F362777

General Info

Members Datasets Scaffolds Average Seq Length
251 141 251 262

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0127776|Ga0501044_0127776_1621_2514
Length 297
Sequence MMREISPPPEKFFAALRILSTSPQGGGDFMAGAPLLLIGAGRMGGALLKGWLARGLGPILVVETNPSPTLKRLAKRDVTLLKNLDDAPKKLRACVIALKPQILKTEAPRLRAIAASGTPMISIAAGSSIKLMTKAWGKSARIIRTMPNTPGSIGEGISALFAAPNATRADRKLAESLLAALGETVWVKRETDIDTVTAVSGSGPAYVFLMAEALEEAARREGLPPSIAHRLARKTIIGAGALLKAEDAPAEALRRNVTSPHGTTEAALNILMAKDGMTPLIRRAVSAARKRARELAG

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 0
Rhizoplane 0.4
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 5.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001446 3300003215 Bacteria 14215
2 rootH2_10000314 3300003320 Bacteria 11295
3 Ga0070658_10061417 3300005327 Bacteria 3061
4 Ga0070683_100158630 3300005329 Bacteria 2146
5 Ga0070666_10001047 3300005335 Bacteria 16909
6 Ga0070666_10009231 3300005335 Bacteria 6145
7 Ga0070680_100000023 3300005336 Bacteria 78765
8 Ga0070660_100463181 3300005339 Bacteria 1052
9 Ga0070691_10000711 3300005341 Bacteria 13019
10 Ga0070691_10003400 3300005341 Bacteria 7154
11 Ga0070692_10107669 3300005345 Bacteria 1537
12 Ga0070659_100004676 3300005366 Bacteria 9771
13 Ga0070667_100331424 3300005367 Bacteria 1375
14 Ga0070709_10000705 3300005434 Bacteria 18959
15 Ga0070714_100147997 3300005435 Bacteria 2114
16 Ga0070714_100315269 3300005435 Unclassified 1461
17 Ga0070713_100000016 3300005436 Bacteria 121229
18 Ga0070713_100166368 3300005436 Unclassified 1972
19 Ga0070681_10000002 3300005458 Bacteria 821814
20 Ga0070679_100000445 3300005530 Bacteria 35145
21 Ga0070679_100015651 3300005530 Bacteria 7291
22 Ga0070679_100062664 3300005530 Bacteria 3707
23 Ga0068853_100003935 3300005539 Bacteria 11407
24 Ga0068853_100005467 3300005539 Bacteria 9954
25 Ga0070696_100182612 3300005546 Bacteria 1557
26 Ga0070693_100021049 3300005547 Bacteria 3450
27 Ga0070693_100073741 3300005547 Bacteria 2017
28 Ga0070665_100074601 3300005548 Bacteria 3398
29 Ga0070665_100116438 3300005548 Bacteria 2675
30 Ga0068855_100000024 3300005563 Bacteria 184241
31 Ga0068855_100068015 3300005563 Bacteria 4148
32 Ga0068855_100320242 3300005563 Bacteria 1714
33 Ga0068857_100007372 3300005577 Bacteria 9468
34 Ga0068854_100240907 3300005578 Bacteria 1440
35 Ga0068856_100004639 3300005614 Bacteria 13648
36 Ga0068856_100018203 3300005614 Bacteria 6809
37 Ga0068852_100159950 3300005616 Bacteria 2102
38 Ga0068858_100039293 3300005842 Bacteria 4389
39 Ga0070716_100008677 3300006173 Bacteria 5049
40 Ga0070712_100000347 3300006175 Bacteria 26219
41 Ga0070712_100001486 3300006175 Bacteria 14308
42 Ga0097621_100686226 3300006237 Bacteria 942
43 Ga0075434_100039831 3300006871 Bacteria 4654
44 Ga0075434_100159735 3300006871 Bacteria 2274
45 Ga0075436_100001679 3300006914 Bacteria 15136
46 Ga0075436_100016301 3300006914 Bacteria 5086
47 Ga0075435_100082454 3300007076 Bacteria 2643
48 Ga0105240_10000564 3300009093 Bacteria 68685
49 Ga0105240_10042961 3300009093 Bacteria 5757
50 Ga0105240_10074525 3300009093 Bacteria 4189
51 Ga0105241_10173296 3300009174 Bacteria 1784
52 Ga0105241_10231260 3300009174 Bacteria 1559
53 Ga0105242_10014859 3300009176 Bacteria 6031
54 Ga0105248_10000009 3300009177 Bacteria 403549
55 Ga0105237_10009554 3300009545 Bacteria 10384
56 Ga0105238_10001025 3300009551 Bacteria 28423
57 Ga0105238_10048832 3300009551 Bacteria 4264
58 Ga0105238_10152499 3300009551 Bacteria 2286
59 Ga0105239_10006486 3300010375 Bacteria 13566
60 Ga0105239_10012088 3300010375 Bacteria 9627
61 Ga0105239_10019286 3300010375 Bacteria 7532
62 Ga0105239_10019526 3300010375 Bacteria 7480
63 Ga0105239_10760591 3300010375 Bacteria 1109
