |
| 61 | Ga0105241_10071221 | 3300009174 | Bacteria | 2698 |
| 62 | Ga0105237_10000481 | 3300009545 | Bacteria | 56729 |
| 63 | Ga0105237_10001840 | 3300009545 | Bacteria | 27293 |
| 64 | Ga0105237_10036173 | 3300009545 | Bacteria | 4996 |
| 65 | Ga0105237_10045561 | 3300009545 | Bacteria | 4413 |
| 66 | Ga0105237_10070420 | 3300009545 | Bacteria | 3493 |
| 67 | Ga0105237_10158297 | 3300009545 | Bacteria | 2262 |
| 68 | Ga0105237_10630813 | 3300009545 | Bacteria | 1079 |
| 69 | Ga0105238_10025265 | 3300009551 | Bacteria | 6054 |
| 70 | Ga0105239_10000865 | 3300010375 | Bacteria | 43041 |
| 71 | Ga0105239_10001327 | 3300010375 | Bacteria | 33331 |
| 72 | Ga0105239_10004229 | 3300010375 | Bacteria | 17242 |
| 73 | Ga0105239_10009782 | 3300010375 | Bacteria | 10777 |
| 74 | Ga0105239_10041307 | 3300010375 | Bacteria | 5055 |
| 75 | Ga0105239_10351993 | 3300010375 | Bacteria | 1663 |
| 76 | Ga0105239_10359833 | 3300010375 | Bacteria | 1643 |
| 77 | Ga0157373_10000090 | 3300013100 | Bacteria | 78142 |
| 78 | Ga0157373_10018277 | 3300013100 | Bacteria | 5105 |
| 79 | Ga0157373_10047711 | 3300013100 | Unclassified | 3054 |
| 80 | Ga0157373_10108000 | 3300013100 | Bacteria | 1957 |
| 81 | Ga0157371_10001813 | 3300013102 | Bacteria | 21557 |
| 82 | Ga0157371_10002322 | 3300013102 | Bacteria | 18276 |
| 83 | Ga0157371_10063594 | 3300013102 | Bacteria | 2615 |
| 84 | Ga0157371_10073301 | 3300013102 | Bacteria | 2425 |
| 85 | Ga0157371_10183648 | 3300013102 | Bacteria | 1496 |
| 86 | Ga0157370_10005173 | 3300013104 | Bacteria | 14710 |
| 87 | Ga0157370_10005382 | 3300013104 | Bacteria | 14371 |
| 88 | Ga0157370_10008393 | 3300013104 | Bacteria | 11142 |
| 89 | Ga0157370_10035528 | 3300013104 | Bacteria | 4842 |
| 90 | Ga0157370_10039249 | 3300013104 | Bacteria | 4576 |
| 91 | Ga0157370_10243717 | 3300013104 | Bacteria | 1663 |
| 92 | Ga0157369_10000047 | 3300013105 | Bacteria | 172682 |
| 93 | Ga0157369_10035923 | 3300013105 | Bacteria | 5431 |
| 94 | Ga0157369_10069732 | 3300013105 | Bacteria | 3776 |
| 95 | Ga0157374_10000742 | 3300013296 | Bacteria | 28401 |
| 96 | Ga0157374_10173725 | 3300013296 | Bacteria | 2103 |
| 97 | Ga0157378_10007744 | 3300013297 | Bacteria | 9374 |
| 98 | Ga0163162_10000631 | 3300013306 | Bacteria | 32664 |
| 99 | Ga0163162_10004006 | 3300013306 | Bacteria | 14134 |
| 100 | Ga0163162_10028948 | 3300013306 | Bacteria | 5482 |
| 101 | Ga0163162_10046336 | 3300013306 | Bacteria | 4357 |
| 102 | Ga0157372_10002968 | 3300013307 | Bacteria | 18277 |
| 103 | Ga0157372_10003495 | 3300013307 | Bacteria | 16933 |
| 104 | Ga0157372_10065589 | 3300013307 | Bacteria | 4077 |
| 105 | Ga0157372_10087078 | 3300013307 | Bacteria | 3543 |
| 106 | Ga0157372_10169020 | 3300013307 | Bacteria | 2529 |
| 107 | Ga0157372_10268939 | 3300013307 | Bacteria | 1980 |
| 108 | Ga0157375_10018456 | 3300013308 | Bacteria | 6327 |
| 109 | Ga0182008_10000169 | 3300014497 | Bacteria | 50985 |
| 110 | Ga0182008_10000395 | 3300014497 | Bacteria | 33809 |
| 111 | Ga0157377_10017714 | 3300014745 | Bacteria | 3689 |
