F362789

General Info

Members Datasets Scaffolds Average Seq Length
251 129 502 307

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_8874_c1|nmdc:mga0n895_8874_c1_7180_8184
Length 334
Sequence LNLRNSRNPRLITIHAMEFITLFGTYKSEPTVLDKIKDAVTQTKENFTERIQDLVQGKKEIDAEMLDELEAIMIGADIGIATTTEILKSIRDQVSRQTLKDPNQLRGAVKEELRKILQINYKPPAQIAEGNPFVILMVGVNGVGKTTTIGKLANRFKEDGKKVLLCAGDTFRAAAVEQLEIWANRTGAPLVKQKAGADPSAVLFDALQSAKARNIDYVIVDTAGRLHTKHNLMSELEKMTRIASREVPGAPHEVLLVMDATTGQNGLTQAREFTKSARVTGLVLTKLDGTAKGGVVTAIAKDLKIPIRFVGIGEKVDDLIEFSADAFVDSLFAA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 99.6
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_8874_c1 3300050512 Bacteria 8753
2 Ga0065712_10082405 3300005290 Bacteria 2919
3 Ga0065715_10113875 3300005293 Bacteria 2436
4 Ga0070690_100046829 3300005330 Bacteria 2750
5 Ga0070670_100018864 3300005331 Bacteria 5916
6 Ga0070670_100039063 3300005331 Bacteria 4081
7 Ga0070689_100004201 3300005340 Bacteria 9715
8 Ga0070689_100140532 3300005340 Bacteria 1942
9 Ga0070689_100168364 3300005340 Bacteria 1774
10 Ga0070689_100245017 3300005340 Bacteria 1477
11 Ga0070675_100013770 3300005354 Bacteria 6365
12 Ga0070675_100015414 3300005354 Bacteria 6042
13 Ga0070675_100035666 3300005354 Bacteria 4043
14 Ga0070675_100047460 3300005354 Bacteria 3519
15 Ga0070675_100117961 3300005354 Bacteria 2253
16 Ga0070671_100000687 3300005355 Bacteria 24327
17 Ga0070671_100041041 3300005355 Bacteria 3845
18 Ga0070673_100008374 3300005364 Bacteria 6874
19 Ga0070688_100000532 3300005365 Bacteria 19232
20 Ga0070688_100001434 3300005365 Bacteria 11862
21 Ga0070688_100040329 3300005365 Bacteria 2861
22 Ga0070688_100306768 3300005365 Bacteria 1149
23 Ga0070667_100019696 3300005367 Bacteria 5597
24 Ga0070703_10028964 3300005406 Bacteria 1658
25 Ga0070701_10030519 3300005438 Bacteria 2667
26 Ga0070701_10080451 3300005438 Bacteria 1762
27 Ga0070705_100164416 3300005440 Bacteria 1487
28 Ga0070705_100203692 3300005440 Bacteria 1359
29 Ga0070694_100009625 3300005444 Bacteria 5930
30 Ga0070685_10013809 3300005466 Bacteria 4269
31 Ga0070685_10015603 3300005466 Bacteria 4038
32 Ga0070706_100124148 3300005467 Bacteria 2407
33 Ga0070706_100245119 3300005467 Bacteria 1673
34 Ga0070707_100036094 3300005468 Bacteria 4716
35 Ga0070698_100014925 3300005471 Bacteria 8213
36 Ga0070698_100482558 3300005471 Bacteria 1177
37 Ga0070697_100109853 3300005536 Bacteria 2297
38 Ga0070672_100067212 3300005543 Bacteria 2840
39 Ga0070672_100297563 3300005543 Bacteria 1367
40 Ga0070686_100023568 3300005544 Bacteria 3680
41 Ga0070686_100140183 3300005544 Bacteria 1682
42 Ga0070695_100001297 3300005545 Bacteria 13787
43 Ga0070695_100004688 3300005545 Bacteria 8042
44 Ga0070695_100010588 3300005545 Bacteria 5511
45 Ga0070696_100057736 3300005546 Bacteria 2709
46 Ga0070704_100012827 3300005549 Bacteria 5182
47 Ga0070704_100020221 3300005549 Bacteria 4289
48 Ga0070704_100066961 3300005549 Bacteria 2592
49 Ga0070704_100074383 3300005549 Bacteria 2478
50 Ga0070704_100076749 3300005549 Bacteria 2445
51 Ga0070704_100100705 3300005549 Bacteria 2176
52 Ga0070664_100028719 3300005564 Bacteria 4630