64 Ga0157373_10002530 3300013100 Bacteria 13920
65 Ga0157370_10005189 3300013104 Bacteria 14674
66 Ga0157370_10027601 3300013104 Bacteria 5597
67 Ga0157369_10008202 3300013105 Bacteria 11979
68 Ga0157369_10030719 3300013105 Bacteria 5923
69 Ga0157374_10162064 3300013296 Bacteria 2178
70 Ga0157378_10090051 3300013297 Bacteria 2788
71 Ga0157372_10003755 3300013307 Bacteria 16310
72 Ga0157372_10018463 3300013307 Bacteria 7497
73 Ga0157372_10062334 3300013307 Bacteria 4178
74 Ga0157372_10155952 3300013307 Bacteria 2637
75 Ga0157372_10245619 3300013307 Bacteria 2077
76 Ga0157379_10176114 3300014968 Bacteria 1931
77 Ga0213874_10003608 3300021377 Bacteria 3455
78 Ga0213874_10017230 3300021377 Bacteria 1934
79 Ga0213876_10000521 3300021384 Bacteria 29455
80 Ga0213876_10001980 3300021384 Bacteria 12245
81 Ga0209455_1006584 3300025272 Bacteria 3412
82 Ga0209758_1000008 3300025297 Bacteria 1215263
83 Ga0207680_10007021 3300025903 Bacteria 5468
84 Ga0207680_10214718 3300025903 Bacteria 1317
85 Ga0207685_10143161 3300025905 Bacteria 1074
86 Ga0207699_10000295 3300025906 Bacteria 26738
87 Ga0207699_10142292 3300025906 Bacteria 1578
88 Ga0207707_10000002 3300025912 Bacteria 1142054
89 Ga0207707_10001430 3300025912 Bacteria 22073
90 Ga0207695_10000003 3300025913 Bacteria 1368691
91 Ga0207695_10039804 3300025913 Bacteria 5049
92 Ga0207693_10000876 3300025915 Bacteria 26927
93 Ga0207693_10001786 3300025915 Bacteria 18850
94 Ga0207663_10019891 3300025916 Bacteria 3792
95 Ga0207660_10004630 3300025917 Bacteria 8965
96 Ga0207657_10000762 3300025919 Bacteria 34172
97 Ga0207657_10103337 3300025919 Bacteria 2362
98 Ga0207652_10000299 3300025921 Bacteria 51311
99 Ga0207652_10002357 3300025921 Bacteria 15976
100 Ga0207652_10402199 3300025921 Bacteria 1235
101 Ga0207694_10000016 3300025924 Bacteria 349087
102 Ga0207694_10161291 3300025924 Bacteria 1811
103 Ga0207700_10000005 3300025928 Bacteria 394836
104 Ga0207664_10088218 3300025929 Bacteria 2538
105 Ga0207686_10057994 3300025934 Bacteria 2440
106 Ga0207665_10035143 3300025939 Bacteria 3325
107 Ga0207711_10000003 3300025941 Bacteria 1042791
108 Ga0207711_10000005 3300025941 Bacteria 822972
109 Ga0207711_10000009 3300025941 Bacteria 580864
110 Ga0207711_10000015 3300025941 Bacteria 494097
111 Ga0207667_10000021 3300025949 Bacteria 370524
112 Ga0207667_10046031 3300025949 Bacteria 4619
113 Ga0207667_10048873 3300025949 Bacteria 4471
114 Ga0207667_10143004 3300025949 Bacteria 2463
115 Ga0207703_10120983 3300026035 Bacteria 2247
116 Ga0207639_10112631 3300026041 Bacteria 2221
117 Ga0207639_10172753 3300026041 Bacteria 1832
118 Ga0207639_10182891 3300026041 Bacteria 1784
119 Ga0207702_10000102 3300026078 Bacteria 99313
120 Ga0207702_10000787 3300026078 Bacteria 33615
121 Ga0207674_10000378 3300026116 Bacteria 57957
122 Ga0207698_10030674 3300026142 Bacteria 3870
123 Ga0207698_10185694 3300026142 Bacteria 1847
124 Ga0268266_10012732 3300028379 Bacteria 7269
125 Ga0268266_10017536 3300028379 Bacteria 6108
126 Ga0268266_10284737 3300028379 Bacteria 1538
127 Ga0265337_1004943 3300028556 Bacteria 5424
128 Ga0265334_10005148 3300028573 Bacteria 5727
129 Ga0265318_10000046 3300028577 Bacteria 126568
130 Ga0265338_10020601 3300028800 Bacteria 6928
131 Ga0265338_10026709 3300028800 Bacteria 5811
132 Ga0265338_10031050 3300028800 Bacteria 5246
133 Ga0265330_10003295 3300031235 Bacteria 8493
134 Ga0265330_10038777 3300031235 Bacteria 2118
135 Ga0265332_10084204 3300031238 Bacteria 1348
136 Ga0265320_10000179 3300031240 Bacteria 53742
137 Ga0265325_10000537 3300031241 Bacteria 27498
138 Ga0265325_10001900 3300031241 Bacteria 14418
139 Ga0265325_10076640 3300031241 Unclassified 1668
140 Ga0265325_10082223 3300031241 Bacteria 1599