| 112 | Ga0182006_1000224 | 3300015261 | Bacteria | 54977 |
| 113 | Ga0182006_1000637 | 3300015261 | Bacteria | 24868 |
| 114 | Ga0182006_1008451 | 3300015261 | Bacteria | 4663 |
| 115 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 116 | Ga0182007_10038016 | 3300015262 | Bacteria | 1615 |
| 117 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 118 | Ga0163161_10000158 | 3300017792 | Bacteria | 62560 |
| 119 | Ga0163161_10001372 | 3300017792 | Bacteria | 18055 |
| 120 | Ga0163161_10001688 | 3300017792 | Bacteria | 16210 |
| 121 | Ga0163161_10036532 | 3300017792 | Bacteria | 3518 |
| 122 | Ga0163161_10044010 | 3300017792 | Bacteria | 3214 |
| 123 | Ga0163161_10053437 | 3300017792 | Bacteria | 2930 |
| 124 | Ga0209437_100070 | 3300025233 | Bacteria | 306718 |
| 125 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 126 | Ga0209026_1000404 | 3300025250 | Bacteria | 38293 |
| 127 | Ga0209026_1001146 | 3300025250 | Bacteria | 12432 |
| 128 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 129 | Ga0209129_1013868 | 3300025258 | Bacteria | 1747 |
| 130 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 131 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 132 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 133 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 134 | Ga0207647_10000231 | 3300025904 | Bacteria | 46261 |
| 135 | Ga0207647_10021224 | 3300025904 | Bacteria | 4338 |
| 136 | Ga0207654_10062364 | 3300025911 | Bacteria | 2184 |
| 137 | Ga0207707_10010461 | 3300025912 | Bacteria | 8050 |
| 138 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 139 | Ga0207695_10003692 | 3300025913 | Bacteria | 21326 |
| 140 | Ga0207695_10038847 | 3300025913 | Bacteria | 5120 |
| 141 | Ga0207695_10041021 | 3300025913 | Unclassified | 4956 |
| 142 | Ga0207695_10042908 | 3300025913 | Bacteria | 4824 |
| 143 | Ga0207695_10090453 | 3300025913 | Bacteria | 3076 |
| 144 | Ga0207695_10254909 | 3300025913 | Bacteria | 1653 |
| 145 | Ga0207695_10600462 | 3300025913 | Bacteria | 982 |
| 146 | Ga0207671_10000815 | 3300025914 | Bacteria | 39441 |
| 147 | Ga0207671_10010835 | 3300025914 | Bacteria | 7479 |
| 148 | Ga0207671_10026656 | 3300025914 | Bacteria | 4327 |
| 149 | Ga0207671_10048482 | 3300025914 | Bacteria | 3144 |
| 150 | Ga0207660_10011657 | 3300025917 | Bacteria | 5732 |
| 151 | Ga0207649_10212292 | 3300025920 | Bacteria | 1374 |
| 152 | Ga0207652_10016052 | 3300025921 | Bacteria | 6106 |
| 153 | Ga0207652_10468596 | 3300025921 | Bacteria | 1135 |
| 154 | Ga0207706_10000406 | 3300025933 | Bacteria | 46320 |
| 155 | Ga0207706_10299886 | 3300025933 | Bacteria | 1400 |
| 156 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 157 | Ga0207667_10000419 | 3300025949 | Bacteria | 57239 |
| 158 | Ga0207667_10000953 | 3300025949 | Bacteria | 36919 |
| 159 | Ga0207667_10026756 | 3300025949 | Bacteria | 6294 |
| 160 | Ga0207667_10207466 | 3300025949 | Bacteria | 2009 |
| 161 | Ga0207667_10233747 | 3300025949 | Bacteria | 1882 |
