F362777
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 141 | 251 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0127776|Ga0501044_0127776_1621_2514 |
| Length | 297 |
| Sequence | MMREISPPPEKFFAALRILSTSPQGGGDFMAGAPLLLIGAGRMGGALLKGWLARGLGPILVVETNPSPTLKRLAKRDVTLLKNLDDAPKKLRACVIALKPQILKTEAPRLRAIAASGTPMISIAAGSSIKLMTKAWGKSARIIRTMPNTPGSIGEGISALFAAPNATRADRKLAESLLAALGETVWVKRETDIDTVTAVSGSGPAYVFLMAEALEEAARREGLPPSIAHRLARKTIIGAGALLKAEDAPAEALRRNVTSPHGTTEAALNILMAKDGMTPLIRRAVSAARKRARELAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 31 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 32 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 48 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 49 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 75 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 76 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 82 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 84 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 85 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 90 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 91 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 93 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 94 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 95 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 96 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 100 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 101 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 113 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 114 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 136 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 137 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 138 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 139 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 140 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.19 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 91.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001446 | 3300003215 | Bacteria | 14215 |
| 2 | rootH2_10000314 | 3300003320 | Bacteria | 11295 |
| 3 | Ga0070658_10061417 | 3300005327 | Bacteria | 3061 |
| 4 | Ga0070683_100158630 | 3300005329 | Bacteria | 2146 |
| 5 | Ga0070666_10001047 | 3300005335 | Bacteria | 16909 |
| 6 | Ga0070666_10009231 | 3300005335 | Bacteria | 6145 |
| 7 | Ga0070680_100000023 | 3300005336 | Bacteria | 78765 |
| 8 | Ga0070660_100463181 | 3300005339 | Bacteria | 1052 |
| 9 | Ga0070691_10000711 | 3300005341 | Bacteria | 13019 |
| 10 | Ga0070691_10003400 | 3300005341 | Bacteria | 7154 |
| 11 | Ga0070692_10107669 | 3300005345 | Bacteria | 1537 |
| 12 | Ga0070659_100004676 | 3300005366 | Bacteria | 9771 |
| 13 | Ga0070667_100331424 | 3300005367 | Bacteria | 1375 |
| 14 | Ga0070709_10000705 | 3300005434 | Bacteria | 18959 |
| 15 | Ga0070714_100147997 | 3300005435 | Bacteria | 2114 |
| 16 | Ga0070714_100315269 | 3300005435 | Unclassified | 1461 |
| 17 | Ga0070713_100000016 | 3300005436 | Bacteria | 121229 |
| 18 | Ga0070713_100166368 | 3300005436 | Unclassified | 1972 |
| 19 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 20 | Ga0070679_100000445 | 3300005530 | Bacteria | 35145 |
| 21 | Ga0070679_100015651 | 3300005530 | Bacteria | 7291 |
| 22 | Ga0070679_100062664 | 3300005530 | Bacteria | 3707 |
| 23 | Ga0068853_100003935 | 3300005539 | Bacteria | 11407 |
| 24 | Ga0068853_100005467 | 3300005539 | Bacteria | 9954 |
| 25 | Ga0070696_100182612 | 3300005546 | Bacteria | 1557 |
| 26 | Ga0070693_100021049 | 3300005547 | Bacteria | 3450 |
| 27 | Ga0070693_100073741 | 3300005547 | Bacteria | 2017 |
| 28 | Ga0070665_100074601 | 3300005548 | Bacteria | 3398 |
| 29 | Ga0070665_100116438 | 3300005548 | Bacteria | 2675 |
| 30 | Ga0068855_100000024 | 3300005563 | Bacteria | 184241 |
| 31 | Ga0068855_100068015 | 3300005563 | Bacteria | 4148 |
| 32 | Ga0068855_100320242 | 3300005563 | Bacteria | 1714 |
| 33 | Ga0068857_100007372 | 3300005577 | Bacteria | 9468 |
| 34 | Ga0068854_100240907 | 3300005578 | Bacteria | 1440 |
| 35 | Ga0068856_100004639 | 3300005614 | Bacteria | 13648 |
| 36 | Ga0068856_100018203 | 3300005614 | Bacteria | 6809 |
| 37 | Ga0068852_100159950 | 3300005616 | Bacteria | 2102 |
| 38 | Ga0068858_100039293 | 3300005842 | Bacteria | 4389 |
| 39 | Ga0070716_100008677 | 3300006173 | Bacteria | 5049 |
| 40 | Ga0070712_100000347 | 3300006175 | Bacteria | 26219 |
| 41 | Ga0070712_100001486 | 3300006175 | Bacteria | 14308 |
| 42 | Ga0097621_100686226 | 3300006237 | Bacteria | 942 |
| 43 | Ga0075434_100039831 | 3300006871 | Bacteria | 4654 |
| 44 | Ga0075434_100159735 | 3300006871 | Bacteria | 2274 |