53 Ga0070664_100099532 3300005564 Unclassified 2527
54 Ga0070702_100056255 3300005615 Bacteria 2271
55 Ga0070702_100158844 3300005615 Bacteria 1459
56 Ga0068859_100003024 3300005617 Bacteria 17050
57 Ga0068859_100009050 3300005617 Bacteria 10060
58 Ga0068859_100225316 3300005617 Bacteria 1963
59 Ga0068859_100346100 3300005617 Bacteria 1581
60 Ga0068863_100071375 3300005841 Bacteria 3285
61 Ga0068863_100155143 3300005841 Bacteria 2192
62 Ga0068863_100243102 3300005841 Bacteria 1737
63 Ga0068858_100060528 3300005842 Bacteria 3500
64 Ga0068860_100007536 3300005843 Bacteria 10887
65 Ga0068860_100418987 3300005843 Bacteria 1327
66 Ga0068862_100175703 3300005844 Bacteria 1920
67 Ga0068862_100254840 3300005844 Bacteria 1600
68 Ga0068862_100500030 3300005844 Bacteria 1154
69 Ga0097621_100080571 3300006237 Bacteria 2708
70 Ga0068871_100318750 3300006358 Bacteria 1368
71 Ga0075428_100004616 3300006844 Bacteria 15237
72 Ga0075428_100004866 3300006844 Bacteria 14905
73 Ga0075428_100052175 3300006844 Bacteria 4484
74 Ga0075428_100098465 3300006844 Bacteria 3188
75 Ga0075428_100126828 3300006844 Bacteria 2777
76 Ga0075428_100145949 3300006844 Bacteria 2571
77 Ga0075428_100150526 3300006844 Bacteria 2528
78 Ga0075431_100235189 3300006847 Bacteria 1865
79 Ga0075431_100301101 3300006847 Bacteria 1620
80 Ga0075433_10008170 3300006852 Bacteria 8334
81 Ga0075433_10017843 3300006852 Bacteria 5889
82 Ga0075433_10069846 3300006852 Bacteria 3086
83 Ga0075433_10093651 3300006852 Bacteria 2658
84 Ga0075433_10333636 3300006852 Bacteria 1341
85 Ga0075434_100032438 3300006871 Bacteria 5150
86 Ga0075434_100083142 3300006871 Bacteria 3199
87 Ga0075434_100159993 3300006871 Bacteria 2272
88 Ga0075434_100209249 3300006871 Bacteria 1971
89 Ga0075429_100002022 3300006880 Bacteria 16867
90 Ga0075429_100005425 3300006880 Bacteria 10984
91 Ga0075429_100039560 3300006880 Bacteria 4104
92 Ga0075429_100066363 3300006880 Bacteria 3141
93 Ga0075429_100226756 3300006880 Bacteria 1636
94 Ga0097620_100003024 3300006931 Bacteria 17050
95 Ga0097620_100009050 3300006931 Bacteria 10060
96 Ga0097620_100225344 3300006931 Bacteria 1963
97 Ga0097620_100346124 3300006931 Bacteria 1581
98 Ga0075435_100071461 3300007076 Bacteria 2834
99 Ga0075435_100232213 3300007076 Bacteria 1567
100 Ga0111539_10007975 3300009094 Bacteria 13505
101 Ga0111539_10039854 3300009094 Bacteria 5657
102 Ga0111539_10124463 3300009094 Bacteria 3021
103 Ga0111539_10125760 3300009094 Bacteria 3004
104 Ga0111539_10430849 3300009094 Bacteria 1536
105 Ga0111539_10486661 3300009094 Bacteria 1437
106 Ga0114129_10000257 3300009147 Bacteria 60056
107 Ga0114129_10011766 3300009147 Bacteria 12451
108 Ga0114129_10018514 3300009147 Bacteria 9915
109 Ga0114129_10153547 3300009147 Bacteria 3150
110 Ga0114129_10192710 3300009147 Bacteria 2766
111 Ga0114129_10258884 3300009147 Bacteria 2333
112 Ga0114129_10651453 3300009147 Bacteria 1359
113 Ga0105242_10082079 3300009176 Bacteria 2697
114 Ga0105248_10011739 3300009177 Bacteria 9661
115 Ga0105246_10212528 3300011119 Bacteria 1511
116 Ga0157374_10248458 3300013296 Bacteria 1750
117 Ga0157375_10005563 3300013308 Bacteria 10966