| 162 | Ga0207640_10011600 | 3300025981 | Bacteria | 4994 |
| 163 | Ga0207702_10000163 | 3300026078 | Bacteria | 79263 |
| 164 | Ga0207702_10037229 | 3300026078 | Bacteria | 4071 |
| 165 | Ga0207674_10042445 | 3300026116 | Bacteria | 4697 |
| 166 | Ga0207674_10179806 | 3300026116 | Bacteria | 2067 |
| 167 | Ga0207698_10007210 | 3300026142 | Bacteria | 6966 |
| 168 | Ga0307515_10014856 | 3300028794 | Bacteria | 14394 |
| 169 | Ga0307515_10076860 | 3300028794 | Bacteria | 4419 |
| 170 | Ga0265327_10001093 | 3300031251 | Bacteria | 37634 |
| 171 | Ga0307509_10046984 | 3300031507 | Bacteria | 4645 |
| 172 | Ga0316576_10299939 | 3300031727 | Unclassified | 1201 |
| 173 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 174 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 175 | Ga0307412_10206014 | 3300031911 | Bacteria | 1497 |
| 176 | Ga0307409_100108779 | 3300031995 | Bacteria | 2319 |
| 177 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 178 | Ga0307507_10001815 | 3300033179 | Bacteria | 46860 |
| 179 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 180 | Ga0395900_0004237 | 3300037418 | Bacteria | 15226 |
| 181 | Ga0395898_0032945 | 3300037466 | Bacteria | 5172 |
| 182 | Ga0395901_0024980 | 3300038443 | Bacteria | 6132 |
| 183 | Ga0466959_0059003 | 3300045049 | Unclassified | 2795 |
| 184 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 185 | Ga0495650_0028904 | 3300046471 | Bacteria | 2535 |
| 186 | Ga0495585_0001451 | 3300046492 | Bacteria | 18615 |
| 187 | Ga0495585_0002526 | 3300046492 | Bacteria | 13003 |
| 188 | Ga0495607_0129101 | 3300046501 | Bacteria | 1318 |
| 189 | Ga0495606_0000241 | 3300046507 | Bacteria | 96663 |
| 190 | Ga0495606_0078108 | 3300046507 | Bacteria | 2065 |
| 191 | Ga0495606_0193520 | 3300046507 | Bacteria | 1164 |
| 192 | Ga0495610_0000338 | 3300046512 | Bacteria | 49305 |
| 193 | Ga0495610_0001603 | 3300046512 | Bacteria | 19932 |
| 194 | Ga0495610_0001644 | 3300046512 | Bacteria | 19645 |
| 195 | Ga0495616_0001895 | 3300046513 | Bacteria | 14129 |
| 196 | Ga0495616_0009577 | 3300046513 | Bacteria | 5654 |
| 197 | Ga0495616_0084660 | 3300046513 | Bacteria | 1511 |
| 198 | Ga0495631_0104445 | 3300046518 | Bacteria | 1219 |
| 199 | Ga0495648_0008221 | 3300046524 | Bacteria | 8228 |
| 200 | Ga0495652_0078079 | 3300046529 | Bacteria | 2742 |
| 201 | Ga0495609_0001800 | 3300046538 | Bacteria | 13764 |
| 202 | Ga0495633_0000027 | 3300046558 | Bacteria | 204613 |
| 203 | Ga0495633_0053510 | 3300046558 | Bacteria | 1900 |
| 204 | Ga0495633_0106553 | 3300046558 | Bacteria | 1300 |
| 205 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 206 | Ga0495668_0167178 | 3300046616 | Bacteria | 1205 |
| 207 | Ga0495625_0000003 | 3300046660 | Bacteria | 686847 |
| 208 | Ga0495625_0000381 | 3300046660 | Bacteria | 67732 |
| 209 | Ga0495625_0003720 | 3300046660 | Bacteria | 14873 |
| 210 | Ga0495625_0017279 | 3300046660 | Bacteria | 5648 |
| 211 | Ga0495625_0053458 | 3300046660 | Bacteria | 2888 |
| 212 | Ga0495625_0077632 | 3300046660 | Bacteria | 2319 |