| 45 | Ga0075436_100001679 | 3300006914 | Bacteria | 15136 |
| 46 | Ga0075436_100016301 | 3300006914 | Bacteria | 5086 |
| 47 | Ga0075435_100082454 | 3300007076 | Bacteria | 2643 |
| 48 | Ga0105240_10000564 | 3300009093 | Bacteria | 68685 |
| 49 | Ga0105240_10042961 | 3300009093 | Bacteria | 5757 |
| 50 | Ga0105240_10074525 | 3300009093 | Bacteria | 4189 |
| 51 | Ga0105241_10173296 | 3300009174 | Bacteria | 1784 |
| 52 | Ga0105241_10231260 | 3300009174 | Bacteria | 1559 |
| 53 | Ga0105242_10014859 | 3300009176 | Bacteria | 6031 |
| 54 | Ga0105248_10000009 | 3300009177 | Bacteria | 403549 |
| 55 | Ga0105237_10009554 | 3300009545 | Bacteria | 10384 |
| 56 | Ga0105238_10001025 | 3300009551 | Bacteria | 28423 |
| 57 | Ga0105238_10048832 | 3300009551 | Bacteria | 4264 |
| 58 | Ga0105238_10152499 | 3300009551 | Bacteria | 2286 |
| 59 | Ga0105239_10006486 | 3300010375 | Bacteria | 13566 |
| 60 | Ga0105239_10012088 | 3300010375 | Bacteria | 9627 |
| 61 | Ga0105239_10019286 | 3300010375 | Bacteria | 7532 |
| 62 | Ga0105239_10019526 | 3300010375 | Bacteria | 7480 |
| 63 | Ga0105239_10760591 | 3300010375 | Bacteria | 1109 |
| 64 | Ga0157373_10002530 | 3300013100 | Bacteria | 13920 |
| 65 | Ga0157370_10005189 | 3300013104 | Bacteria | 14674 |
| 66 | Ga0157370_10027601 | 3300013104 | Bacteria | 5597 |
| 67 | Ga0157369_10008202 | 3300013105 | Bacteria | 11979 |
| 68 | Ga0157369_10030719 | 3300013105 | Bacteria | 5923 |
| 69 | Ga0157374_10162064 | 3300013296 | Bacteria | 2178 |
| 70 | Ga0157378_10090051 | 3300013297 | Bacteria | 2788 |
| 71 | Ga0157372_10003755 | 3300013307 | Bacteria | 16310 |
| 72 | Ga0157372_10018463 | 3300013307 | Bacteria | 7497 |
| 73 | Ga0157372_10062334 | 3300013307 | Bacteria | 4178 |
| 74 | Ga0157372_10155952 | 3300013307 | Bacteria | 2637 |
| 75 | Ga0157372_10245619 | 3300013307 | Bacteria | 2077 |
| 76 | Ga0157379_10176114 | 3300014968 | Bacteria | 1931 |
| 77 | Ga0213874_10003608 | 3300021377 | Bacteria | 3455 |
| 78 | Ga0213874_10017230 | 3300021377 | Bacteria | 1934 |
| 79 | Ga0213876_10000521 | 3300021384 | Bacteria | 29455 |
| 80 | Ga0213876_10001980 | 3300021384 | Bacteria | 12245 |
| 81 | Ga0209455_1006584 | 3300025272 | Bacteria | 3412 |
| 82 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 83 | Ga0207680_10007021 | 3300025903 | Bacteria | 5468 |
| 84 | Ga0207680_10214718 | 3300025903 | Bacteria | 1317 |
| 85 | Ga0207685_10143161 | 3300025905 | Bacteria | 1074 |
| 86 | Ga0207699_10000295 | 3300025906 | Bacteria | 26738 |
| 87 | Ga0207699_10142292 | 3300025906 | Bacteria | 1578 |
| 88 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 89 | Ga0207707_10001430 | 3300025912 | Bacteria | 22073 |
| 90 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 91 | Ga0207695_10039804 | 3300025913 | Bacteria | 5049 |
| 92 | Ga0207693_10000876 | 3300025915 | Bacteria | 26927 |
| 93 | Ga0207693_10001786 | 3300025915 | Bacteria | 18850 |
| 94 | Ga0207663_10019891 | 3300025916 | Bacteria | 3792 |
| 95 | Ga0207660_10004630 | 3300025917 | Bacteria | 8965 |
| 96 | Ga0207657_10000762 | 3300025919 | Bacteria | 34172 |
| 97 | Ga0207657_10103337 | 3300025919 | Bacteria | 2362 |
| 98 | Ga0207652_10000299 | 3300025921 | Bacteria | 51311 |
| 99 | Ga0207652_10002357 | 3300025921 | Bacteria | 15976 |
| 100 | Ga0207652_10402199 | 3300025921 | Bacteria | 1235 |
| 101 | Ga0207694_10000016 | 3300025924 | Bacteria | 349087 |
| 102 | Ga0207694_10161291 | 3300025924 | Bacteria | 1811 |
| 103 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 104 | Ga0207664_10088218 | 3300025929 | Bacteria | 2538 |
| 105 | Ga0207686_10057994 | 3300025934 | Bacteria | 2440 |
| 106 | Ga0207665_10035143 | 3300025939 | Bacteria | 3325 |
| 107 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 108 | Ga0207711_10000005 | 3300025941 | Bacteria | 822972 |
| 109 | Ga0207711_10000009 | 3300025941 | Bacteria | 580864 |
| 110 | Ga0207711_10000015 | 3300025941 | Bacteria | 494097 |
| 111 | Ga0207667_10000021 | 3300025949 | Bacteria | 370524 |
| 112 | Ga0207667_10046031 | 3300025949 | Bacteria | 4619 |
| 113 | Ga0207667_10048873 | 3300025949 | Bacteria | 4471 |
| 114 | Ga0207667_10143004 | 3300025949 | Bacteria | 2463 |
| 115 | Ga0207703_10120983 | 3300026035 | Bacteria | 2247 |
| 116 | Ga0207639_10112631 | 3300026041 | Bacteria | 2221 |
| 117 | Ga0207639_10172753 | 3300026041 | Bacteria | 1832 |
| 118 | Ga0207639_10182891 | 3300026041 | Bacteria | 1784 |
| 119 | Ga0207702_10000102 | 3300026078 | Bacteria | 99313 |
| 120 | Ga0207702_10000787 | 3300026078 | Bacteria | 33615 |
| 121 | Ga0207674_10000378 | 3300026116 | Bacteria | 57957 |