118 Ga0163163_10126604 3300014325 Bacteria 2593
119 Ga0157380_10003717 3300014326 Bacteria 10491
120 Ga0157380_10025713 3300014326 Bacteria 4467
121 Ga0157379_10000961 3300014968 Bacteria 23396
122 Ga0157376_10106831 3300014969 Bacteria 2456
123 Ga0157376_10453986 3300014969 Bacteria 1251
124 Ga0207680_10020822 3300025903 Bacteria 3540
125 Ga0207684_10112906 3300025910 Bacteria 2326
126 Ga0207684_10185079 3300025910 Bacteria 1796
127 Ga0207662_10002198 3300025918 Bacteria 9721
128 Ga0207662_10083075 3300025918 Bacteria 1957
129 Ga0207646_10034080 3300025922 Bacteria 4602
130 Ga0207646_10173381 3300025922 Bacteria 1948
131 Ga0207650_10025517 3300025925 Bacteria 4210
132 Ga0207659_10002104 3300025926 Bacteria 11789
133 Ga0207659_10047271 3300025926 Bacteria 3043
134 Ga0207659_10057282 3300025926 Bacteria 2793
135 Ga0207659_10235687 3300025926 Bacteria 1478
136 Ga0207644_10001598 3300025931 Bacteria 14628
137 Ga0207644_10029462 3300025931 Bacteria 3809
138 Ga0207706_10138810 3300025933 Bacteria 2138
139 Ga0207686_10054120 3300025934 Bacteria 2513
140 Ga0207670_10001269 3300025936 Bacteria 13340
141 Ga0207670_10038498 3300025936 Bacteria 3124
142 Ga0207670_10054342 3300025936 Bacteria 2702
143 Ga0207670_10206474 3300025936 Bacteria 1495
144 Ga0207691_10052965 3300025940 Bacteria 3706
145 Ga0207711_10001914 3300025941 Bacteria 18908
146 Ga0207679_10007473 3300025945 Bacteria 6935
147 Ga0207679_10046127 3300025945 Bacteria 3157
148 Ga0207651_10026894 3300025960 Bacteria 3603
149 Ga0207658_10013686 3300025986 Bacteria 5548
150 Ga0207703_10123374 3300026035 Bacteria 2227
151 Ga0207708_10137836 3300026075 Bacteria 1912
152 Ga0207708_10254312 3300026075 Bacteria 1416
153 Ga0207641_10007631 3300026088 Bacteria 8994
154 Ga0207641_10397895 3300026088 Bacteria 1322
155 Ga0207676_10214185 3300026095 Bacteria 1711
156 Ga0207675_100052183 3300026118 Bacteria 3816
157 Ga0207428_10016195 3300027907 Bacteria 6418
158 Ga0207428_10047579 3300027907 Bacteria 3444
159 Ga0207428_10276499 3300027907 Bacteria 1247
160 Ga0268265_10077262 3300028380 Bacteria 2615
161 Ga0268265_10123607 3300028380 Bacteria 2137
162 Ga0268264_10055437 3300028381 Bacteria 3312
163 Ga0316579_10028944 3300031691 Bacteria 2525
164 Ga0316576_10005383 3300031727 Bacteria 7810
165 Ga0316578_10002626 3300031728 Bacteria 7969
166 Ga0316578_10031477 3300031728 Bacteria 3023
167 Ga0316577_10001160 3300031733 Bacteria 12069
168 Ga0373934_0001427 3300035086 Bacteria 8747
169 Ga0373953_0006446 3300035117 Bacteria 3867
170 Ga0373954_0030016 3300035118 Bacteria 2507
171 Ga0373956_0003336 3300035119 Bacteria 6458
172 Ga0373955_0002264 3300035172 Bacteria 8361
173 Ga0316574_0072416 3300035398 Bacteria 2178
174 Ga0316574_0102379 3300035398 Bacteria 1833
175 Ga0373924_0111103 3300035410 Bacteria 1185
176 Ga0373933_0013065 3300035724 Bacteria 4597
177 Ga0373937_0025383 3300036401 Bacteria 5349
178 Ga0373937_0041101 3300036401 Bacteria 4218
179 Ga0373937_0459651 3300036401 Bacteria 1209
180 Ga0316584_0027935 3300036712 Bacteria 4156
181 Ga0373925_0183261 3300037068 Bacteria 1659
182 Ga0451577_0004042 3300042876 Bacteria 15774
183 Ga0453684_0199769 3300044712 Bacteria 2331