| 213 | Ga0495625_0117578 | 3300046660 | Bacteria | 1812 |
| 214 | Ga0495661_0003567 | 3300046665 | Bacteria | 11452 |
| 215 | Ga0495661_0014257 | 3300046665 | Bacteria | 5326 |
| 216 | Ga0495661_0029907 | 3300046665 | Bacteria | 3473 |
| 217 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 218 | Ga0495660_0029043 | 3300046810 | Bacteria | 3122 |
| 219 | Ga0495660_0080350 | 3300046810 | Bacteria | 1711 |
| 220 | Ga0495687_000785 | 3300047443 | Bacteria | 34129 |
| 221 | Ga0495681_0179463 | 3300047470 | Bacteria | 871 |
| 222 | Ga0495686_0001273 | 3300047472 | Bacteria | 28543 |
| 223 | Ga0495614_0058976 | 3300048089 | Bacteria | 1648 |
| 224 | Ga0496115_0210540 | 3300048918 | Bacteria | 1606 |
| 225 | Ga0496122_0000836 | 3300048925 | Bacteria | 58266 |
| 226 | Ga0496123_0003773 | 3300048926 | Bacteria | 16604 |
| 227 | Ga0496125_0081992 | 3300048928 | Unclassified | 2461 |
| 228 | Ga0501223_000905 | 3300049663 | Bacteria | 7019 |
| 229 | nmdc:mga0k408_1219_c1 | 3300050493 | Bacteria | 14084 |
| 230 | Ga0500622_0000302 | 3300053156 | Bacteria | 50416 |
| 231 | Ga0500624_000397 | 3300053157 | Bacteria | 13683 |
| 232 | 2586206737 | 2585427687 | Bacteria | 5544917 |
| 233 | 2599477283 | 2599185184 | Bacteria | 6430550 |
| 234 | 2738759164 | 2738541283 | Bacteria | 7222293 |
| 235 | 2738854922 | 2738541302 | Bacteria | 5944758 |
| 236 | 2739303090 | 2738543023 | Bacteria | 6767879 |
| 237 | 2739586962 | 2739367651 | Bacteria | 6359826 |
| 238 | 2739614703 | 2739367656 | Bacteria | 5152243 |
| 239 | 2739648114 | 2739367663 | Bacteria | 5040914 |
| 240 | 2819547416 | 2818991437 | Bacteria | 5805520 |
| 241 | 2842727596 | 2842722452 | Bacteria | 6263924 |
| 242 | 2842911198 | 2842909656 | Bacteria | 6185908 |
| 243 | 2849283151 | 2849281842 | Bacteria | 6065644 |
| 244 | 2852626335 | 2852623160 | Bacteria | 4376875 |
| 245 | 2857631510 | 2857627736 | Bacteria | 5625397 |
| 246 | 2884934786 | 2884933994 | Bacteria | 4535041 |
| 247 | 2904447881 | 2904445276 | Bacteria | 5310396 |
| 248 | 2928079200 | 2928078545 | Bacteria | 6534839 |
| 249 | 2928148429 | 2928147474 | Bacteria | 6512076 |
| 250 | 2932085725 | 2932082852 | Bacteria | 6563563 |
| 251 | 2946003262 | 2945997725 | Bacteria | 6404843 |
| 252 | 2954020135 | 2954016120 | Bacteria | 6446024 |
| 253 | 2977235034 | 2977232053 | Bacteria | 5485925 |
| 254 | Ga0065714_10003765 | |||
| 255 | JGI24736J21556_1000902 | |||
| 256 | JGI24739J22299_10016677 | |||
| 257 | JGI24737J22298_10005695 | |||
| 258 | JGI24737J22298_10010970 | |||
| 259 | JGI24735J21928_10000001 | |||
| 260 | JGI25162J39368_1000141 | |||
| 261 | JGI25152J39213_1000016 | |||
| 262 | JGI25150J39212_1000003 | |||
| 263 | JGI25150J39212_1000004 | |||
| 264 | JGI25151J46595_10000002 | |||
| 265 | JGI25153J46596_10000015 | |||
| 266 | rootH1_10044460 | |||
| 267 | rootH1_10115464 | |||
| 268 | rootH2_10335944 | |||
| 269 | rootH1_10058585 | |||
| 270 | rootH1_10085439 | |||
| 271 | Ga0055536_1000006 | |||
| 272 | Ga0055530_10000379 | |||