141 Ga0265329_10036351 3300031242 Unclassified 1588
142 Ga0265340_10000080 3300031247 Bacteria 46799
143 Ga0265340_10000118 3300031247 Bacteria 38702
144 Ga0265340_10001080 3300031247 Bacteria 15533
145 Ga0265340_10054926 3300031247 Bacteria 1920
146 Ga0265340_10125558 3300031247 Bacteria 1179
147 Ga0265339_10009717 3300031249 Bacteria 6017
148 Ga0265339_10010898 3300031249 Bacteria 5620
149 Ga0265316_10006247 3300031344 Bacteria 11420
150 Ga0265316_10018626 3300031344 Bacteria 5963
151 Ga0265316_10080142 3300031344 Bacteria 2504
152 Ga0265313_10000907 3300031595 Bacteria 29634
153 Ga0265313_10003286 3300031595 Bacteria 13275
154 Ga0265313_10083345 3300031595 Bacteria 1448
155 Ga0265313_10125321 3300031595 Bacteria 1117
156 Ga0265314_10003297 3300031711 Bacteria 15767
157 Ga0265314_10047995 3300031711 Bacteria 3000
158 Ga0265314_10082073 3300031711 Bacteria 2122
159 Ga0265314_10083703 3300031711 Bacteria 2096
160 Ga0265314_10088795 3300031711 Bacteria 2018
161 Ga0265342_10004310 3300031712 Bacteria 11264
162 Ga0265342_10018632 3300031712 Bacteria 4488
163 Ga0265342_10042302 3300031712 Bacteria 2753
164 Ga0307516_10016131 3300031730 Bacteria 7827
165 Ga0373934_0120134 3300035086 Unclassified 1069
166 Ga0373932_0027750 3300035112 Bacteria 1551
167 Ga0373943_0003428 3300035170 Bacteria 7220
168 Ga0373955_0087671 3300035172 Bacteria 1769
169 Ga0373931_0002678 3300035691 Bacteria 7922
170 Ga0373935_0010934 3300035692 Bacteria 5449
171 Ga0373927_0032978 3300035695 Bacteria 3372
172 Ga0373937_0027237 3300036401 Bacteria 5168
173 Ga0373937_0050375 3300036401 Bacteria 3814
174 Ga0373937_0051903 3300036401 Bacteria 3759
175 Ga0373925_0001852 3300037068 Bacteria 17614
176 Ga0373925_0372993 3300037068 Bacteria 1161
177 Ga0436365_1004240 3300039437 Bacteria 80154
178 Ga0436365_1295905 3300039437 Bacteria 848
179 Ga0436365_1754533 3300039437 Bacteria 1016
180 Ga0436365_1935268 3300039437 Bacteria 135877
181 Ga0436363_1045901 3300039450 Bacteria 3450
182 Ga0436363_1379663 3300039450 Bacteria 7686
183 Ga0495592_0178147 3300046454 Bacteria 1450
184 Ga0495580_0002971 3300046472 Bacteria 14554
185 Ga0495580_0082902 3300046472 Bacteria 2235
186 Ga0495582_0021415 3300046473 Bacteria 3538
187 Ga0495664_0132497 3300046477 Bacteria 1510
188 Ga0495620_0201108 3300046515 Bacteria 766
189 Ga0495628_0185057 3300046516 Bacteria 1574
190 Ga0495652_0084436 3300046529 Bacteria 2611
191 Ga0495640_0284042 3300046533 Bacteria 1030
192 Ga0495645_0002312 3300046543 Bacteria 12938
193 Ga0495645_0042446 3300046543 Bacteria 3316
194 Ga0495645_0088992 3300046543 Bacteria 2208
195 Ga0495634_0166532 3300046642 Bacteria 1387
196 Ga0495658_0003511 3300046683 Bacteria 7758
197 Ga0495658_0112273 3300046683 Bacteria 1640
198 Ga0496115_0445028 3300048918 Bacteria 1047
199 Ga0496126_0000159 3300048929 Bacteria 155348
200 Ga0495682_0003794 3300049460 Bacteria 6646
201 Ga0501031_0021688 3300049568 Bacteria 4187
202 Ga0501033_0114580 3300049570 Bacteria 1959
203 Ga0501033_0182516 3300049570 Bacteria 1504
204 Ga0501037_0102403 3300049573 Bacteria 2065
205 Ga0501037_0214966 3300049573 Bacteria 1354
206 Ga0501038_0059702 3300049574 Bacteria 3266
207 Ga0501043_0074052 3300049579 Bacteria 2675
208 Ga0501043_0225210 3300049579 Bacteria 1449
209 Ga0501043_0346959 3300049579 Bacteria 1128
210 Ga0501047_0002517 3300049581 Bacteria 17477
211 Ga0501047_0047427 3300049581 Bacteria 4151
212 Ga0501047_0204509 3300049581 Bacteria 1834
213 Ga0501047_0249468 3300049581 Unclassified 1624
214 Ga0501047_0486778 3300049581 Bacteria 1061
215 Ga0501067_0027852 3300049583 Bacteria 3131
216 Ga0501067_0152235 3300049583 Bacteria 1289
217 Ga0501068_0043754 3300049584 Bacteria 2695
218 Ga0501069_0157044 3300049585 Bacteria 1309