184 Ga0451576_0030031 3300045051 Bacteria 5812
185 Ga0451576_0186124 3300045051 Bacteria 2168
186 Ga0495592_0041722 3300046454 Bacteria 3438
187 Ga0495603_0085213 3300046455 Bacteria 1850
188 Ga0495603_0114347 3300046455 Bacteria 1574
189 Ga0495653_0106681 3300046463 Bacteria 2020
190 Ga0495608_0012756 3300046511 Bacteria 5831
191 Ga0495618_0011560 3300046514 Bacteria 5355
192 Ga0495628_0009215 3300046516 Bacteria 8436
193 Ga0495630_0260581 3300046517 Bacteria 1324
194 Ga0495587_0006322 3300046536 Bacteria 7727
195 Ga0495635_0130224 3300046663 Bacteria 1715
196 Ga0495657_0097288 3300046675 Bacteria 1879
197 Ga0495600_0024747 3300046809 Bacteria 3866
198 Ga0495600_0074693 3300046809 Bacteria 2214
199 Ga0495636_0008431 3300047318 Bacteria 4067
200 Ga0495672_0000745 3300047320 Bacteria 35669
201 Ga0495680_0055383 3300047322 Bacteria 3076
202 Ga0495680_0105875 3300047322 Bacteria 2091
203 Ga0495680_0136758 3300047322 Bacteria 1796
204 Ga0495675_0007744 3300047444 Bacteria 6626
205 Ga0496104_0450236 3300048907 Bacteria 1199
206 Ga0501031_0100217 3300049568 Bacteria 1890
207 Ga0501042_0039775 3300049578 Bacteria 3343
208 Ga0501048_0022373 3300049582 Bacteria 4624
209 Ga0501071_0033852 3300049587 Bacteria 3632
210 Ga0501071_0176219 3300049587 Bacteria 1601
211 Ga0501073_0121435 3300049589 Bacteria 1811
212 Ga0501075_0038568 3300049591 Bacteria 3572
213 Ga0501076_0009291 3300049592 Bacteria 7254
214 Ga0501079_0182042 3300049741 Bacteria 1640
215 Ga0501079_0281906 3300049741 Bacteria 1299
216 Ga0501081_0271171 3300049743 Bacteria 1241
217 nmdc:mga05p37_127914_c1 3300050507 Bacteria 3118
218 nmdc:mga05p37_164263_c1 3300050507 Bacteria 2710
219 nmdc:mga05p37_2193_c1 3300050507 Bacteria 22758
220 nmdc:mga05p37_228626_c1 3300050507 Bacteria 2242
221 nmdc:mga05p37_3488_c1 3300050507 Bacteria 18382
222 nmdc:mga05p37_71590_c1 3300050507 Bacteria 4265
223 nmdc:mga09592_123390_c1 3300050508 Bacteria 2226
224 nmdc:mga09592_125194_c1 3300050508 Bacteria 2209
225 nmdc:mga09592_1289_c1 3300050508 Bacteria 20125
226 nmdc:mga09592_20362_c1 3300050508 Bacteria 5453
227 nmdc:mga09592_35953_c1 3300050508 Bacteria 4148
228 nmdc:mga09592_63089_c1 3300050508 Bacteria 3135
229 nmdc:mga0qj67_103341_c1 3300050509 Bacteria 2298
230 nmdc:mga06r32_13641_c1 3300050510 Bacteria 7368
231 nmdc:mga06r32_31171_c1 3300050510 Bacteria 5006
232 nmdc:mga08y16_141613_c1 3300050511 Bacteria 2500
233 nmdc:mga08y16_31575_c1 3300050511 Bacteria 5570
234 nmdc:mga08y16_5516_c1 3300050511 Bacteria 13238
235 nmdc:mga08y16_5653_c1 3300050511 Bacteria 13101
236 nmdc:mga08y16_663453_c1 3300050511 Bacteria 1046
237 nmdc:mga08y16_68703_c1 3300050511 Bacteria 3694
238 nmdc:mga0n895_12564_c1 3300050512 Bacteria 7599
239 nmdc:mga0n895_210409_c1 3300050512 Bacteria 1975
240 nmdc:mga0n895_385552_c1 3300050512 Bacteria 1418
241 nmdc:mga0n895_534335_c1 3300050512 Bacteria 1179
242 nmdc:mga0n895_89369_c1 3300050512 Bacteria 3081
243 nmdc:mga0rr50_102594_c1 3300050513 Bacteria 2250
244 nmdc:mga08x19_111343_c1 3300050514 Bacteria 1083
245 nmdc:mga0a205_109015_c1 3300050515 Bacteria 2667
246 nmdc:mga0a205_69207_c1 3300050515 Bacteria 3409