| 273 | Ga0058863_11424898 | |||
| 274 | Ga0065714_10002432 | |||
| 275 | Ga0065714_10078973 | |||
| 276 | Ga0065714_10080733 | |||
| 277 | Ga0065714_10131827 | |||
| 278 | Ga0070658_10028555 | |||
| 279 | Ga0070680_100026859 | |||
| 280 | Ga0070680_100204978 | |||
| 281 | Ga0068868_100101099 | |||
| 282 | Ga0070660_100030454 | |||
| 283 | Ga0070660_100063344 | |||
| 284 | Ga0070661_100190940 | |||
| 285 | Ga0070710_10176104 | |||
| 286 | Ga0070662_100006156 | |||
| 287 | Ga0070662_100416785 | |||
| 288 | Ga0070681_10009257 | |||
| 289 | Ga0070679_100093209 | |||
| 290 | Ga0070679_100487143 | |||
| 291 | Ga0070684_100393565 | |||
| 292 | Ga0068853_100215337 | |||
| 293 | Ga0068853_100504505 | |||
| 294 | Ga0068855_100000155 | |||
| 295 | Ga0068855_100026390 | |||
| 296 | Ga0068855_100045704 | |||
| 297 | Ga0068855_100172516 | |||
| 298 | Ga0068855_100799000 | |||
| 299 | Ga0068857_100156470 | |||
| 300 | Ga0068854_100007114 | |||
| 301 | Ga0068856_100013088 | |||
| 302 | Ga0068856_100547158 | |||
| 303 | Ga0068852_100005008 | |||
| 304 | Ga0068858_100014667 | |||
| 305 | Ga0075366_10002457 | |||
| 306 | Ga0097621_100517804 | |||
| 307 | Ga0105240_10007257 | |||
| 308 | Ga0105240_10010049 | |||
| 309 | Ga0105240_10139443 | |||
| 310 | Ga0105240_10157635 | |||
| 311 | Ga0105240_10200812 | |||
| 312 | Ga0105240_10244250 | |||
| 313 | Ga0105241_10071221 | |||
| 314 | Ga0105237_10000481 | |||
| 315 | Ga0105237_10001840 | |||
| 316 | Ga0105237_10036173 | |||
| 317 | Ga0105237_10045561 | |||
| 318 | Ga0105237_10070420 | |||
| 319 | Ga0105237_10158297 | |||
| 320 | Ga0105237_10630813 | |||
| 321 | Ga0105238_10025265 | |||
| 322 | Ga0105239_10000865 | |||
| 323 | Ga0105239_10001327 | |||
| 324 | Ga0105239_10004229 | |||
| 325 | Ga0105239_10009782 | |||
| 326 | Ga0105239_10041307 | |||
| 327 | Ga0105239_10351993 | |||
| 328 | Ga0105239_10359833 | |||
| 329 | Ga0157373_10000090 | |||
| 330 | Ga0157373_10018277 | |||
| 331 | Ga0157373_10047711 | |||
| 332 | Ga0157373_10108000 | |||
| 333 | Ga0157371_10001813 | |||
| 334 | Ga0157371_10002322 | |||
| 335 | Ga0157371_10063594 | |||
| 336 | Ga0157371_10073301 | |||
| 337 | Ga0157371_10183648 | |||
| 338 | Ga0157370_10005173 | |||
| 339 | Ga0157370_10005382 | |||
| 340 | Ga0157370_10008393 | |||
| 341 | Ga0157370_10035528 | |||
| 342 | Ga0157370_10039249 | |||
| 343 | Ga0157370_10243717 | |||
| 344 | Ga0157369_10000047 | |||
| 345 | Ga0157369_10035923 | |||
| 346 | Ga0157369_10069732 | |||
| 347 | Ga0157374_10000742 | |||
| 348 | Ga0157374_10173725 | |||
| 349 | Ga0157378_10007744 | |||
| 350 | Ga0163162_10000631 | |||
| 351 | Ga0163162_10004006 | |||
| 352 | Ga0163162_10028948 | |||
| 353 | Ga0163162_10046336 | |||
| 354 | Ga0157372_10002968 | |||
| 355 | Ga0157372_10003495 | |||
| 356 | Ga0157372_10065589 | |||
| 357 | Ga0157372_10087078 | |||
| 358 | Ga0157372_10169020 | |||
| 359 | Ga0157372_10268939 | |||
| 360 | Ga0157375_10018456 | |||
| 361 | Ga0182008_10000169 | |||
| 362 | Ga0182008_10000395 | |||
| 363 | Ga0157377_10017714 | |||