219 Ga0501070_0141218 3300049586 Bacteria 1988
220 Ga0501070_0176024 3300049586 Bacteria 1761
221 Ga0501070_0298617 3300049586 Bacteria 1312
222 Ga0501072_0100052 3300049588 Bacteria 2304
223 Ga0501073_0008977 3300049589 Bacteria 7383
224 Ga0501073_0445270 3300049589 Bacteria 895
225 Ga0501074_0120075 3300049590 Bacteria 1880
226 Ga0501079_0044327 3300049741 Bacteria 3433
227 Ga0501080_0000693 3300049742 Bacteria 27033
228 Ga0501080_0012632 3300049742 Bacteria 7744
229 Ga0501080_0053236 3300049742 Bacteria 3767
230 Ga0501035_0000593 3300049822 Bacteria 39882
231 Ga0501035_0054076 3300049822 Bacteria 3588
232 Ga0501035_0207845 3300049822 Bacteria 1676
233 Ga0501044_0001971 3300049823 Bacteria 23742
234 Ga0501044_0024086 3300049823 Bacteria 6467
235 Ga0501044_0064825 3300049823 Bacteria 3727
236 Ga0501044_0079301 3300049823 Bacteria 3327
237 Ga0501044_0127776 3300049823 Bacteria 2538
238 Ga0501044_0643141 3300049823 Bacteria 950
239 nmdc:mga0n895_149639_c1 3300050512 Bacteria 2364
240 nmdc:mga0n895_37140_c1 3300050512 Bacteria 4710
241 nmdc:mga0rr50_41122_c1 3300050513 Bacteria 3366
242 nmdc:mga08x19_15960_c1 3300050514 Bacteria 4576
243 nmdc:mga08x19_160_c1 3300050514 Bacteria 55694
244 Ga0500595_010372 3300053119 Bacteria 3706
245 Ga0500655_005414 3300053133 Bacteria 2302
246 Ga0500559_0182217 3300053136 Bacteria 989
247 Ga0500619_030535 3300053154 Bacteria 1638
248 Ga0500645_024705 3300053730 Bacteria 1836
249 Ga0501084_0000431 3300054114 Bacteria 32242
250 Ga0501082_0220975 3300060353 Bacteria 1648
251 Ga0501082_0427272 3300060353 Bacteria 1157

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10125558 Ga0265340_101255581 207
2 3300009176 Ga0105242_10014859 Ga0105242_100148598 220
3 3300025934 Ga0207686_10057994 Ga0207686_100579944 220
4 3300035170 Ga0373943_0003428 Ga0373943_0003428_3351_4199 220
5 3300035692 Ga0373935_0010934 Ga0373935_0010934_24_872 220
6 3300035695 Ga0373927_0032978 Ga0373927_0032978_66_914 220
7 3300037068 Ga0373925_0001852 Ga0373925_0001852_3464_4312 220
8 3300036401 Ga0373937_0051903 Ga0373937_0051903_1176_2024 225
9 3300035086 Ga0373934_0120134 Ga0373934_0120134_23_712 227
10 3300035172 Ga0373955_0087671 Ga0373955_0087671_23_712 227
11 3300046515 Ga0495620_0201108 Ga0495620_0201108_65_751 227
12 3300031711 Ga0265314_10047995 Ga0265314_100479952 230
13 3300046533 Ga0495640_0284042 Ga0495640_0284042_134_961 234
14 3300046642 Ga0495634_0166532 Ga0495634_0166532_473_1300 234
15 3300046683 Ga0495658_0112273 Ga0495658_0112273_625_1452 234
16 3300003320 rootH2_10000314 rootH2_100003147 235
17 3300005548 Ga0070665_100116438 Ga0070665_1001164382 240
18 3300009093 Ga0105240_10074525 Ga0105240_100745253 240
19 3300009174 Ga0105241_10231260 Ga0105241_102312602 240
20 3300028379 Ga0268266_10012732 Ga0268266_100127328 240
21 3300010375 Ga0105239_10760591 Ga0105239_107605912 243
22 3300031247 Ga0265340_10000080 Ga0265340_1000008054 243
23 3300031247 Ga0265340_10001080 Ga0265340_100010806 243
24 3300031344 Ga0265316_10006247 Ga0265316_1000624710 243
25 3300031595 Ga0265313_10125321 Ga0265313_101253211 243
26 3300021384 Ga0213876_10001980 Ga0213876_1000198015 244
27 3300049589 Ga0501073_0445270 Ga0501073_0445270_63_806 244
28 3300031241 Ga0265325_10082223 Ga0265325_100822232 246
29 3300005539 Ga0068853_100003935 Ga0068853_10000393513 247
30 3300005563 Ga0068855_100000024 Ga0068855_10000002414 247
31 3300025913 Ga0207695_10000003 Ga0207695_10000003136 247
32 3300025924 Ga0207694_10000016 Ga0207694_10000016115 247
33 3300025949 Ga0207667_10000021 Ga0207667_10000021239 247
34 3300026041 Ga0207639_10112631 Ga0207639_101126314 247
35 3300026142 Ga0207698_10030674 Ga0207698_100306745 247