247 nmdc:mga0a205_82655_c1 3300050515 Bacteria 3102
248 Ga0495595_0004428 3300053084 Bacteria 5651
249 Ga0495619_0024520 3300053085 Bacteria 3869
250 Ga0530510_0232270 3300061734 Bacteria 1372
251 Ga0530510_0330120 3300061734 Bacteria 1144
252 nmdc:mga0n895_8874_c1
253 Ga0065712_10082405
254 Ga0065715_10113875
255 Ga0070690_100046829
256 Ga0070670_100018864
257 Ga0070670_100039063
258 Ga0070689_100004201
259 Ga0070689_100140532
260 Ga0070689_100168364
261 Ga0070689_100245017
262 Ga0070675_100013770
263 Ga0070675_100015414
264 Ga0070675_100035666
265 Ga0070675_100047460
266 Ga0070675_100117961
267 Ga0070671_100000687
268 Ga0070671_100041041
269 Ga0070673_100008374
270 Ga0070688_100000532
271 Ga0070688_100001434
272 Ga0070688_100040329
273 Ga0070688_100306768
274 Ga0070667_100019696
275 Ga0070703_10028964
276 Ga0070701_10030519
277 Ga0070701_10080451
278 Ga0070705_100164416
279 Ga0070705_100203692
280 Ga0070694_100009625
281 Ga0070685_10013809
282 Ga0070685_10015603
283 Ga0070706_100124148
284 Ga0070706_100245119
285 Ga0070707_100036094
286 Ga0070698_100014925
287 Ga0070698_100482558
288 Ga0070697_100109853
289 Ga0070672_100067212
290 Ga0070672_100297563
291 Ga0070686_100023568
292 Ga0070686_100140183
293 Ga0070695_100001297
294 Ga0070695_100004688
295 Ga0070695_100010588
296 Ga0070696_100057736
297 Ga0070704_100012827
298 Ga0070704_100020221
299 Ga0070704_100066961
300 Ga0070704_100074383
301 Ga0070704_100076749
302 Ga0070704_100100705
303 Ga0070664_100028719
304 Ga0070664_100099532
305 Ga0070702_100056255
306 Ga0070702_100158844
307 Ga0068859_100003024
308 Ga0068859_100009050
309 Ga0068859_100225316
310 Ga0068859_100346100
311 Ga0068863_100071375
312 Ga0068863_100155143
313 Ga0068863_100243102
314 Ga0068858_100060528
315 Ga0068860_100007536
316 Ga0068860_100418987
317 Ga0068862_100175703
318 Ga0068862_100254840
319 Ga0068862_100500030
320 Ga0097621_100080571
321 Ga0068871_100318750
322 Ga0075428_100004616
323 Ga0075428_100004866
324 Ga0075428_100052175
325 Ga0075428_100098465
326 Ga0075428_100126828
327 Ga0075428_100145949
328 Ga0075428_100150526
329 Ga0075431_100235189
330 Ga0075431_100301101
331 Ga0075433_10008170
332 Ga0075433_10017843
333 Ga0075433_10069846
334 Ga0075433_10093651
335 Ga0075433_10333636
336 Ga0075434_100032438
337 Ga0075434_100083142
338 Ga0075434_100159993
339 Ga0075434_100209249
340 Ga0075429_100002022
341 Ga0075429_100005425
342 Ga0075429_100039560
343 Ga0075429_100066363
344 Ga0075429_100226756
345 Ga0097620_100003024
346 Ga0097620_100009050
347 Ga0097620_100225344
348 Ga0097620_100346124
349 Ga0075435_100071461
350 Ga0075435_100232213
351 Ga0111539_10007975
352 Ga0111539_10039854
353 Ga0111539_10124463
354 Ga0111539_10125760
355 Ga0111539_10430849
356 Ga0111539_10486661
357 Ga0114129_10000257
358 Ga0114129_10011766
359 Ga0114129_10018514
360 Ga0114129_10153547
361 Ga0114129_10192710
362 Ga0114129_10258884
363 Ga0114129_10651453
364 Ga0105242_10082079
365 Ga0105248_10011739
366 Ga0105246_10212528
367 Ga0157374_10248458
368 Ga0157375_10005563
369 Ga0163163_10126604
370 Ga0157380_10003717
371 Ga0157380_10025713
372 Ga0157379_10000961