| 122 | Ga0207698_10030674 | 3300026142 | Bacteria | 3870 |
| 123 | Ga0207698_10185694 | 3300026142 | Bacteria | 1847 |
| 124 | Ga0268266_10012732 | 3300028379 | Bacteria | 7269 |
| 125 | Ga0268266_10017536 | 3300028379 | Bacteria | 6108 |
| 126 | Ga0268266_10284737 | 3300028379 | Bacteria | 1538 |
| 127 | Ga0265337_1004943 | 3300028556 | Bacteria | 5424 |
| 128 | Ga0265334_10005148 | 3300028573 | Bacteria | 5727 |
| 129 | Ga0265318_10000046 | 3300028577 | Bacteria | 126568 |
| 130 | Ga0265338_10020601 | 3300028800 | Bacteria | 6928 |
| 131 | Ga0265338_10026709 | 3300028800 | Bacteria | 5811 |
| 132 | Ga0265338_10031050 | 3300028800 | Bacteria | 5246 |
| 133 | Ga0265330_10003295 | 3300031235 | Bacteria | 8493 |
| 134 | Ga0265330_10038777 | 3300031235 | Bacteria | 2118 |
| 135 | Ga0265332_10084204 | 3300031238 | Bacteria | 1348 |
| 136 | Ga0265320_10000179 | 3300031240 | Bacteria | 53742 |
| 137 | Ga0265325_10000537 | 3300031241 | Bacteria | 27498 |
| 138 | Ga0265325_10001900 | 3300031241 | Bacteria | 14418 |
| 139 | Ga0265325_10076640 | 3300031241 | Unclassified | 1668 |
| 140 | Ga0265325_10082223 | 3300031241 | Bacteria | 1599 |
| 141 | Ga0265329_10036351 | 3300031242 | Unclassified | 1588 |
| 142 | Ga0265340_10000080 | 3300031247 | Bacteria | 46799 |
| 143 | Ga0265340_10000118 | 3300031247 | Bacteria | 38702 |
| 144 | Ga0265340_10001080 | 3300031247 | Bacteria | 15533 |
| 145 | Ga0265340_10054926 | 3300031247 | Bacteria | 1920 |
| 146 | Ga0265340_10125558 | 3300031247 | Bacteria | 1179 |
| 147 | Ga0265339_10009717 | 3300031249 | Bacteria | 6017 |
| 148 | Ga0265339_10010898 | 3300031249 | Bacteria | 5620 |
| 149 | Ga0265316_10006247 | 3300031344 | Bacteria | 11420 |
| 150 | Ga0265316_10018626 | 3300031344 | Bacteria | 5963 |
| 151 | Ga0265316_10080142 | 3300031344 | Bacteria | 2504 |
| 152 | Ga0265313_10000907 | 3300031595 | Bacteria | 29634 |
| 153 | Ga0265313_10003286 | 3300031595 | Bacteria | 13275 |
| 154 | Ga0265313_10083345 | 3300031595 | Bacteria | 1448 |
| 155 | Ga0265313_10125321 | 3300031595 | Bacteria | 1117 |
| 156 | Ga0265314_10003297 | 3300031711 | Bacteria | 15767 |
| 157 | Ga0265314_10047995 | 3300031711 | Bacteria | 3000 |
| 158 | Ga0265314_10082073 | 3300031711 | Bacteria | 2122 |
| 159 | Ga0265314_10083703 | 3300031711 | Bacteria | 2096 |
| 160 | Ga0265314_10088795 | 3300031711 | Bacteria | 2018 |
| 161 | Ga0265342_10004310 | 3300031712 | Bacteria | 11264 |
| 162 | Ga0265342_10018632 | 3300031712 | Bacteria | 4488 |
| 163 | Ga0265342_10042302 | 3300031712 | Bacteria | 2753 |
| 164 | Ga0307516_10016131 | 3300031730 | Bacteria | 7827 |
| 165 | Ga0373934_0120134 | 3300035086 | Unclassified | 1069 |
| 166 | Ga0373932_0027750 | 3300035112 | Bacteria | 1551 |
| 167 | Ga0373943_0003428 | 3300035170 | Bacteria | 7220 |
| 168 | Ga0373955_0087671 | 3300035172 | Bacteria | 1769 |
| 169 | Ga0373931_0002678 | 3300035691 | Bacteria | 7922 |
| 170 | Ga0373935_0010934 | 3300035692 | Bacteria | 5449 |
| 171 | Ga0373927_0032978 | 3300035695 | Bacteria | 3372 |
| 172 | Ga0373937_0027237 | 3300036401 | Bacteria | 5168 |
| 173 | Ga0373937_0050375 | 3300036401 | Bacteria | 3814 |
| 174 | Ga0373937_0051903 | 3300036401 | Bacteria | 3759 |
| 175 | Ga0373925_0001852 | 3300037068 | Bacteria | 17614 |
| 176 | Ga0373925_0372993 | 3300037068 | Bacteria | 1161 |
| 177 | Ga0436365_1004240 | 3300039437 | Bacteria | 80154 |
| 178 | Ga0436365_1295905 | 3300039437 | Bacteria | 848 |
| 179 | Ga0436365_1754533 | 3300039437 | Bacteria | 1016 |
| 180 | Ga0436365_1935268 | 3300039437 | Bacteria | 135877 |
| 181 | Ga0436363_1045901 | 3300039450 | Bacteria | 3450 |
| 182 | Ga0436363_1379663 | 3300039450 | Bacteria | 7686 |
| 183 | Ga0495592_0178147 | 3300046454 | Bacteria | 1450 |
| 184 | Ga0495580_0002971 | 3300046472 | Bacteria | 14554 |
| 185 | Ga0495580_0082902 | 3300046472 | Bacteria | 2235 |
| 186 | Ga0495582_0021415 | 3300046473 | Bacteria | 3538 |
| 187 | Ga0495664_0132497 | 3300046477 | Bacteria | 1510 |
| 188 | Ga0495620_0201108 | 3300046515 | Bacteria | 766 |
| 189 | Ga0495628_0185057 | 3300046516 | Bacteria | 1574 |
| 190 | Ga0495652_0084436 | 3300046529 | Bacteria | 2611 |
| 191 | Ga0495640_0284042 | 3300046533 | Bacteria | 1030 |
| 192 | Ga0495645_0002312 | 3300046543 | Bacteria | 12938 |
| 193 | Ga0495645_0042446 | 3300046543 | Bacteria | 3316 |
| 194 | Ga0495645_0088992 | 3300046543 | Bacteria | 2208 |
| 195 | Ga0495634_0166532 | 3300046642 | Bacteria | 1387 |
| 196 | Ga0495658_0003511 | 3300046683 | Bacteria | 7758 |
| 197 | Ga0495658_0112273 | 3300046683 | Bacteria | 1640 |
| 198 | Ga0496115_0445028 | 3300048918 | Bacteria | 1047 |