36 3300028577 Ga0265318_10000046 Ga0265318_1000004664 247
37 3300031730 Ga0307516_10016131 Ga0307516_100161318 247
38 3300046516 Ga0495628_0185057 Ga0495628_0185057_662_1414 247
39 3300049460 Ga0495682_0003794 Ga0495682_0003794_3791_4543 247
40 3300049581 Ga0501047_0002517 Ga0501047_0002517_15947_16699 247
41 3300049583 Ga0501067_0027852 Ga0501067_0027852_774_1526 247
42 3300049588 Ga0501072_0100052 Ga0501072_0100052_1300_2052 247
43 3300049589 Ga0501073_0008977 Ga0501073_0008977_298_1050 247
44 3300049590 Ga0501074_0120075 Ga0501074_0120075_1088_1840 247
45 3300049741 Ga0501079_0044327 Ga0501079_0044327_141_893 247
46 3300053133 Ga0500655_005414 Ga0500655_005414_736_1488 247
47 3300060353 Ga0501082_0427272 Ga0501082_0427272_216_968 247
48 3300039437 Ga0436365_1004240 Ga0436365_1004240_11129_11956 248
49 3300049583 Ga0501067_0152235 Ga0501067_0152235_31_837 248
50 3300054114 Ga0501084_0000431 Ga0501084_0000431_30317_31123 248
51 3300060353 Ga0501082_0220975 Ga0501082_0220975_812_1618 248
52 3300048929 Ga0496126_0000159 Ga0496126_0000159_23109_23900 249
53 3300053730 Ga0500645_024705 Ga0500645_024705_879_1679 249
54 3300005336 Ga0070680_100000023 Ga0070680_10000002349 251
55 3300005458 Ga0070681_10000002 Ga0070681_1000000243 251
56 3300005530 Ga0070679_100000445 Ga0070679_10000044518 251
57 3300005616 Ga0068852_100159950 Ga0068852_1001599503 251
58 3300009093 Ga0105240_10000564 Ga0105240_1000056420 251
59 3300009174 Ga0105241_10173296 Ga0105241_101732962 251
60 3300009177 Ga0105248_10000009 Ga0105248_10000009366 251
61 3300009551 Ga0105238_10152499 Ga0105238_101524992 251
62 3300010375 Ga0105239_10006486 Ga0105239_1000648610 251
63 3300010375 Ga0105239_10012088 Ga0105239_100120887 251
64 3300010375 Ga0105239_10019526 Ga0105239_100195266 251
65 3300013105 Ga0157369_10030719 Ga0157369_100307192 251
66 3300021377 Ga0213874_10003608 Ga0213874_100036083 251
67 3300025912 Ga0207707_10000002 Ga0207707_10000002908 251
68 3300025921 Ga0207652_10000299 Ga0207652_100002992 251
69 3300025941 Ga0207711_10000003 Ga0207711_10000003694 251
70 3300025941 Ga0207711_10000005 Ga0207711_10000005440 251
71 3300025941 Ga0207711_10000009 Ga0207711_10000009216 251
72 3300025941 Ga0207711_10000015 Ga0207711_10000015447 251
73 3300026142 Ga0207698_10185694 Ga0207698_101856943 251
74 3300028800 Ga0265338_10020601 Ga0265338_100206013 251
75 3300028800 Ga0265338_10026709 Ga0265338_100267094 251
76 3300031235 Ga0265330_10003295 Ga0265330_1000329511 251
77 3300031235 Ga0265330_10038777 Ga0265330_100387773 251
78 3300031238 Ga0265332_10084204 Ga0265332_100842042 251
79 3300031241 Ga0265325_10001900 Ga0265325_1000190015 251
80 3300031241 Ga0265325_10076640 Ga0265325_100766402 251
81 3300031242 Ga0265329_10036351 Ga0265329_100363512 251
82 3300031247 Ga0265340_10000118 Ga0265340_100001188 251
83 3300031247 Ga0265340_10054926 Ga0265340_100549261 251
84 3300031249 Ga0265339_10010898 Ga0265339_100108982 251
85 3300031344 Ga0265316_10018626 Ga0265316_100186262 251
86 3300031595 Ga0265313_10003286 Ga0265313_100032864 251
87 3300031595 Ga0265313_10083345 Ga0265313_100833452 251
88 3300031711 Ga0265314_10003297 Ga0265314_1000329718 251
89 3300031711 Ga0265314_10088795 Ga0265314_100887954 251
90 3300031712 Ga0265342_10004310 Ga0265342_100043106 251
91 3300031712 Ga0265342_10018632 Ga0265342_100186322 251
92 3300031712 Ga0265342_10042302 Ga0265342_100423022 251
93 3300039450 Ga0436363_1045901 Ga0436363_1045901_1225_2040 251
94 3300046454 Ga0495592_0178147 Ga0495592_0178147_183_998 251
95 3300046477 Ga0495664_0132497 Ga0495664_0132497_356_1171 251
96 3300046529 Ga0495652_0084436 Ga0495652_0084436_931_1746 251
97 3300046543 Ga0495645_0002312 Ga0495645_0002312_2876_3691 251