373 Ga0157376_10106831
374 Ga0157376_10453986
375 Ga0207680_10020822
376 Ga0207684_10112906
377 Ga0207684_10185079
378 Ga0207662_10002198
379 Ga0207662_10083075
380 Ga0207646_10034080
381 Ga0207646_10173381
382 Ga0207650_10025517
383 Ga0207659_10002104
384 Ga0207659_10047271
385 Ga0207659_10057282
386 Ga0207659_10235687
387 Ga0207644_10001598
388 Ga0207644_10029462
389 Ga0207706_10138810
390 Ga0207686_10054120
391 Ga0207670_10001269
392 Ga0207670_10038498
393 Ga0207670_10054342
394 Ga0207670_10206474
395 Ga0207691_10052965
396 Ga0207711_10001914
397 Ga0207679_10007473
398 Ga0207679_10046127
399 Ga0207651_10026894
400 Ga0207658_10013686
401 Ga0207703_10123374
402 Ga0207708_10137836
403 Ga0207708_10254312
404 Ga0207641_10007631
405 Ga0207641_10397895
406 Ga0207676_10214185
407 Ga0207675_100052183
408 Ga0207428_10016195
409 Ga0207428_10047579
410 Ga0207428_10276499
411 Ga0268265_10077262
412 Ga0268265_10123607
413 Ga0268264_10055437
414 Ga0316579_10028944
415 Ga0316576_10005383
416 Ga0316578_10002626
417 Ga0316578_10031477
418 Ga0316577_10001160
419 Ga0373934_0001427
420 Ga0373953_0006446
421 Ga0373954_0030016
422 Ga0373956_0003336
423 Ga0373955_0002264
424 Ga0316574_0072416
425 Ga0316574_0102379
426 Ga0373924_0111103
427 Ga0373933_0013065
428 Ga0373937_0025383
429 Ga0373937_0041101
430 Ga0373937_0459651
431 Ga0316584_0027935
432 Ga0373925_0183261
433 Ga0451577_0004042
434 Ga0453684_0199769
435 Ga0451576_0030031
436 Ga0451576_0186124
437 Ga0495592_0041722
438 Ga0495603_0085213
439 Ga0495603_0114347
440 Ga0495653_0106681
441 Ga0495608_0012756
442 Ga0495618_0011560
443 Ga0495628_0009215
444 Ga0495630_0260581
445 Ga0495587_0006322
446 Ga0495635_0130224
447 Ga0495657_0097288
448 Ga0495600_0024747
449 Ga0495600_0074693
450 Ga0495636_0008431
451 Ga0495672_0000745
452 Ga0495680_0055383
453 Ga0495680_0105875
454 Ga0495680_0136758
455 Ga0495675_0007744
456 Ga0496104_0450236
457 Ga0501031_0100217
458 Ga0501042_0039775
459 Ga0501048_0022373
460 Ga0501071_0033852
461 Ga0501071_0176219
462 Ga0501073_0121435
463 Ga0501075_0038568
464 Ga0501076_0009291
465 Ga0501079_0182042
466 Ga0501079_0281906
467 Ga0501081_0271171
468 nmdc:mga05p37_127914_c1
469 nmdc:mga05p37_164263_c1
470 nmdc:mga05p37_2193_c1
471 nmdc:mga05p37_228626_c1
472 nmdc:mga05p37_3488_c1
473 nmdc:mga05p37_71590_c1
474 nmdc:mga09592_123390_c1
475 nmdc:mga09592_125194_c1
476 nmdc:mga09592_1289_c1
477 nmdc:mga09592_20362_c1
478 nmdc:mga09592_35953_c1
479 nmdc:mga09592_63089_c1
480 nmdc:mga0qj67_103341_c1
481 nmdc:mga06r32_13641_c1
482 nmdc:mga06r32_31171_c1
483 nmdc:mga08y16_141613_c1
484 nmdc:mga08y16_31575_c1
485 nmdc:mga08y16_5516_c1
486 nmdc:mga08y16_5653_c1
487 nmdc:mga08y16_663453_c1
488 nmdc:mga08y16_68703_c1
489 nmdc:mga0n895_12564_c1
490 nmdc:mga0n895_210409_c1
491 nmdc:mga0n895_385552_c1
492 nmdc:mga0n895_534335_c1
493 nmdc:mga0n895_89369_c1
494 nmdc:mga0rr50_102594_c1
495 nmdc:mga08x19_111343_c1
496 nmdc:mga0a205_109015_c1
497 nmdc:mga0a205_69207_c1
498 nmdc:mga0a205_82655_c1
499 Ga0495595_0004428
500 Ga0495619_0024520
501 Ga0530510_0232270
502 Ga0530510_0330120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00448