| 199 | Ga0496126_0000159 | 3300048929 | Bacteria | 155348 |
| 200 | Ga0495682_0003794 | 3300049460 | Bacteria | 6646 |
| 201 | Ga0501031_0021688 | 3300049568 | Bacteria | 4187 |
| 202 | Ga0501033_0114580 | 3300049570 | Bacteria | 1959 |
| 203 | Ga0501033_0182516 | 3300049570 | Bacteria | 1504 |
| 204 | Ga0501037_0102403 | 3300049573 | Bacteria | 2065 |
| 205 | Ga0501037_0214966 | 3300049573 | Bacteria | 1354 |
| 206 | Ga0501038_0059702 | 3300049574 | Bacteria | 3266 |
| 207 | Ga0501043_0074052 | 3300049579 | Bacteria | 2675 |
| 208 | Ga0501043_0225210 | 3300049579 | Bacteria | 1449 |
| 209 | Ga0501043_0346959 | 3300049579 | Bacteria | 1128 |
| 210 | Ga0501047_0002517 | 3300049581 | Bacteria | 17477 |
| 211 | Ga0501047_0047427 | 3300049581 | Bacteria | 4151 |
| 212 | Ga0501047_0204509 | 3300049581 | Bacteria | 1834 |
| 213 | Ga0501047_0249468 | 3300049581 | Unclassified | 1624 |
| 214 | Ga0501047_0486778 | 3300049581 | Bacteria | 1061 |
| 215 | Ga0501067_0027852 | 3300049583 | Bacteria | 3131 |
| 216 | Ga0501067_0152235 | 3300049583 | Bacteria | 1289 |
| 217 | Ga0501068_0043754 | 3300049584 | Bacteria | 2695 |
| 218 | Ga0501069_0157044 | 3300049585 | Bacteria | 1309 |
| 219 | Ga0501070_0141218 | 3300049586 | Bacteria | 1988 |
| 220 | Ga0501070_0176024 | 3300049586 | Bacteria | 1761 |
| 221 | Ga0501070_0298617 | 3300049586 | Bacteria | 1312 |
| 222 | Ga0501072_0100052 | 3300049588 | Bacteria | 2304 |
| 223 | Ga0501073_0008977 | 3300049589 | Bacteria | 7383 |
| 224 | Ga0501073_0445270 | 3300049589 | Bacteria | 895 |
| 225 | Ga0501074_0120075 | 3300049590 | Bacteria | 1880 |
| 226 | Ga0501079_0044327 | 3300049741 | Bacteria | 3433 |
| 227 | Ga0501080_0000693 | 3300049742 | Bacteria | 27033 |
| 228 | Ga0501080_0012632 | 3300049742 | Bacteria | 7744 |
| 229 | Ga0501080_0053236 | 3300049742 | Bacteria | 3767 |
| 230 | Ga0501035_0000593 | 3300049822 | Bacteria | 39882 |
| 231 | Ga0501035_0054076 | 3300049822 | Bacteria | 3588 |
| 232 | Ga0501035_0207845 | 3300049822 | Bacteria | 1676 |
| 233 | Ga0501044_0001971 | 3300049823 | Bacteria | 23742 |
| 234 | Ga0501044_0024086 | 3300049823 | Bacteria | 6467 |
| 235 | Ga0501044_0064825 | 3300049823 | Bacteria | 3727 |
| 236 | Ga0501044_0079301 | 3300049823 | Bacteria | 3327 |
| 237 | Ga0501044_0127776 | 3300049823 | Bacteria | 2538 |
| 238 | Ga0501044_0643141 | 3300049823 | Bacteria | 950 |
| 239 | nmdc:mga0n895_149639_c1 | 3300050512 | Bacteria | 2364 |
| 240 | nmdc:mga0n895_37140_c1 | 3300050512 | Bacteria | 4710 |
| 241 | nmdc:mga0rr50_41122_c1 | 3300050513 | Bacteria | 3366 |
| 242 | nmdc:mga08x19_15960_c1 | 3300050514 | Bacteria | 4576 |
| 243 | nmdc:mga08x19_160_c1 | 3300050514 | Bacteria | 55694 |
| 244 | Ga0500595_010372 | 3300053119 | Bacteria | 3706 |
| 245 | Ga0500655_005414 | 3300053133 | Bacteria | 2302 |
| 246 | Ga0500559_0182217 | 3300053136 | Bacteria | 989 |
| 247 | Ga0500619_030535 | 3300053154 | Bacteria | 1638 |
| 248 | Ga0500645_024705 | 3300053730 | Bacteria | 1836 |
| 249 | Ga0501084_0000431 | 3300054114 | Bacteria | 32242 |
| 250 | Ga0501082_0220975 | 3300060353 | Bacteria | 1648 |
| 251 | Ga0501082_0427272 | 3300060353 | Bacteria | 1157 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031247 | Ga0265340_10125558 | Ga0265340_101255581 | 207 |
| 2 | 3300009176 | Ga0105242_10014859 | Ga0105242_100148598 | 220 |
| 3 | 3300025934 | Ga0207686_10057994 | Ga0207686_100579944 | 220 |
| 4 | 3300035170 | Ga0373943_0003428 | Ga0373943_0003428_3351_4199 | 220 |
| 5 | 3300035692 | Ga0373935_0010934 | Ga0373935_0010934_24_872 | 220 |
| 6 | 3300035695 | Ga0373927_0032978 | Ga0373927_0032978_66_914 | 220 |
| 7 | 3300037068 | Ga0373925_0001852 | Ga0373925_0001852_3464_4312 | 220 |
| 8 | 3300036401 | Ga0373937_0051903 | Ga0373937_0051903_1176_2024 | 225 |
| 9 | 3300035086 | Ga0373934_0120134 | Ga0373934_0120134_23_712 | 227 |
| 10 | 3300035172 | Ga0373955_0087671 | Ga0373955_0087671_23_712 | 227 |
| 11 | 3300046515 | Ga0495620_0201108 | Ga0495620_0201108_65_751 | 227 |
| 12 | 3300031711 | Ga0265314_10047995 | Ga0265314_100479952 | 230 |
| 13 | 3300046533 | Ga0495640_0284042 | Ga0495640_0284042_134_961 | 234 |
| 14 | 3300046642 | Ga0495634_0166532 | Ga0495634_0166532_473_1300 | 234 |
| 15 | 3300046683 | Ga0495658_0112273 | Ga0495658_0112273_625_1452 | 234 |
| 16 | 3300003320 | rootH2_10000314 | rootH2_100003147 | 235 |
| 17 | 3300005548 | Ga0070665_100116438 | Ga0070665_1001164382 | 240 |
| 18 | 3300009093 | Ga0105240_10074525 | Ga0105240_100745253 | 240 |
| 19 | 3300009174 | Ga0105241_10231260 | Ga0105241_102312602 | 240 |
| 20 | 3300028379 | Ga0268266_10012732 | Ga0268266_100127328 | 240 |