| 364 | Ga0182006_1000224 | |||
| 365 | Ga0182006_1000637 | |||
| 366 | Ga0182006_1008451 | |||
| 367 | Ga0182007_10000005 | |||
| 368 | Ga0182007_10038016 | |||
| 369 | Ga0183373_1002 | |||
| 370 | Ga0163161_10000158 | |||
| 371 | Ga0163161_10001372 | |||
| 372 | Ga0163161_10001688 | |||
| 373 | Ga0163161_10036532 | |||
| 374 | Ga0163161_10044010 | |||
| 375 | Ga0163161_10053437 | |||
| 376 | Ga0209437_100070 | |||
| 377 | Ga0207425_1000003 | |||
| 378 | Ga0209026_1000404 | |||
| 379 | Ga0209026_1001146 | |||
| 380 | Ga0209129_1000014 | |||
| 381 | Ga0209129_1013868 | |||
| 382 | Ga0209676_1000039 | |||
| 383 | Ga0209025_1000007 | |||
| 384 | Ga0209758_1000012 | |||
| 385 | Ga0209050_1000033 | |||
| 386 | Ga0207647_10000231 | |||
| 387 | Ga0207647_10021224 | |||
| 388 | Ga0207654_10062364 | |||
| 389 | Ga0207707_10010461 | |||
| 390 | Ga0207695_10000142 | |||
| 391 | Ga0207695_10003692 | |||
| 392 | Ga0207695_10038847 | |||
| 393 | Ga0207695_10041021 | |||
| 394 | Ga0207695_10042908 | |||
| 395 | Ga0207695_10090453 | |||
| 396 | Ga0207695_10254909 | |||
| 397 | Ga0207695_10600462 | |||
| 398 | Ga0207671_10000815 | |||
| 399 | Ga0207671_10010835 | |||
| 400 | Ga0207671_10026656 | |||
| 401 | Ga0207671_10048482 | |||
| 402 | Ga0207660_10011657 | |||
| 403 | Ga0207649_10212292 | |||
| 404 | Ga0207652_10016052 | |||
| 405 | Ga0207652_10468596 | |||
| 406 | Ga0207706_10000406 | |||
| 407 | Ga0207706_10299886 | |||
| 408 | Ga0207667_10000015 | |||
| 409 | Ga0207667_10000419 | |||
| 410 | Ga0207667_10000953 | |||
| 411 | Ga0207667_10026756 | |||
| 412 | Ga0207667_10207466 | |||
| 413 | Ga0207667_10233747 | |||
| 414 | Ga0207640_10011600 | |||
| 415 | Ga0207702_10000163 | |||
| 416 | Ga0207702_10037229 | |||
| 417 | Ga0207674_10042445 | |||
| 418 | Ga0207674_10179806 | |||
| 419 | Ga0207698_10007210 | |||
| 420 | Ga0307515_10014856 | |||
| 421 | Ga0307515_10076860 | |||
| 422 | Ga0265327_10001093 | |||
| 423 | Ga0307509_10046984 | |||
| 424 | Ga0316576_10299939 | |||
| 425 | Ga0307405_10000009 | |||
| 426 | Ga0307407_10000001 | |||
| 427 | Ga0307412_10206014 | |||
| 428 | Ga0307409_100108779 | |||
| 429 | Ga0307416_100000008 | |||
| 430 | Ga0307507_10001815 | |||
| 431 | Ga0395899_0000017 | |||
| 432 | Ga0395900_0004237 | |||
| 433 | Ga0395898_0032945 | |||
| 434 | Ga0395901_0024980 | |||
| 435 | Ga0466959_0059003 | |||
| 436 | Ga0495650_0000014 | |||
| 437 | Ga0495650_0028904 | |||
| 438 | Ga0495585_0001451 | |||
| 439 | Ga0495585_0002526 | |||
| 440 | Ga0495607_0129101 | |||
| 441 | Ga0495606_0000241 | |||
| 442 | Ga0495606_0078108 | |||
| 443 | Ga0495606_0193520 | |||
| 444 | Ga0495610_0000338 | |||
| 445 | Ga0495610_0001603 | |||
| 446 | Ga0495610_0001644 | |||
| 447 | Ga0495616_0001895 | |||
| 448 | Ga0495616_0009577 | |||
| 449 | Ga0495616_0084660 | |||
| 450 | Ga0495631_0104445 | |||
| 451 | Ga0495648_0008221 | |||
| 452 | Ga0495652_0078079 | |||
| 453 | Ga0495609_0001800 | |||
| 454 | Ga0495633_0000027 | |||
| 455 | Ga0495633_0053510 | |||
| 456 | Ga0495633_0106553 | |||