SRP54

SRP54-type protein, GTPase domain

132

333

0.99

PF02881

SRP54_N

SRP54-type protein, helical bundle domain

47

113

0.98

PF13604

AAA_30

AAA domain

124

261

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gad-assembly1.cif.gz_l rnc-srp-sr complex early state 0.9168 97 294
5gad-assembly1.cif.gz_l rnc-srp-sr complex early state 0.9125 97 294
2iyl-assembly1.cif.gz_D structure of an ftsy:gdp complex 0.8659 39 303
2cnw-assembly3.cif.gz_F gdpalf4 complex of the srp gtpases ffh and ftsy 0.8371 35 304
5l3w-assembly1.cif.gz_A structure of the crenarchaeal ftsy gtpase bound to gdp 0.8362 39 304
ID Description Score Start End Superfamily
af_P9WGD9_219_421_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9501 102 303 3.40.50.300
1zu5B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9335 98 305 3.40.50.300
af_P9WGD9_219_421_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9321 102 303 3.40.50.300
3dm9B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9318 104 291 3.40.50.300
af_A0A0R0L4Y4_128_288_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9269 100 248 3.40.50.300
ID Description Score Start End GO Terms
AF-W4RJ54-F1-model_v4 Signal recognition particle receptor protein FtsY 0.9666 118 305 GO:0003924
GO:0005047
GO:0005525
GO:0005886
GO:0006614
AF-A0A356L674-F1-model_v4 Signal recognition particle-docking protein FtsY 0.9639 123 305 GO:0003924
GO:0005047
GO:0005525
GO:0005886
GO:0006614
AF-A0A2V8GLJ3-F1-model_v4 Signal recognition particle-docking protein FtsY 0.9563 209 304 GO:0003924
GO:0005047
GO:0005525
GO:0005886
GO:0006614
AF-A0A847W181-F1-model_v4 Signal recognition particle-docking protein FtsY 0.9519 136 304 GO:0003924
GO:0005047
GO:0005525
GO:0005886
GO:0006614
AF-K1SNC8-F1-model_v4 Signal recognition particle-docking protein FtsY 0.9488 124 306 GO:0003924
GO:0005047
GO:0005525
GO:0005886
GO:0006614

Map