| 21 | 3300010375 | Ga0105239_10760591 | Ga0105239_107605912 | 243 |
| 22 | 3300031247 | Ga0265340_10000080 | Ga0265340_1000008054 | 243 |
| 23 | 3300031247 | Ga0265340_10001080 | Ga0265340_100010806 | 243 |
| 24 | 3300031344 | Ga0265316_10006247 | Ga0265316_1000624710 | 243 |
| 25 | 3300031595 | Ga0265313_10125321 | Ga0265313_101253211 | 243 |
| 26 | 3300021384 | Ga0213876_10001980 | Ga0213876_1000198015 | 244 |
| 27 | 3300049589 | Ga0501073_0445270 | Ga0501073_0445270_63_806 | 244 |
| 28 | 3300031241 | Ga0265325_10082223 | Ga0265325_100822232 | 246 |
| 29 | 3300005539 | Ga0068853_100003935 | Ga0068853_10000393513 | 247 |
| 30 | 3300005563 | Ga0068855_100000024 | Ga0068855_10000002414 | 247 |
| 31 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003136 | 247 |
| 32 | 3300025924 | Ga0207694_10000016 | Ga0207694_10000016115 | 247 |
| 33 | 3300025949 | Ga0207667_10000021 | Ga0207667_10000021239 | 247 |
| 34 | 3300026041 | Ga0207639_10112631 | Ga0207639_101126314 | 247 |
| 35 | 3300026142 | Ga0207698_10030674 | Ga0207698_100306745 | 247 |
| 36 | 3300028577 | Ga0265318_10000046 | Ga0265318_1000004664 | 247 |
| 37 | 3300031730 | Ga0307516_10016131 | Ga0307516_100161318 | 247 |
| 38 | 3300046516 | Ga0495628_0185057 | Ga0495628_0185057_662_1414 | 247 |
| 39 | 3300049460 | Ga0495682_0003794 | Ga0495682_0003794_3791_4543 | 247 |
| 40 | 3300049581 | Ga0501047_0002517 | Ga0501047_0002517_15947_16699 | 247 |
| 41 | 3300049583 | Ga0501067_0027852 | Ga0501067_0027852_774_1526 | 247 |
| 42 | 3300049588 | Ga0501072_0100052 | Ga0501072_0100052_1300_2052 | 247 |
| 43 | 3300049589 | Ga0501073_0008977 | Ga0501073_0008977_298_1050 | 247 |
| 44 | 3300049590 | Ga0501074_0120075 | Ga0501074_0120075_1088_1840 | 247 |
| 45 | 3300049741 | Ga0501079_0044327 | Ga0501079_0044327_141_893 | 247 |
| 46 | 3300053133 | Ga0500655_005414 | Ga0500655_005414_736_1488 | 247 |
| 47 | 3300060353 | Ga0501082_0427272 | Ga0501082_0427272_216_968 | 247 |
| 48 | 3300039437 | Ga0436365_1004240 | Ga0436365_1004240_11129_11956 | 248 |
| 49 | 3300049583 | Ga0501067_0152235 | Ga0501067_0152235_31_837 | 248 |
| 50 | 3300054114 | Ga0501084_0000431 | Ga0501084_0000431_30317_31123 | 248 |
| 51 | 3300060353 | Ga0501082_0220975 | Ga0501082_0220975_812_1618 | 248 |
| 52 | 3300048929 | Ga0496126_0000159 | Ga0496126_0000159_23109_23900 | 249 |
| 53 | 3300053730 | Ga0500645_024705 | Ga0500645_024705_879_1679 | 249 |
| 54 | 3300005336 | Ga0070680_100000023 | Ga0070680_10000002349 | 251 |
| 55 | 3300005458 | Ga0070681_10000002 | Ga0070681_1000000243 | 251 |
| 56 | 3300005530 | Ga0070679_100000445 | Ga0070679_10000044518 | 251 |
| 57 | 3300005616 | Ga0068852_100159950 | Ga0068852_1001599503 | 251 |
| 58 | 3300009093 | Ga0105240_10000564 | Ga0105240_1000056420 | 251 |
| 59 | 3300009174 | Ga0105241_10173296 | Ga0105241_101732962 | 251 |
| 60 | 3300009177 | Ga0105248_10000009 | Ga0105248_10000009366 | 251 |
| 61 | 3300009551 | Ga0105238_10152499 | Ga0105238_101524992 | 251 |
| 62 | 3300010375 | Ga0105239_10006486 | Ga0105239_1000648610 | 251 |
| 63 | 3300010375 | Ga0105239_10012088 | Ga0105239_100120887 | 251 |
| 64 | 3300010375 | Ga0105239_10019526 | Ga0105239_100195266 | 251 |
| 65 | 3300013105 | Ga0157369_10030719 | Ga0157369_100307192 | 251 |
| 66 | 3300021377 | Ga0213874_10003608 | Ga0213874_100036083 | 251 |
| 67 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002908 | 251 |
| 68 | 3300025921 | Ga0207652_10000299 | Ga0207652_100002992 | 251 |
| 69 | 3300025941 | Ga0207711_10000003 | Ga0207711_10000003694 | 251 |
| 70 | 3300025941 | Ga0207711_10000005 | Ga0207711_10000005440 | 251 |
| 71 | 3300025941 | Ga0207711_10000009 | Ga0207711_10000009216 | 251 |
| 72 | 3300025941 | Ga0207711_10000015 | Ga0207711_10000015447 | 251 |
| 73 | 3300026142 | Ga0207698_10185694 | Ga0207698_101856943 | 251 |
| 74 | 3300028800 | Ga0265338_10020601 | Ga0265338_100206013 | 251 |
| 75 | 3300028800 | Ga0265338_10026709 | Ga0265338_100267094 | 251 |
| 76 | 3300031235 | Ga0265330_10003295 | Ga0265330_1000329511 | 251 |
| 77 | 3300031235 | Ga0265330_10038777 | Ga0265330_100387773 | 251 |
| 78 | 3300031238 | Ga0265332_10084204 | Ga0265332_100842042 | 251 |
| 79 | 3300031241 | Ga0265325_10001900 | Ga0265325_1000190015 | 251 |
| 80 | 3300031241 | Ga0265325_10076640 | Ga0265325_100766402 | 251 |
| 81 | 3300031242 | Ga0265329_10036351 | Ga0265329_100363512 | 251 |
| 82 | 3300031247 | Ga0265340_10000118 | Ga0265340_100001188 | 251 |
| 83 | 3300031247 | Ga0265340_10054926 | Ga0265340_100549261 | 251 |
| 84 | 3300031249 | Ga0265339_10010898 | Ga0265339_100108982 | 251 |
| 85 | 3300031344 | Ga0265316_10018626 | Ga0265316_100186262 | 251 |