| 457 | Ga0495668_0000010 | |||
| 458 | Ga0495668_0167178 | |||
| 459 | Ga0495625_0000003 | |||
| 460 | Ga0495625_0000381 | |||
| 461 | Ga0495625_0003720 | |||
| 462 | Ga0495625_0017279 | |||
| 463 | Ga0495625_0053458 | |||
| 464 | Ga0495625_0077632 | |||
| 465 | Ga0495625_0117578 | |||
| 466 | Ga0495661_0003567 | |||
| 467 | Ga0495661_0014257 | |||
| 468 | Ga0495661_0029907 | |||
| 469 | Ga0495649_0000002 | |||
| 470 | Ga0495660_0029043 | |||
| 471 | Ga0495660_0080350 | |||
| 472 | Ga0495687_000785 | |||
| 473 | Ga0495681_0179463 | |||
| 474 | Ga0495686_0001273 | |||
| 475 | Ga0495614_0058976 | |||
| 476 | Ga0496115_0210540 | |||
| 477 | Ga0496122_0000836 | |||
| 478 | Ga0496123_0003773 | |||
| 479 | Ga0496125_0081992 | |||
| 480 | Ga0501223_000905 | |||
| 481 | nmdc:mga0k408_1219_c1 | |||
| 482 | Ga0500622_0000302 | |||
| 483 | Ga0500624_000397 | |||
| 484 | 2586206737 | |||
| 485 | 2599477283 | |||
| 486 | 2738759164 | |||
| 487 | 2738854922 | |||
| 488 | 2739303090 | |||
| 489 | 2739586962 | |||
| 490 | 2739614703 | |||
| 491 | 2739648114 | |||
| 492 | 2819547416 | |||
| 493 | 2842727596 | |||
| 494 | 2842911198 | |||
| 495 | 2849283151 | |||
| 496 | 2852626335 | |||
| 497 | 2857631510 | |||
| 498 | 2884934786 | |||
| 499 | 2904447881 | |||
| 500 | 2928079200 | |||
| 501 | 2928148429 | |||
| 502 | 2932085725 | |||
| 503 | 2946003262 | |||
| 504 | 2954020135 | |||
| 505 | 2977235034 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7msp-assembly2.cif.gz_B | suns glycosin s-glycosyltransferase | 0.7316 | 2 | 215 |
| 2z87-assembly3.cif.gz_B | crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp | 0.7289 | 2 | 133 |
| 1qgs-assembly1.cif.gz_A | udp-magnesium complex of spsa from bacillus subtilis | 0.7287 | 1 | 132 |
| 1h7l-assembly1.cif.gz_A | dtdp-magnesium complex of spsa from bacillus subtilis | 0.7274 | 1 | 132 |
| 3bcv-assembly1.cif.gz_B | crystal structure of a putative glycosyltransferase from bacteroides fragilis | 0.7054 | 2 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMX1_74_289_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7786 | 3 | 137 | 3.90.550.10 |
| af_P75905_64_287_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7786 | 2 | 129 | 3.90.550.10 |
| af_P71795_2_224_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7379 | 2 | 129 | 3.90.550.10 |
| 1h7lA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7274 | 1 | 132 | 3.90.550.10 |
| af_P77414_1_259_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7212 | 3 | 132 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N7ZJ12-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9967 | 1 | 101 |
GO:0016740
|
| AF-A0A524IPX7-F1-model_v4 | Glycosyltransferase | 0.9912 | 1 | 132 |
GO:0016740
|
| AF-A0A6N7M9C6-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9878 | 1 | 177 |
GO:0016740
|
| AF-A0A5N7ZJ12-F1-model_v4 | Glycosyltransferase family 2 protein | 0.987 | 1 | 101 |
GO:0016740
|
| AF-A0A3D2XID0-F1-model_v4 | Glycosyl transferase | 0.9866 | 1 | 161 |
GO:0016740
|