98 3300046543 Ga0495645_0042446 Ga0495645_0042446_628_1443 251
99 3300048918 Ga0496115_0445028 Ga0496115_0445028_113_877 251
100 3300049581 Ga0501047_0047427 Ga0501047_0047427_2224_2988 251
101 3300049581 Ga0501047_0486778 Ga0501047_0486778_247_1011 251
102 3300049586 Ga0501070_0298617 Ga0501070_0298617_362_1126 251
103 3300049742 Ga0501080_0012632 Ga0501080_0012632_4002_4766 251
104 3300053154 Ga0500619_030535 Ga0500619_030535_76_891 251
105 3300005435 Ga0070714_100147997 Ga0070714_1001479972 252
106 3300025929 Ga0207664_10088218 Ga0207664_100882182 252
107 3300049570 Ga0501033_0114580 Ga0501033_0114580_712_1479 252
108 3300049822 Ga0501035_0054076 Ga0501035_0054076_84_851 252
109 3300049823 Ga0501044_0079301 Ga0501044_0079301_440_1207 252
110 3300005341 Ga0070691_10003400 Ga0070691_100034002 253
111 3300005366 Ga0070659_100004676 Ga0070659_1000046769 253
112 3300005435 Ga0070714_100315269 Ga0070714_1003152691 253
113 3300005578 Ga0068854_100240907 Ga0068854_1002409072 253
114 3300006175 Ga0070712_100001486 Ga0070712_10000148614 253
115 3300009551 Ga0105238_10048832 Ga0105238_100488324 253
116 3300013104 Ga0157370_10005189 Ga0157370_1000518914 253
117 3300013307 Ga0157372_10062334 Ga0157372_100623343 253
118 3300025912 Ga0207707_10001430 Ga0207707_1000143016 253
119 3300025915 Ga0207693_10001786 Ga0207693_1000178615 253
120 3300025917 Ga0207660_10004630 Ga0207660_100046309 253
121 3300025919 Ga0207657_10000762 Ga0207657_1000076212 253
122 3300025921 Ga0207652_10002357 Ga0207652_100023575 253
123 3300025949 Ga0207667_10046031 Ga0207667_100460314 253
124 3300026041 Ga0207639_10172753 Ga0207639_101727532 253
125 3300031711 Ga0265314_10083703 Ga0265314_100837032 253
126 3300037068 Ga0373925_0372993 Ga0373925_0372993_92_940 253
127 3300039437 Ga0436365_1295905 Ga0436365_1295905_54_821 253
128 3300046472 Ga0495580_0002971 Ga0495580_0002971_10924_11772 253
129 3300046473 Ga0495582_0021415 Ga0495582_0021415_2062_2910 253
130 3300046543 Ga0495645_0088992 Ga0495645_0088992_546_1322 253
131 3300046683 Ga0495658_0003511 Ga0495658_0003511_645_1493 253
132 3300049568 Ga0501031_0021688 Ga0501031_0021688_1387_2154 253
133 3300049570 Ga0501033_0182516 Ga0501033_0182516_75_842 253
134 3300049573 Ga0501037_0102403 Ga0501037_0102403_396_1163 253
135 3300049573 Ga0501037_0214966 Ga0501037_0214966_264_1031 253
136 3300049574 Ga0501038_0059702 Ga0501038_0059702_1950_2717 253
137 3300049579 Ga0501043_0074052 Ga0501043_0074052_1831_2598 253
138 3300049579 Ga0501043_0346959 Ga0501043_0346959_167_934 253
139 3300049581 Ga0501047_0204509 Ga0501047_0204509_1008_1775 253
140 3300049585 Ga0501069_0157044 Ga0501069_0157044_89_856 253
141 3300049586 Ga0501070_0141218 Ga0501070_0141218_729_1496 253
142 3300049742 Ga0501080_0000693 Ga0501080_0000693_19767_20534 253
143 3300049822 Ga0501035_0000593 Ga0501035_0000593_21915_22682 253
144 3300049822 Ga0501035_0207845 Ga0501035_0207845_132_899 253
145 3300049823 Ga0501044_0001971 Ga0501044_0001971_22264_23031 253
146 3300049823 Ga0501044_0024086 Ga0501044_0024086_66_833 253
147 3300049823 Ga0501044_0127776 Ga0501044_0127776_1621_2514 253
148 3300049823 Ga0501044_0643141 Ga0501044_0643141_158_925 253
149 3300003215 JGI25153J46596_10001446 JGI25153J46596_1000144613 254
150 3300005327 Ga0070658_10061417 Ga0070658_100614173 254
151 3300005329 Ga0070683_100158630 Ga0070683_1001586303 254
152 3300005335 Ga0070666_10001047 Ga0070666_1000104710 254
153 3300005335 Ga0070666_10009231 Ga0070666_100092317 254
154 3300005339 Ga0070660_100463181 Ga0070660_1004631812 254
155 3300005341 Ga0070691_10000711 Ga0070691_1000071113 254
156 3300005345 Ga0070692_10107669 Ga0070692_101076692 254
157 3300005367 Ga0070667_100331424 Ga0070667_1003314242 254
158 3300005434 Ga0070709_10000705 Ga0070709_1000070511 254
159 3300005436 Ga0070713_100000016 Ga0070713_10000001611 254
160 3300005436 Ga0070713_100166368 Ga0070713_1001663681 254
161 3300005530 Ga0070679_100015651 Ga0070679_1000156515 254
162 3300005530 Ga0070679_100062664 Ga0070679_1000626642 254
163 3300005539 Ga0068853_100005467 Ga0068853_1000054674 254
164 3300005546 Ga0070696_100182612 Ga0070696_1001826122 254
165 3300005547 Ga0070693_100021049 Ga0070693_1000210495 254
166 3300005547 Ga0070693_100073741 Ga0070693_1000737412 254
167 3300005548 Ga0070665_100074601 Ga0070665_1000746012 254
168 3300005563 Ga0068855_100068015 Ga0068855_1000680153 254
169 3300005563 Ga0068855_100320242 Ga0068855_1003202423 254
170 3300005577 Ga0068857_100007372 Ga0068857_1000073728 254
171 3300005614 Ga0068856_100004639 Ga0068856_10000463915 254
172 3300005614 Ga0068856_100018203 Ga0068856_1000182033 254
173 3300005842 Ga0068858_100039293 Ga0068858_1000392934 254
174 3300006173 Ga0070716_100008677 Ga0070716_1000086774 254
175 3300006175 Ga0070712_100000347 Ga0070712_10000034711 254
176 3300006237 Ga0097621_100686226 Ga0097621_1006862262 254
177 3300006871 Ga0075434_100039831 Ga0075434_1000398313 254
178 3300006871 Ga0075434_100159735 Ga0075434_1001597353 254
179 3300006914 Ga0075436_100001679 Ga0075436_10000167911 254
180 3300006914 Ga0075436_100016301 Ga0075436_1000163016 254
181 3300007076 Ga0075435_100082454 Ga0075435_1000824543 254
182 3300009093 Ga0105240_10042961 Ga0105240_100429617 254
183 3300009545 Ga0105237_10009554 Ga0105237_1000955413 254
184 3300009551 Ga0105238_10001025 Ga0105238_100010255 254
185 3300010375 Ga0105239_10019286 Ga0105239_100192869 254
186 3300013100 Ga0157373_10002530 Ga0157373_100025306 254
187 3300013104 Ga0157370_10027601 Ga0157370_100276016 254
188 3300013105 Ga0157369_10008202 Ga0157369_1000820212 254
189 3300013296 Ga0157374_10162064 Ga0157374_101620643 254
190 3300013297 Ga0157378_10090051 Ga0157378_100900511 254
191 3300013307 Ga0157372_10003755 Ga0157372_1000375515 254
192 3300013307 Ga0157372_10018463 Ga0157372_100184632 254
193 3300013307 Ga0157372_10155952 Ga0157372_101559522 254
194 3300013307 Ga0157372_10245619 Ga0157372_102456193 254
195 3300014968 Ga0157379_10176114 Ga0157379_101761142 254
196 3300021377 Ga0213874_10017230 Ga0213874_100172304 254
197 3300021384 Ga0213876_10000521 Ga0213876_1000052124 254
198 3300025272 Ga0209455_1006584 Ga0209455_10065842 254
199 3300025297 Ga0209758_1000008 Ga0209758_1000008672 254
200 3300025903 Ga0207680_10007021 Ga0207680_100070217 254
201 3300025903 Ga0207680_10214718 Ga0207680_102147182 254
202 3300025905 Ga0207685_10143161 Ga0207685_101431612 254
203 3300025906 Ga0207699_10000295 Ga0207699_1000029530 254
204 3300025906 Ga0207699_10142292 Ga0207699_101422922 254
205 3300025913 Ga0207695_10039804 Ga0207695_100398045 254
206 3300025915 Ga0207693_10000876 Ga0207693_1000087611 254
207 3300025916 Ga0207663_10019891 Ga0207663_100198914 254
208 3300025919 Ga0207657_10103337 Ga0207657_101033374 254
209 3300025921 Ga0207652_10402199 Ga0207652_104021992 254
210 3300025924 Ga0207694_10161291 Ga0207694_101612912 254
211 3300025928 Ga0207700_10000005 Ga0207700_10000005270 254
212 3300025939 Ga0207665_10035143 Ga0207665_100351432 254
213 3300025949 Ga0207667_10048873 Ga0207667_100488733 254
214 3300025949 Ga0207667_10143004 Ga0207667_101430042 254
215 3300026035 Ga0207703_10120983 Ga0207703_101209833 254
216 3300026041 Ga0207639_10182891 Ga0207639_101828912 254
217 3300026078 Ga0207702_10000102 Ga0207702_1000010257 254
218 3300026078 Ga0207702_10000787 Ga0207702_1000078734 254
219 3300026116 Ga0207674_10000378 Ga0207674_1000037836 254
220 3300028379 Ga0268266_10017536 Ga0268266_100175367 254
221 3300028379 Ga0268266_10284737 Ga0268266_102847372 254
222 3300028556 Ga0265337_1004943 Ga0265337_10049432 254
223 3300028573 Ga0265334_10005148 Ga0265334_100051487 254
224 3300028800 Ga0265338_10031050 Ga0265338_100310508 254
225 3300031240 Ga0265320_10000179 Ga0265320_1000017935 254
226 3300031241 Ga0265325_10000537 Ga0265325_1000053725 254
227 3300031249 Ga0265339_10009717 Ga0265339_100097176 254
228 3300031344 Ga0265316_10080142 Ga0265316_100801422 254
229 3300031595 Ga0265313_10000907 Ga0265313_1000090729 254
230 3300031711 Ga0265314_10082073 Ga0265314_100820732 254
231 3300035112 Ga0373932_0027750 Ga0373932_0027750_697_1500 254
232 3300035691 Ga0373931_0002678 Ga0373931_0002678_461_1264 254
233 3300036401 Ga0373937_0027237 Ga0373937_0027237_4287_5090 254
234 3300036401 Ga0373937_0050375 Ga0373937_0050375_2982_3788 254
235 3300039437 Ga0436365_1754533 Ga0436365_1754533_30_836 254
236 3300039437 Ga0436365_1935268 Ga0436365_1935268_45980_46786 254
237 3300039450 Ga0436363_1379663 Ga0436363_1379663_33_839 254
238 3300046472 Ga0495580_0082902 Ga0495580_0082902_186_1013 254
239 3300049579 Ga0501043_0225210 Ga0501043_0225210_79_852 254
240 3300049581 Ga0501047_0249468 Ga0501047_0249468_820_1599 254
241 3300049584 Ga0501068_0043754 Ga0501068_0043754_1734_2507 254
242 3300049586 Ga0501070_0176024 Ga0501070_0176024_831_1604 254
243 3300049742 Ga0501080_0053236 Ga0501080_0053236_1108_1881 254
244 3300049823 Ga0501044_0064825 Ga0501044_0064825_1991_2764 254
245 3300050512 nmdc:mga0n895_149639_c1 nmdc:mga0n895_149639_c1_522_1325 254
246 3300050512 nmdc:mga0n895_37140_c1 nmdc:mga0n895_37140_c1_2252_3055 254
247 3300050513 nmdc:mga0rr50_41122_c1 nmdc:mga0rr50_41122_c1_2060_2863 254
248 3300050514 nmdc:mga08x19_15960_c1 nmdc:mga08x19_15960_c1_1097_1867 254
249 3300050514 nmdc:mga08x19_160_c1 nmdc:mga08x19_160_c1_24024_24827 254
250 3300053119 Ga0500595_010372 Ga0500595_010372_2901_3668 254
251 3300053136 Ga0500559_0182217 Ga0500559_0182217_22_789 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

190

295

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

35

126

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tri-assembly1.cif.gz_B structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii 0.9129 2 254
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.9113 1 253
3tri-assembly1.cif.gz_B structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii 0.9061 2 254
5bse-assembly1.cif.gz_A crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) 0.8879 2 254
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.8876 1 253
ID Description Score Start End Superfamily
5bshF02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9431 156 254 1.10.3730.10
5bshB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9422 156 254 1.10.3730.10
5bsfB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9421 156 254 1.10.3730.10
2ag8A02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9415 152 252 1.10.3730.10
1xc2A02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.941 152 252 1.10.3730.10
ID Description Score Start End GO Terms
AF-A0A7V9S9F9-F1-model_v4 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) 0.9736 2 254 GO:0004735
GO:0005737
GO:0055129
AF-A0A521LHP2-F1-model_v4 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) 0.969 40 253 GO:0004735
GO:0055129
AF-A0A2W5MYT5-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9689 91 253 GO:0004735
GO:0055129
AF-A0A7X6EIL4-F1-model_v4 deleted 0.9686 84 253
AF-A0A436E0X8-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9679 108 254 GO:0004735
GO:0055129

Feature Viewer

pLDDT pTM Quality
91.62 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map