| 86 | 3300031595 | Ga0265313_10003286 | Ga0265313_100032864 | 251 |
| 87 | 3300031595 | Ga0265313_10083345 | Ga0265313_100833452 | 251 |
| 88 | 3300031711 | Ga0265314_10003297 | Ga0265314_1000329718 | 251 |
| 89 | 3300031711 | Ga0265314_10088795 | Ga0265314_100887954 | 251 |
| 90 | 3300031712 | Ga0265342_10004310 | Ga0265342_100043106 | 251 |
| 91 | 3300031712 | Ga0265342_10018632 | Ga0265342_100186322 | 251 |
| 92 | 3300031712 | Ga0265342_10042302 | Ga0265342_100423022 | 251 |
| 93 | 3300039450 | Ga0436363_1045901 | Ga0436363_1045901_1225_2040 | 251 |
| 94 | 3300046454 | Ga0495592_0178147 | Ga0495592_0178147_183_998 | 251 |
| 95 | 3300046477 | Ga0495664_0132497 | Ga0495664_0132497_356_1171 | 251 |
| 96 | 3300046529 | Ga0495652_0084436 | Ga0495652_0084436_931_1746 | 251 |
| 97 | 3300046543 | Ga0495645_0002312 | Ga0495645_0002312_2876_3691 | 251 |
| 98 | 3300046543 | Ga0495645_0042446 | Ga0495645_0042446_628_1443 | 251 |
| 99 | 3300048918 | Ga0496115_0445028 | Ga0496115_0445028_113_877 | 251 |
| 100 | 3300049581 | Ga0501047_0047427 | Ga0501047_0047427_2224_2988 | 251 |
| 101 | 3300049581 | Ga0501047_0486778 | Ga0501047_0486778_247_1011 | 251 |
| 102 | 3300049586 | Ga0501070_0298617 | Ga0501070_0298617_362_1126 | 251 |
| 103 | 3300049742 | Ga0501080_0012632 | Ga0501080_0012632_4002_4766 | 251 |
| 104 | 3300053154 | Ga0500619_030535 | Ga0500619_030535_76_891 | 251 |
| 105 | 3300005435 | Ga0070714_100147997 | Ga0070714_1001479972 | 252 |
| 106 | 3300025929 | Ga0207664_10088218 | Ga0207664_100882182 | 252 |
| 107 | 3300049570 | Ga0501033_0114580 | Ga0501033_0114580_712_1479 | 252 |
| 108 | 3300049822 | Ga0501035_0054076 | Ga0501035_0054076_84_851 | 252 |
| 109 | 3300049823 | Ga0501044_0079301 | Ga0501044_0079301_440_1207 | 252 |
| 110 | 3300005341 | Ga0070691_10003400 | Ga0070691_100034002 | 253 |
| 111 | 3300005366 | Ga0070659_100004676 | Ga0070659_1000046769 | 253 |
| 112 | 3300005435 | Ga0070714_100315269 | Ga0070714_1003152691 | 253 |
| 113 | 3300005578 | Ga0068854_100240907 | Ga0068854_1002409072 | 253 |
| 114 | 3300006175 | Ga0070712_100001486 | Ga0070712_10000148614 | 253 |
| 115 | 3300009551 | Ga0105238_10048832 | Ga0105238_100488324 | 253 |
| 116 | 3300013104 | Ga0157370_10005189 | Ga0157370_1000518914 | 253 |
| 117 | 3300013307 | Ga0157372_10062334 | Ga0157372_100623343 | 253 |
| 118 | 3300025912 | Ga0207707_10001430 | Ga0207707_1000143016 | 253 |
| 119 | 3300025915 | Ga0207693_10001786 | Ga0207693_1000178615 | 253 |
| 120 | 3300025917 | Ga0207660_10004630 | Ga0207660_100046309 | 253 |
| 121 | 3300025919 | Ga0207657_10000762 | Ga0207657_1000076212 | 253 |
| 122 | 3300025921 | Ga0207652_10002357 | Ga0207652_100023575 | 253 |
| 123 | 3300025949 | Ga0207667_10046031 | Ga0207667_100460314 | 253 |
| 124 | 3300026041 | Ga0207639_10172753 | Ga0207639_101727532 | 253 |
| 125 | 3300031711 | Ga0265314_10083703 | Ga0265314_100837032 | 253 |
| 126 | 3300037068 | Ga0373925_0372993 | Ga0373925_0372993_92_940 | 253 |
| 127 | 3300039437 | Ga0436365_1295905 | Ga0436365_1295905_54_821 | 253 |
| 128 | 3300046472 | Ga0495580_0002971 | Ga0495580_0002971_10924_11772 | 253 |
| 129 | 3300046473 | Ga0495582_0021415 | Ga0495582_0021415_2062_2910 | 253 |
| 130 | 3300046543 | Ga0495645_0088992 | Ga0495645_0088992_546_1322 | 253 |
| 131 | 3300046683 | Ga0495658_0003511 | Ga0495658_0003511_645_1493 | 253 |
| 132 | 3300049568 | Ga0501031_0021688 | Ga0501031_0021688_1387_2154 | 253 |
| 133 | 3300049570 | Ga0501033_0182516 | Ga0501033_0182516_75_842 | 253 |
| 134 | 3300049573 | Ga0501037_0102403 | Ga0501037_0102403_396_1163 | 253 |
| 135 | 3300049573 | Ga0501037_0214966 | Ga0501037_0214966_264_1031 | 253 |
| 136 | 3300049574 | Ga0501038_0059702 | Ga0501038_0059702_1950_2717 | 253 |
| 137 | 3300049579 | Ga0501043_0074052 | Ga0501043_0074052_1831_2598 | 253 |
| 138 | 3300049579 | Ga0501043_0346959 | Ga0501043_0346959_167_934 | 253 |
| 139 | 3300049581 | Ga0501047_0204509 | Ga0501047_0204509_1008_1775 | 253 |
| 140 | 3300049585 | Ga0501069_0157044 | Ga0501069_0157044_89_856 | 253 |
| 141 | 3300049586 | Ga0501070_0141218 | Ga0501070_0141218_729_1496 | 253 |
| 142 | 3300049742 | Ga0501080_0000693 | Ga0501080_0000693_19767_20534 | 253 |
| 143 | 3300049822 | Ga0501035_0000593 | Ga0501035_0000593_21915_22682 | 253 |
| 144 | 3300049822 | Ga0501035_0207845 | Ga0501035_0207845_132_899 | 253 |
| 145 | 3300049823 | Ga0501044_0001971 | Ga0501044_0001971_22264_23031 | 253 |
| 146 | 3300049823 | Ga0501044_0024086 | Ga0501044_0024086_66_833 | 253 |
| 147 | 3300049823 | Ga0501044_0127776 | Ga0501044_0127776_1621_2514 | 253 |
| 148 | 3300049823 | Ga0501044_0643141 | Ga0501044_0643141_158_925 | 253 |
| 149 | 3300003215 | JGI25153J46596_10001446 | JGI25153J46596_1000144613 | 254 |
| 150 | 3300005327 | Ga0070658_10061417 | Ga0070658_100614173 | 254 |
| 151 | 3300005329 | Ga0070683_100158630 | Ga0070683_1001586303 | 254 |
| 152 | 3300005335 | Ga0070666_10001047 | Ga0070666_1000104710 | 254 |
| 153 | 3300005335 | Ga0070666_10009231 | Ga0070666_100092317 | 254 |
| 154 | 3300005339 | Ga0070660_100463181 | Ga0070660_1004631812 | 254 |
| 155 | 3300005341 | Ga0070691_10000711 | Ga0070691_1000071113 | 254 |
| 156 | 3300005345 | Ga0070692_10107669 | Ga0070692_101076692 | 254 |
| 157 | 3300005367 | Ga0070667_100331424 | Ga0070667_1003314242 | 254 |
| 158 | 3300005434 | Ga0070709_10000705 | Ga0070709_1000070511 | 254 |
| 159 | 3300005436 | Ga0070713_100000016 | Ga0070713_10000001611 | 254 |
| 160 | 3300005436 | Ga0070713_100166368 | Ga0070713_1001663681 | 254 |
| 161 | 3300005530 | Ga0070679_100015651 | Ga0070679_1000156515 | 254 |
| 162 | 3300005530 | Ga0070679_100062664 | Ga0070679_1000626642 | 254 |
| 163 | 3300005539 | Ga0068853_100005467 | Ga0068853_1000054674 | 254 |
| 164 | 3300005546 | Ga0070696_100182612 | Ga0070696_1001826122 | 254 |
| 165 | 3300005547 | Ga0070693_100021049 | Ga0070693_1000210495 | 254 |
| 166 | 3300005547 | Ga0070693_100073741 | Ga0070693_1000737412 | 254 |
| 167 | 3300005548 | Ga0070665_100074601 | Ga0070665_1000746012 | 254 |
| 168 | 3300005563 | Ga0068855_100068015 | Ga0068855_1000680153 | 254 |
| 169 | 3300005563 | Ga0068855_100320242 | Ga0068855_1003202423 | 254 |
| 170 | 3300005577 | Ga0068857_100007372 | Ga0068857_1000073728 | 254 |
| 171 | 3300005614 | Ga0068856_100004639 | Ga0068856_10000463915 | 254 |
| 172 | 3300005614 | Ga0068856_100018203 | Ga0068856_1000182033 | 254 |
| 173 | 3300005842 | Ga0068858_100039293 | Ga0068858_1000392934 | 254 |
| 174 | 3300006173 | Ga0070716_100008677 | Ga0070716_1000086774 | 254 |
| 175 | 3300006175 | Ga0070712_100000347 | Ga0070712_10000034711 | 254 |
| 176 | 3300006237 | Ga0097621_100686226 | Ga0097621_1006862262 | 254 |
| 177 | 3300006871 | Ga0075434_100039831 | Ga0075434_1000398313 | 254 |
| 178 | 3300006871 | Ga0075434_100159735 | Ga0075434_1001597353 | 254 |
| 179 | 3300006914 | Ga0075436_100001679 | Ga0075436_10000167911 | 254 |
| 180 | 3300006914 | Ga0075436_100016301 | Ga0075436_1000163016 | 254 |
| 181 | 3300007076 | Ga0075435_100082454 | Ga0075435_1000824543 | 254 |
| 182 | 3300009093 | Ga0105240_10042961 | Ga0105240_100429617 | 254 |
| 183 | 3300009545 | Ga0105237_10009554 | Ga0105237_1000955413 | 254 |
| 184 | 3300009551 | Ga0105238_10001025 | Ga0105238_100010255 | 254 |
| 185 | 3300010375 | Ga0105239_10019286 | Ga0105239_100192869 | 254 |
| 186 | 3300013100 | Ga0157373_10002530 | Ga0157373_100025306 | 254 |
| 187 | 3300013104 | Ga0157370_10027601 | Ga0157370_100276016 | 254 |
| 188 | 3300013105 | Ga0157369_10008202 | Ga0157369_1000820212 | 254 |
| 189 | 3300013296 | Ga0157374_10162064 | Ga0157374_101620643 | 254 |
| 190 | 3300013297 | Ga0157378_10090051 | Ga0157378_100900511 | 254 |
| 191 | 3300013307 | Ga0157372_10003755 | Ga0157372_1000375515 | 254 |
| 192 | 3300013307 | Ga0157372_10018463 | Ga0157372_100184632 | 254 |
| 193 | 3300013307 | Ga0157372_10155952 | Ga0157372_101559522 | 254 |
| 194 | 3300013307 | Ga0157372_10245619 | Ga0157372_102456193 | 254 |
| 195 | 3300014968 | Ga0157379_10176114 | Ga0157379_101761142 | 254 |
| 196 | 3300021377 | Ga0213874_10017230 | Ga0213874_100172304 | 254 |
| 197 | 3300021384 | Ga0213876_10000521 | Ga0213876_1000052124 | 254 |
| 198 | 3300025272 | Ga0209455_1006584 | Ga0209455_10065842 | 254 |
| 199 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008672 | 254 |
| 200 | 3300025903 | Ga0207680_10007021 | Ga0207680_100070217 | 254 |
| 201 | 3300025903 | Ga0207680_10214718 | Ga0207680_102147182 | 254 |
| 202 | 3300025905 | Ga0207685_10143161 | Ga0207685_101431612 | 254 |
| 203 | 3300025906 | Ga0207699_10000295 | Ga0207699_1000029530 | 254 |
| 204 | 3300025906 | Ga0207699_10142292 | Ga0207699_101422922 | 254 |
| 205 | 3300025913 | Ga0207695_10039804 | Ga0207695_100398045 | 254 |
| 206 | 3300025915 | Ga0207693_10000876 | Ga0207693_1000087611 | 254 |
| 207 | 3300025916 | Ga0207663_10019891 | Ga0207663_100198914 | 254 |
| 208 | 3300025919 | Ga0207657_10103337 | Ga0207657_101033374 | 254 |
| 209 | 3300025921 | Ga0207652_10402199 | Ga0207652_104021992 | 254 |
| 210 | 3300025924 | Ga0207694_10161291 | Ga0207694_101612912 | 254 |
| 211 | 3300025928 | Ga0207700_10000005 | Ga0207700_10000005270 | 254 |
| 212 | 3300025939 | Ga0207665_10035143 | Ga0207665_100351432 | 254 |
| 213 | 3300025949 | Ga0207667_10048873 | Ga0207667_100488733 | 254 |
| 214 | 3300025949 | Ga0207667_10143004 | Ga0207667_101430042 | 254 |
| 215 | 3300026035 | Ga0207703_10120983 | Ga0207703_101209833 | 254 |
| 216 | 3300026041 | Ga0207639_10182891 | Ga0207639_101828912 | 254 |
| 217 | 3300026078 | Ga0207702_10000102 | Ga0207702_1000010257 | 254 |
| 218 | 3300026078 | Ga0207702_10000787 | Ga0207702_1000078734 | 254 |
| 219 | 3300026116 | Ga0207674_10000378 | Ga0207674_1000037836 | 254 |
| 220 | 3300028379 | Ga0268266_10017536 | Ga0268266_100175367 | 254 |
| 221 | 3300028379 | Ga0268266_10284737 | Ga0268266_102847372 | 254 |
| 222 | 3300028556 | Ga0265337_1004943 | Ga0265337_10049432 | 254 |
| 223 | 3300028573 | Ga0265334_10005148 | Ga0265334_100051487 | 254 |
| 224 | 3300028800 | Ga0265338_10031050 | Ga0265338_100310508 | 254 |
| 225 | 3300031240 | Ga0265320_10000179 | Ga0265320_1000017935 | 254 |
| 226 | 3300031241 | Ga0265325_10000537 | Ga0265325_1000053725 | 254 |
| 227 | 3300031249 | Ga0265339_10009717 | Ga0265339_100097176 | 254 |
| 228 | 3300031344 | Ga0265316_10080142 | Ga0265316_100801422 | 254 |
| 229 | 3300031595 | Ga0265313_10000907 | Ga0265313_1000090729 | 254 |
| 230 | 3300031711 | Ga0265314_10082073 | Ga0265314_100820732 | 254 |
| 231 | 3300035112 | Ga0373932_0027750 | Ga0373932_0027750_697_1500 | 254 |
| 232 | 3300035691 | Ga0373931_0002678 | Ga0373931_0002678_461_1264 | 254 |
| 233 | 3300036401 | Ga0373937_0027237 | Ga0373937_0027237_4287_5090 | 254 |
| 234 | 3300036401 | Ga0373937_0050375 | Ga0373937_0050375_2982_3788 | 254 |
| 235 | 3300039437 | Ga0436365_1754533 | Ga0436365_1754533_30_836 | 254 |
| 236 | 3300039437 | Ga0436365_1935268 | Ga0436365_1935268_45980_46786 | 254 |
| 237 | 3300039450 | Ga0436363_1379663 | Ga0436363_1379663_33_839 | 254 |
| 238 | 3300046472 | Ga0495580_0082902 | Ga0495580_0082902_186_1013 | 254 |
| 239 | 3300049579 | Ga0501043_0225210 | Ga0501043_0225210_79_852 | 254 |
| 240 | 3300049581 | Ga0501047_0249468 | Ga0501047_0249468_820_1599 | 254 |
| 241 | 3300049584 | Ga0501068_0043754 | Ga0501068_0043754_1734_2507 | 254 |
| 242 | 3300049586 | Ga0501070_0176024 | Ga0501070_0176024_831_1604 | 254 |
| 243 | 3300049742 | Ga0501080_0053236 | Ga0501080_0053236_1108_1881 | 254 |
| 244 | 3300049823 | Ga0501044_0064825 | Ga0501044_0064825_1991_2764 | 254 |
| 245 | 3300050512 | nmdc:mga0n895_149639_c1 | nmdc:mga0n895_149639_c1_522_1325 | 254 |
| 246 | 3300050512 | nmdc:mga0n895_37140_c1 | nmdc:mga0n895_37140_c1_2252_3055 | 254 |
| 247 | 3300050513 | nmdc:mga0rr50_41122_c1 | nmdc:mga0rr50_41122_c1_2060_2863 | 254 |
| 248 | 3300050514 | nmdc:mga08x19_15960_c1 | nmdc:mga08x19_15960_c1_1097_1867 | 254 |
| 249 | 3300050514 | nmdc:mga08x19_160_c1 | nmdc:mga08x19_160_c1_24024_24827 | 254 |
| 250 | 3300053119 | Ga0500595_010372 | Ga0500595_010372_2901_3668 | 254 |
| 251 | 3300053136 | Ga0500559_0182217 | Ga0500559_0182217_22_789 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tri-assembly1.cif.gz_B | structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii | 0.9129 | 2 | 254 |
| 2ag8-assembly1.cif.gz_A | nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis | 0.9113 | 1 | 253 |
| 3tri-assembly1.cif.gz_B | structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii | 0.9061 | 2 | 254 |
| 5bse-assembly1.cif.gz_A | crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) | 0.8879 | 2 | 254 |
| 2ag8-assembly1.cif.gz_A | nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis | 0.8876 | 1 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5bshF02 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like | 0.9431 | 156 | 254 | 1.10.3730.10 |
| 5bshB02 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like | 0.9422 | 156 | 254 | 1.10.3730.10 |
| 5bsfB02 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like | 0.9421 | 156 | 254 | 1.10.3730.10 |
| 2ag8A02 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like | 0.9415 | 152 | 252 | 1.10.3730.10 |
| 1xc2A02 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like | 0.941 | 152 | 252 | 1.10.3730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9S9F9-F1-model_v4 | Pyrroline-5-carboxylate reductase (EC 1.5.1.2) | 0.9736 | 2 | 254 |
GO:0004735
GO:0005737 GO:0055129 |
| AF-A0A521LHP2-F1-model_v4 | Pyrroline-5-carboxylate reductase (EC 1.5.1.2) | 0.969 | 40 | 253 |
GO:0004735
GO:0055129 |
| AF-A0A2W5MYT5-F1-model_v4 | Pyrroline-5-carboxylate reductase | 0.9689 | 91 | 253 |
GO:0004735
GO:0055129 |
| AF-A0A7X6EIL4-F1-model_v4 | deleted | 0.9686 | 84 | 253 |
|
| AF-A0A436E0X8-F1-model_v4 | Pyrroline-5-carboxylate reductase | 0.9679 | 108 | 254 |
GO:0004735
GO:0055129 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar