F362748

General Info

Members Datasets Scaffolds Average Seq Length
251 140 250 303

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0007121|Ga0501032_0007121_5305_6279
Length 324
Sequence VPSDQPAIGRRRFDGPPRVALEPPGSRSWLADAVAAGGGTVVPLDEAEALVWTSPAHPEDLTTALAATGDAIGWVQLPWAGIEPFAHVVDHERLWTSGKGVYAEPVAEHALALALAGMRHIGAYARADRWTGPAGRNLLGARVVVLGAGGITESLLRLLGPFGCHVTVVRKRAAVPVDGADAVVAFDDLDGVLPDADLVVLALALTPETAGVIDAHRLSLMKPTAWLVNVGRGGHVVTDDLVAELTPDQDGTTAIAGAALDVTDPEPLPDGHPLWSLERCIVTPHIGNTPEMALPLLSERVATNVARFAAGEPLVGPVDPDLGY

Samples

Sample ID Description Type Environment
1 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
76 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
126 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.16
Nodule 0
Rhizoplane 6.37
Rhizosphere 80.88
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10009374 3300003373 Bacteria 2479
2 Ga0070683_100423118 3300005329 Bacteria 1271
3 Ga0070689_100143162 3300005340 Bacteria 1924
4 Ga0070692_10315138 3300005345 Bacteria 960
5 Ga0070668_100031115 3300005347 Bacteria 4060
6 Ga0070669_100326779 3300005353 Unclassified 1240
7 Ga0070671_100048985 3300005355 Bacteria 3515
8 Ga0070674_100025520 3300005356 Bacteria 3849
9 Ga0070674_100369408 3300005356 Bacteria 1164
10 Ga0070701_10067806 3300005438 Bacteria 1899
11 Ga0070678_100158530 3300005456 Bacteria 1831
12 Ga0068867_100029406 3300005459 Bacteria 3959
13 Ga0070686_100012795 3300005544 Bacteria 4790
14 Ga0070686_100214734 3300005544 Unclassified 1387
15 Ga0070702_100042347 3300005615 Unclassified 2560
16 Ga0068859_100315455 3300005617 Bacteria 1657
17 Ga0068860_100009744 3300005843 Bacteria 9537
18 Ga0068860_100013080 3300005843 Bacteria 8145
19 Ga0068860_100127724 3300005843 Bacteria 2437
20 Ga0068860_100201803 3300005843 Bacteria 1927
21 Ga0068862_100472921 3300005844 Unclassified 1185
22 Ga0081455_10000549 3300005937 Bacteria 48766
23 Ga0081455_10000578 3300005937 Bacteria 47746
24 Ga0081538_10000372 3300005981 Bacteria 51168
25 Ga0081538_10001797 3300005981 Bacteria 21655
26 Ga0081538_10003517 3300005981 Bacteria 14752
27 Ga0081538_10025009 3300005981 Bacteria 4232
28 Ga0075365_10001191 3300006038 Bacteria 11453
29 Ga0075365_10010334 3300006038 Bacteria 5427
30 Ga0075365_10069413 3300006038 Bacteria 2368
31 Ga0075365_10086829 3300006038 Bacteria 2126
32 Ga0075368_10071155 3300006042 Bacteria 1405
33 Ga0075363_100021356 3300006048 Bacteria 3259
34 Ga0075363_100023942 3300006048 Bacteria 3100
35 Ga0075363_100100350 3300006048 Bacteria 1601
36 Ga0075364_10029873 3300006051 Bacteria 3496
37 Ga0075364_10040012 3300006051 Bacteria 3040
38 Ga0075364_10076997 3300006051 Bacteria 2201
39 Ga0075364_10148277 3300006051 Bacteria 1580
40 Ga0075364_10307477 3300006051 Bacteria 1079
41 Ga0075362_10007876 3300006177 Bacteria 4052
42 Ga0097621_100283769 3300006237 Bacteria 1458
43 Ga0075370_10037129 3300006353 Unclassified 2738
44 Ga0068871_100257627 3300006358 Bacteria 1521
45 Ga0075428_100000020 3300006844 Bacteria 136123
46 Ga0075428_100002362 3300006844 Bacteria 20486
47 Ga0075428_100010985 3300006844 Bacteria 10071
48 Ga0075428_100056278 3300006844 Bacteria 4308
49 Ga0075428_100070875 3300006844 Bacteria 3810
50 Ga0075428_100216955 3300006844 Bacteria 2066
51 Ga0075430_100001723 3300006846 Bacteria 17837
52 Ga0075430_100003098 3300006846 Bacteria 13893
53 Ga0075430_100016031 3300006846 Bacteria 6381
54 Ga0075431_100001015 3300006847 Bacteria 24999
55 Ga0075431_100005624 3300006847 Bacteria 12378
56 Ga0075431_100008144 3300006847 Bacteria 10473
57 Ga0075431_100026729 3300006847 Bacteria 5920
58 Ga0075431_100081420 3300006847 Bacteria 3343
59 Ga0075431_100088735 3300006847 Bacteria 3191
60 Ga0075434_100487891 3300006871 Bacteria 1253
61 Ga0075429_100002209 3300006880 Bacteria 16287
62 Ga0075429_100005161 3300006880 Bacteria 11232
63 Ga0075429_100025810 3300006880 Bacteria 5102
64 Ga0075429_100436822 3300006880 Bacteria 1147
65 Ga0097620_100315450 3300006931 Bacteria 1657
66 Ga0111539_10048297 3300009094 Bacteria 5083
67 Ga0111539_10312731 3300009094 Bacteria 1828
68 Ga0105245_10087912 3300009098 Bacteria 2853
69 Ga0105245_10231803 3300009098 Unclassified 1786
70 Ga0114129_10000770 3300009147 Bacteria 40863
71 Ga0114129_10012645 3300009147 Bacteria 12019
72 Ga0114129_10030349 3300009147 Bacteria 7650
73 Ga0105243_10023922 3300009148 Bacteria 4655
74 Ga0105243_10041829 3300009148 Bacteria 3585
75 Ga0105242_10027310 3300009176 Bacteria 4530
76 Ga0105242_10090931 3300009176 Bacteria 2568
77 Ga0105248_10345413 3300009177 Bacteria 1675
78 Ga0105249_10215342 3300009553 Bacteria 1887
79 Ga0157378_10007763 3300013297 Bacteria 9365
80 Ga0157375_10018869 3300013308 Bacteria 6262
81 Ga0163163_10510313 3300014325 Bacteria 1264
82 Ga0157380_10149824 3300014326 Bacteria 2015
83 Ga0157379_10035479 3300014968 Bacteria 4447
84 Ga0213876_10131792 3300021384 Bacteria 1328
85 Ga0207657_10246226 3300025919 Bacteria 1426
86 Ga0207644_10102435 3300025931 Bacteria 2153
87 Ga0207709_10056128 3300025935 Bacteria 2436
88 Ga0207670_10136715 3300025936 Bacteria 1802
89 Ga0207669_10005552 3300025937 Bacteria 5672
90 Ga0207669_10276791 3300025937 Bacteria 1264
91 Ga0207704_10052490 3300025938 Bacteria 2472
92 Ga0207711_10154609 3300025941 Bacteria 2072
93 Ga0207667_10068354 3300025949 Bacteria 3700
94 Ga0207712_10023678 3300025961 Bacteria 4056
95 Ga0207668_10021717 3300025972 Bacteria 4098
96 Ga0207658_10108051 3300025986 Bacteria 2194
97 Ga0207677_10152995 3300026023 Unclassified 1782
98 Ga0207703_10111978 3300026035 Bacteria 2331
99 Ga0207708_10035906 3300026075 Bacteria 3771
100 Ga0207648_10002665 3300026089 Bacteria 19014
101 Ga0207675_100064931 3300026118 Unclassified 3412
102 Ga0207683_10262739 3300026121 Bacteria 1576
103 Ga0268264_10008826 3300028381 Bacteria 8357
104 Ga0268264_10009279 3300028381 Bacteria 8146
105 Ga0316575_10055647 3300031665 Bacteria 1576
106 Ga0316576_10015484 3300031727 Bacteria 5120
107 Ga0316576_10019907 3300031727 Bacteria 4605
108 Ga0316576_10059166 3300031727 Bacteria 2804
109 Ga0316576_10070772 3300031727 Bacteria 2572
110 Ga0316576_10192876 3300031727 Bacteria 1536
111 Ga0316578_10038017 3300031728 Bacteria 2774
112 Ga0316577_10052020 3300031733 Bacteria 2285
113 Ga0316580_10026317 3300032139 Bacteria 1799
114 Ga0316574_0002550 3300035398 Bacteria 9164
115 Ga0316574_0007959 3300035398 Bacteria 5854
116 Ga0316584_0056836 3300036712 Bacteria 2929
117 Ga0316584_0065810 3300036712 Bacteria 2715
118 Ga0316584_0210584 3300036712 Bacteria 1431
119 Ga0436365_0908221 3300039437 Bacteria 1334
120 Ga0451791_0902966 3300041451 Bacteria 1150
121 Ga0451853_1886938 3300041512 Bacteria 1428
122 Ga0439450_001066 3300042008 Bacteria 3878
123 Ga0439463_008085 3300042016 Bacteria 2595
124 Ga0439434_0001440 3300042435 Bacteria 6848
125 Ga0451577_0022672 3300042876 Bacteria 5732
126 Ga0439440_0007321 3300042993 Bacteria 2239
127 Ga0453684_0009137 3300044712 Bacteria 17449
128 Ga0466967_0222397 3300045976 Bacteria 1795
129 Ga0495634_0019126 3300046642 Bacteria 4868
130 Ga0495613_0020756 3300046689 Bacteria 4897
131 Ga0495676_0308854 3300047321 Bacteria 1065
132 Ga0496100_0087786 3300048903 Bacteria 2115
133 Ga0496101_0029495 3300048904 Bacteria 3837
134 Ga0496102_0144202 3300048905 Bacteria 2234
135 Ga0496105_0024285 3300048908 Bacteria 4926
136 Ga0496107_0148879 3300048910 Bacteria 1731
137 Ga0496108_0090274 3300048911 Bacteria 2605
138 Ga0496108_0382708 3300048911 Bacteria 1229
139 Ga0496109_0380848 3300048912 Bacteria 1333
140 Ga0496109_0685427 3300048912 Bacteria 962
141 Ga0496110_0031321 3300048913 Bacteria 4588
142 Ga0496110_0055370 3300048913 Bacteria 3490
143 Ga0496110_0231392 3300048913 Bacteria 1681
144 Ga0496111_0004007 3300048914 Bacteria 9246
145 Ga0496114_0018134 3300048917 Bacteria 5687
146 Ga0496114_0173789 3300048917 Bacteria 1879
147 Ga0501032_0007121 3300049569 Bacteria 8189
148 Ga0501033_0000654 3300049570 Bacteria 32016
149 Ga0501033_0137454 3300049570 Bacteria 1768
150 Ga0501034_0000034 3300049571 Bacteria 242608
151 Ga0501034_0007454 3300049571 Bacteria 11642
152 Ga0501034_0074840 3300049571 Bacteria 3394
153 Ga0501034_0077929 3300049571 Bacteria 3319
154 Ga0501034_0408699 3300049571 Bacteria 1279
155 Ga0501037_0008052 3300049573 Bacteria 7722
156 Ga0501037_0010465 3300049573 Bacteria 6811
157 Ga0501038_0016465 3300049574 Bacteria 6701
158 Ga0501038_0031847 3300049574 Bacteria 4658
159 Ga0501039_0047906 3300049575 Bacteria 3304
160 Ga0501039_0269953 3300049575 Bacteria 1337
161 Ga0501040_0001415 3300049576 Bacteria 15181
162 Ga0501040_0086450 3300049576 Bacteria 2177
163 Ga0501041_0007361 3300049577 Bacteria 6463
164 Ga0501041_0025521 3300049577 Bacteria 3552
165 Ga0501042_0001742 3300049578 Bacteria 13015
166 Ga0501042_0027220 3300049578 Bacteria 4020
167 Ga0501042_0070609 3300049578 Bacteria 2498
168 Ga0501042_0216986 3300049578 Bacteria 1380
169 Ga0501043_0039297 3300049579 Bacteria 3719
170 Ga0501043_0065363 3300049579 Bacteria 2856
171 Ga0501046_0129846 3300049580 Bacteria 1912
172 Ga0501047_0180275 3300049581 Bacteria 1979
173 Ga0501048_0068564 3300049582 Bacteria 2505
174 Ga0501048_0072236 3300049582 Bacteria 2436
175 Ga0501067_0008830 3300049583 Bacteria 5582
176 Ga0501068_0000417 3300049584 Bacteria 21577
177 Ga0501068_0072158 3300049584 Bacteria 2108
178 Ga0501070_0078221 3300049586 Bacteria 2737
179 Ga0501070_0290088 3300049586 Bacteria 1334
180 Ga0501071_0050036 3300049587 Bacteria 3010
181 Ga0501071_0063815 3300049587 Bacteria 2672
182 Ga0501071_0180602 3300049587 Unclassified 1581
183 Ga0501072_0001390 3300049588 Bacteria 18212
184 Ga0501072_0006481 3300049588 Bacteria 8913
185 Ga0501072_0094969 3300049588 Bacteria 2369
186 Ga0501072_0109565 3300049588 Bacteria 2198
187 Ga0501072_0148291 3300049588 Bacteria 1870
188 Ga0501073_0000948 3300049589 Bacteria 20913
189 Ga0501074_0001035 3300049590 Bacteria 18056
190 Ga0501074_0172816 3300049590 Bacteria 1542
191 Ga0501075_0019041 3300049591 Bacteria 4978
192 Ga0501076_0018725 3300049592 Bacteria 5285
193 Ga0501076_0065731 3300049592 Bacteria 2893
194 Ga0501076_0289960 3300049592 Bacteria 1341
195 Ga0501076_0337210 3300049592 Bacteria 1237
196 Ga0501077_0001132 3300049593 Bacteria 16096
197 Ga0501079_0018106 3300049741 Bacteria 5379
198 Ga0501079_0050986 3300049741 Bacteria 3194
199 Ga0501079_0114236 3300049741 Bacteria 2099
200 Ga0501079_0151886 3300049741 Unclassified 1805
201 Ga0501080_0002028 3300049742 Bacteria 17508
202 Ga0501080_0087718 3300049742 Bacteria 2890
203 Ga0501080_0138265 3300049742 Bacteria 2253
204 Ga0501080_0316818 3300049742 Bacteria 1413
205 Ga0501081_0161420 3300049743 Bacteria 1615
206 Ga0501081_0188770 3300049743 Bacteria 1492
207 Ga0501083_0132136 3300049744 Bacteria 1636
208 Ga0501035_0102162 3300049822 Bacteria 2515
209 Ga0501035_0244957 3300049822 Bacteria 1524
210 Ga0501044_0012775 3300049823 Bacteria 9094
211 Ga0501044_0035562 3300049823 Bacteria 5215
212 Ga0501045_0036640 3300049824 Bacteria 3563
213 Ga0501045_0078907 3300049824 Bacteria 2427
214 Ga0501045_0321925 3300049824 Bacteria 1151
215 nmdc:mga03683_34442_c1 3300050489 Bacteria 2049
216 nmdc:mga03683_6983_c2 3300050489 Bacteria 3549
217 nmdc:mga03n38_54262_c1 3300050490 Bacteria 1801
218 nmdc:mga00v17_47180_c1 3300050491 Bacteria 2608
219 nmdc:mga00v17_80953_c1 3300050491 Bacteria 2027
220 nmdc:mga00v17_84875_c1 3300050491 Bacteria 1983
221 nmdc:mga00v17_99681_c1 3300050491 Bacteria 1833
222 nmdc:mga0yw44_14880_c1 3300050492 Bacteria 4148
223 nmdc:mga0yw44_17175_c1 3300050492 Bacteria 3931
224 nmdc:mga0yw44_97763_c1 3300050492 Bacteria 1865
225 nmdc:mga06z11_212500_c1 3300050494 Bacteria 1128
226 nmdc:mga05p37_11915_c1 3300050507 Bacteria 10369
227 nmdc:mga05p37_15962_c1 3300050507 Bacteria 9034
228 nmdc:mga05p37_626268_c1 3300050507 Bacteria 1210
229 nmdc:mga09592_1450_c1 3300050508 Bacteria 19039
230 nmdc:mga09592_18844_c1 3300050508 Bacteria 5663
231 nmdc:mga09592_342296_c1 3300050508 Bacteria 1295
232 nmdc:mga0qj67_366_c1 3300050509 Bacteria 31055
233 nmdc:mga0qj67_41948_c1 3300050509 Bacteria 3601
234 nmdc:mga0qj67_54358_c1 3300050509 Bacteria 3171
235 nmdc:mga06r32_119422_c1 3300050510 Bacteria 2600
236 nmdc:mga06r32_1614_c1 3300050510 Bacteria 20327
237 nmdc:mga06r32_184422_c1 3300050510 Bacteria 2073
238 nmdc:mga06r32_40416_c1 3300050510 Bacteria 4428
239 nmdc:mga06r32_5607_c1 3300050510 Bacteria 11291
240 nmdc:mga08y16_651037_c1 3300050511 Bacteria 1058
241 Ga0495601_0119383 3300053077 Bacteria 1712
242 Ga0500566_0003366 3300053094 Bacteria 9546
243 Ga0500616_0000303 3300053153 Bacteria 71156
244 Ga0501084_0017882 3300054114 Bacteria 5902
245 Ga0501084_0108065 3300054114 Bacteria 2337
246 Ga0501084_0320240 3300054114 Bacteria 1310
247 Ga0501082_0022589 3300060353 Bacteria 5418
248 Ga0501082_0094869 3300060353 Bacteria 2578
249 Ga0501082_0394637 3300060353 Bacteria 1207
250 Ga0530510_0212029 3300061734 Unclassified 1439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0210584 Ga0316584_0210584_12_794 260
2 3300005353 Ga0070669_100326779 Ga0070669_1003267792 267
3 3300025935 Ga0207709_10056128 Ga0207709_100561282 267
4 3300025937 Ga0207669_10005552 Ga0207669_100055525 267
5 3300026075 Ga0207708_10035906 Ga0207708_100359062 267
6 3300026089 Ga0207648_10002665 Ga0207648_100026659 267
7 3300026118 Ga0207675_100064931 Ga0207675_1000649315 267
8 3300009094 Ga0111539_10312731 Ga0111539_103127312 284
9 3300048911 Ga0496108_0382708 Ga0496108_0382708_25_879 284
10 3300005345 Ga0070692_10315138 Ga0070692_103151381 288
11 3300005843 Ga0068860_100009744 Ga0068860_1000097449 288
12 3300005843 Ga0068860_100127724 Ga0068860_1001277242 288
13 3300005844 Ga0068862_100472921 Ga0068862_1004729212 288
14 3300006038 Ga0075365_10069413 Ga0075365_100694131 288
15 3300006042 Ga0075368_10071155 Ga0075368_100711552 288
16 3300006051 Ga0075364_10040012 Ga0075364_100400122 288
17 3300006051 Ga0075364_10307477 Ga0075364_103074771 288
18 3300006353 Ga0075370_10037129 Ga0075370_100371292 288
19 3300006358 Ga0068871_100257627 Ga0068871_1002576272 288
20 3300006871 Ga0075434_100487891 Ga0075434_1004878912 288
21 3300009098 Ga0105245_10231803 Ga0105245_102318033 288
22 3300009148 Ga0105243_10041829 Ga0105243_100418292 288
23 3300009176 Ga0105242_10090931 Ga0105242_100909312 288
24 3300009177 Ga0105248_10345413 Ga0105248_103454132 288
25 3300009553 Ga0105249_10215342 Ga0105249_102153422 288
26 3300013297 Ga0157378_10007763 Ga0157378_100077636 288
27 3300013308 Ga0157375_10018869 Ga0157375_100188698 288
28 3300014325 Ga0163163_10510313 Ga0163163_105103131 288
29 3300014968 Ga0157379_10035479 Ga0157379_100354792 288
30 3300025936 Ga0207670_10136715 Ga0207670_101367152 288
31 3300025938 Ga0207704_10052490 Ga0207704_100524903 288
32 3300025941 Ga0207711_10154609 Ga0207711_101546093 288
33 3300026023 Ga0207677_10152995 Ga0207677_101529952 288
34 3300026035 Ga0207703_10111978 Ga0207703_101119782 288
35 3300026121 Ga0207683_10262739 Ga0207683_102627392 288
36 3300028381 Ga0268264_10008826 Ga0268264_100088265 288
37 3300041451 Ga0451791_0902966 Ga0451791_0902966_219_1085 288
38 3300045976 Ga0466967_0222397 Ga0466967_0222397_911_1777 288
39 3300048903 Ga0496100_0087786 Ga0496100_0087786_964_1830 288
40 3300048904 Ga0496101_0029495 Ga0496101_0029495_2802_3668 288
41 3300048905 Ga0496102_0144202 Ga0496102_0144202_86_952 288
42 3300048908 Ga0496105_0024285 Ga0496105_0024285_3553_4419 288
43 3300048910 Ga0496107_0148879 Ga0496107_0148879_245_1111 288
44 3300048911 Ga0496108_0090274 Ga0496108_0090274_735_1601 288
45 3300048912 Ga0496109_0380848 Ga0496109_0380848_297_1163 288
46 3300048913 Ga0496110_0031321 Ga0496110_0031321_1730_2596 288
47 3300048913 Ga0496110_0231392 Ga0496110_0231392_407_1273 288
48 3300048914 Ga0496111_0004007 Ga0496111_0004007_6563_7429 288
49 3300048917 Ga0496114_0018134 Ga0496114_0018134_2456_3322 288
50 3300048917 Ga0496114_0173789 Ga0496114_0173789_508_1374 288
51 3300049571 Ga0501034_0077929 Ga0501034_0077929_1484_2350 288
52 3300049571 Ga0501034_0408699 Ga0501034_0408699_304_1170 288
53 3300049575 Ga0501039_0047906 Ga0501039_0047906_2254_3120 288
54 3300049576 Ga0501040_0086450 Ga0501040_0086450_309_1175 288
55 3300049577 Ga0501041_0025521 Ga0501041_0025521_2670_3536 288
56 3300049578 Ga0501042_0070609 Ga0501042_0070609_999_1865 288
57 3300049582 Ga0501048_0068564 Ga0501048_0068564_1474_2340 288
58 3300049588 Ga0501072_0094969 Ga0501072_0094969_892_1758 288
59 3300049591 Ga0501075_0019041 Ga0501075_0019041_2895_3761 288
60 3300049592 Ga0501076_0289960 Ga0501076_0289960_142_1008 288
61 3300049741 Ga0501079_0050986 Ga0501079_0050986_89_955 288
62 3300049742 Ga0501080_0316818 Ga0501080_0316818_131_997 288
63 3300049743 Ga0501081_0188770 Ga0501081_0188770_135_1001 288
64 3300049822 Ga0501035_0244957 Ga0501035_0244957_278_1144 288
65 3300049824 Ga0501045_0036640 Ga0501045_0036640_1590_2456 288
66 3300050489 nmdc:mga03683_34442_c1 nmdc:mga03683_34442_c1_497_1363 288
67 3300050489 nmdc:mga03683_6983_c2 nmdc:mga03683_6983_c2_1378_2244 288
68 3300050490 nmdc:mga03n38_54262_c1 nmdc:mga03n38_54262_c1_610_1476 288
69 3300050491 nmdc:mga00v17_80953_c1 nmdc:mga00v17_80953_c1_796_1662 288
70 3300050491 nmdc:mga00v17_84875_c1 nmdc:mga00v17_84875_c1_421_1287 288
71 3300050491 nmdc:mga00v17_99681_c1 nmdc:mga00v17_99681_c1_681_1547 288
72 3300050492 nmdc:mga0yw44_14880_c1 nmdc:mga0yw44_14880_c1_588_1454 288
73 3300050492 nmdc:mga0yw44_17175_c1 nmdc:mga0yw44_17175_c1_1370_2236 288
74 3300050494 nmdc:mga06z11_212500_c1 nmdc:mga06z11_212500_c1_17_883 288
75 3300053153 Ga0500616_0000303 Ga0500616_0000303_18071_18937 288
76 3300054114 Ga0501084_0017882 Ga0501084_0017882_3031_3897 288
77 3300060353 Ga0501082_0094869 Ga0501082_0094869_1247_2113 288
78 3300006844 Ga0075428_100000020 Ga0075428_10000002022 290
79 3300005355 Ga0070671_100048985 Ga0070671_1000489853 291
80 3300049571 Ga0501034_0007454 Ga0501034_0007454_4113_4988 291
81 3300048912 Ga0496109_0685427 Ga0496109_0685427_39_920 292
82 3300046642 Ga0495634_0019126 Ga0495634_0019126_2264_3178 297
83 3300046689 Ga0495613_0020756 Ga0495613_0020756_1097_2011 297
84 3300049581 Ga0501047_0180275 Ga0501047_0180275_905_1798 297
85 3300049578 Ga0501042_0216986 Ga0501042_0216986_219_1124 299
86 3300049586 Ga0501070_0290088 Ga0501070_0290088_99_1019 299
87 3300006844 Ga0075428_100216955 Ga0075428_1002169552 302
88 3300006847 Ga0075431_100081420 Ga0075431_1000814204 302
89 3300009094 Ga0111539_10048297 Ga0111539_100482973 302
90 3300009147 Ga0114129_10030349 Ga0114129_100303497 302
91 3300031727 Ga0316576_10015484 Ga0316576_100154845 302
92 3300035398 Ga0316574_0007959 Ga0316574_0007959_4204_5151 302
93 3300049570 Ga0501033_0000654 Ga0501033_0000654_30821_31729 302
94 3300049823 Ga0501044_0035562 Ga0501044_0035562_2365_3273 302
95 3300050492 nmdc:mga0yw44_97763_c1 nmdc:mga0yw44_97763_c1_645_1553 302
96 3300050507 nmdc:mga05p37_15962_c1 nmdc:mga05p37_15962_c1_5859_6776 302
97 3300050511 nmdc:mga08y16_651037_c1 nmdc:mga08y16_651037_c1_41_958 302
98 3300053094 Ga0500566_0003366 Ga0500566_0003366_1784_2692 302
99 iso_pu_bacteria 2837183177 2837184283 302
100 3300006880 Ga0075429_100436822 Ga0075429_1004368221 303
101 3300025919 Ga0207657_10246226 Ga0207657_102462262 303
102 3300025949 Ga0207667_10068354 Ga0207667_100683543 303
103 3300039437 Ga0436365_0908221 Ga0436365_0908221_208_1119 303
104 3300042435 Ga0439434_0001440 Ga0439434_0001440_5081_6007 303
105 3300049571 Ga0501034_0000034 Ga0501034_0000034_142988_143917 303
106 3300049573 Ga0501037_0010465 Ga0501037_0010465_2321_3250 303
107 3300049584 Ga0501068_0000417 Ga0501068_0000417_12028_12957 303
108 3300049587 Ga0501071_0050036 Ga0501071_0050036_2035_2946 303
109 3300049588 Ga0501072_0006481 Ga0501072_0006481_1263_2192 303
110 3300049589 Ga0501073_0000948 Ga0501073_0000948_6354_7283 303
111 3300049590 Ga0501074_0001035 Ga0501074_0001035_17091_18020 303
112 3300049592 Ga0501076_0065731 Ga0501076_0065731_153_1082 303
113 3300049742 Ga0501080_0002028 Ga0501080_0002028_6244_7173 303
114 3300049742 Ga0501080_0138265 Ga0501080_0138265_1157_2074 303
115 3300049744 Ga0501083_0132136 Ga0501083_0132136_530_1447 303
116 3300060353 Ga0501082_0394637 Ga0501082_0394637_63_980 303
117 3300005329 Ga0070683_100423118 Ga0070683_1004231182 304
118 3300005340 Ga0070689_100143162 Ga0070689_1001431622 304
119 3300005347 Ga0070668_100031115 Ga0070668_1000311155 304
120 3300005356 Ga0070674_100025520 Ga0070674_1000255205 304
121 3300005356 Ga0070674_100369408 Ga0070674_1003694081 304
122 3300005438 Ga0070701_10067806 Ga0070701_100678061 304
123 3300005456 Ga0070678_100158530 Ga0070678_1001585302 304
124 3300005459 Ga0068867_100029406 Ga0068867_1000294062 304
125 3300005544 Ga0070686_100012795 Ga0070686_1000127957 304
126 3300005544 Ga0070686_100214734 Ga0070686_1002147342 304
127 3300005615 Ga0070702_100042347 Ga0070702_1000423473 304
128 3300005617 Ga0068859_100315455 Ga0068859_1003154552 304
129 3300005843 Ga0068860_100013080 Ga0068860_1000130807 304
130 3300005843 Ga0068860_100201803 Ga0068860_1002018033 304
131 3300005937 Ga0081455_10000549 Ga0081455_100005494 304
132 3300005937 Ga0081455_10000578 Ga0081455_1000057838 304
133 3300005981 Ga0081538_10001797 Ga0081538_1000179710 304
134 3300005981 Ga0081538_10003517 Ga0081538_1000351714 304
135 3300005981 Ga0081538_10025009 Ga0081538_100250094 304
136 3300006038 Ga0075365_10001191 Ga0075365_100011914 304
137 3300006038 Ga0075365_10010334 Ga0075365_100103342 304
138 3300006038 Ga0075365_10086829 Ga0075365_100868292 304
139 3300006048 Ga0075363_100021356 Ga0075363_1000213562 304
140 3300006048 Ga0075363_100023942 Ga0075363_1000239425 304
141 3300006048 Ga0075363_100100350 Ga0075363_1001003502 304
142 3300006051 Ga0075364_10029873 Ga0075364_100298732 304
143 3300006051 Ga0075364_10076997 Ga0075364_100769972 304
144 3300006051 Ga0075364_10148277 Ga0075364_101482772 304
145 3300006177 Ga0075362_10007876 Ga0075362_100078763 304
146 3300006237 Ga0097621_100283769 Ga0097621_1002837692 304
147 3300006844 Ga0075428_100002362 Ga0075428_10000236211 304
148 3300006844 Ga0075428_100010985 Ga0075428_1000109855 304
149 3300006844 Ga0075428_100056278 Ga0075428_1000562783 304
150 3300006844 Ga0075428_100070875 Ga0075428_1000708753 304
151 3300006846 Ga0075430_100001723 Ga0075430_1000017231 304
152 3300006846 Ga0075430_100003098 Ga0075430_1000030988 304
153 3300006846 Ga0075430_100016031 Ga0075430_1000160314 304
154 3300006847 Ga0075431_100001015 Ga0075431_10000101510 304
155 3300006847 Ga0075431_100005624 Ga0075431_10000562411 304
156 3300006847 Ga0075431_100008144 Ga0075431_1000081446 304
157 3300006847 Ga0075431_100026729 Ga0075431_1000267294 304
158 3300006847 Ga0075431_100088735 Ga0075431_1000887352 304
159 3300006880 Ga0075429_100002209 Ga0075429_1000022097 304
160 3300006880 Ga0075429_100005161 Ga0075429_1000051614 304
161 3300006880 Ga0075429_100025810 Ga0075429_1000258102 304
162 3300006931 Ga0097620_100315450 Ga0097620_1003154502 304
163 3300009098 Ga0105245_10087912 Ga0105245_100879122 304
164 3300009147 Ga0114129_10000770 Ga0114129_1000077033 304
165 3300009147 Ga0114129_10012645 Ga0114129_100126454 304
166 3300009148 Ga0105243_10023922 Ga0105243_100239222 304
167 3300009176 Ga0105242_10027310 Ga0105242_100273103 304
168 3300014326 Ga0157380_10149824 Ga0157380_101498242 304
169 3300021384 Ga0213876_10131792 Ga0213876_101317922 304
170 3300025931 Ga0207644_10102435 Ga0207644_101024351 304
171 3300025937 Ga0207669_10276791 Ga0207669_102767912 304
172 3300025961 Ga0207712_10023678 Ga0207712_100236782 304
173 3300025972 Ga0207668_10021717 Ga0207668_100217175 304
174 3300025986 Ga0207658_10108051 Ga0207658_101080513 304
175 3300028381 Ga0268264_10009279 Ga0268264_100092797 304
176 3300031665 Ga0316575_10055647 Ga0316575_100556472 304
177 3300031727 Ga0316576_10019907 Ga0316576_100199073 304
178 3300031727 Ga0316576_10059166 Ga0316576_100591662 304
179 3300031727 Ga0316576_10070772 Ga0316576_100707721 304
180 3300031727 Ga0316576_10192876 Ga0316576_101928761 304
181 3300031728 Ga0316578_10038017 Ga0316578_100380172 304
182 3300031733 Ga0316577_10052020 Ga0316577_100520202 304
183 3300032139 Ga0316580_10026317 Ga0316580_100263172 304
184 3300035398 Ga0316574_0002550 Ga0316574_0002550_2998_3921 304
185 3300036712 Ga0316584_0056836 Ga0316584_0056836_498_1430 304
186 3300036712 Ga0316584_0065810 Ga0316584_0065810_582_1505 304
187 3300041512 Ga0451853_1886938 Ga0451853_1886938_98_1021 304
188 3300042008 Ga0439450_001066 Ga0439450_001066_1955_2887 304
189 3300042016 Ga0439463_008085 Ga0439463_008085_472_1404 304
190 3300042876 Ga0451577_0022672 Ga0451577_0022672_3232_4197 304
191 3300042993 Ga0439440_0007321 Ga0439440_0007321_313_1245 304
192 3300044712 Ga0453684_0009137 Ga0453684_0009137_10963_11928 304
193 3300047321 Ga0495676_0308854 Ga0495676_0308854_126_1055 304
194 3300048913 Ga0496110_0055370 Ga0496110_0055370_1997_2938 304
195 3300049569 Ga0501032_0007121 Ga0501032_0007121_5305_6279 304
196 3300049570 Ga0501033_0137454 Ga0501033_0137454_761_1735 304
197 3300049571 Ga0501034_0074840 Ga0501034_0074840_237_1211 304
198 3300049573 Ga0501037_0008052 Ga0501037_0008052_853_1827 304
199 3300049574 Ga0501038_0016465 Ga0501038_0016465_2917_3891 304
200 3300049574 Ga0501038_0031847 Ga0501038_0031847_638_1570 304
201 3300049575 Ga0501039_0269953 Ga0501039_0269953_241_1182 304
202 3300049576 Ga0501040_0001415 Ga0501040_0001415_14192_15124 304
203 3300049577 Ga0501041_0007361 Ga0501041_0007361_17_949 304
204 3300049578 Ga0501042_0001742 Ga0501042_0001742_3842_4774 304
205 3300049578 Ga0501042_0027220 Ga0501042_0027220_636_1577 304
206 3300049579 Ga0501043_0039297 Ga0501043_0039297_367_1299 304
207 3300049579 Ga0501043_0065363 Ga0501043_0065363_513_1487 304
208 3300049580 Ga0501046_0129846 Ga0501046_0129846_227_1168 304
209 3300049582 Ga0501048_0072236 Ga0501048_0072236_1447_2388 304
210 3300049583 Ga0501067_0008830 Ga0501067_0008830_2409_3329 304
211 3300049584 Ga0501068_0072158 Ga0501068_0072158_1062_1994 304
212 3300049586 Ga0501070_0078221 Ga0501070_0078221_1746_2720 304
213 3300049587 Ga0501071_0063815 Ga0501071_0063815_1720_2652 304
214 3300049587 Ga0501071_0180602 Ga0501071_0180602_442_1383 304
215 3300049588 Ga0501072_0001390 Ga0501072_0001390_1354_2286 304
216 3300049588 Ga0501072_0109565 Ga0501072_0109565_91_1023 304
217 3300049588 Ga0501072_0148291 Ga0501072_0148291_792_1727 304
218 3300049590 Ga0501074_0172816 Ga0501074_0172816_589_1521 304
219 3300049592 Ga0501076_0018725 Ga0501076_0018725_851_1783 304
220 3300049592 Ga0501076_0337210 Ga0501076_0337210_72_1004 304
221 3300049593 Ga0501077_0001132 Ga0501077_0001132_10118_11050 304
222 3300049741 Ga0501079_0018106 Ga0501079_0018106_244_1176 304
223 3300049741 Ga0501079_0114236 Ga0501079_0114236_125_1057 304
224 3300049741 Ga0501079_0151886 Ga0501079_0151886_555_1496 304
225 3300049742 Ga0501080_0087718 Ga0501080_0087718_1858_2832 304
226 3300049743 Ga0501081_0161420 Ga0501081_0161420_451_1377 304
227 3300049822 Ga0501035_0102162 Ga0501035_0102162_84_1058 304
228 3300049823 Ga0501044_0012775 Ga0501044_0012775_5317_6291 304
229 3300049824 Ga0501045_0078907 Ga0501045_0078907_649_1590 304
230 3300049824 Ga0501045_0321925 Ga0501045_0321925_181_1134 304
231 3300050491 nmdc:mga00v17_47180_c1 nmdc:mga00v17_47180_c1_1353_2279 304
232 3300050507 nmdc:mga05p37_11915_c1 nmdc:mga05p37_11915_c1_4430_5359 304
233 3300050507 nmdc:mga05p37_626268_c1 nmdc:mga05p37_626268_c1_173_1114 304
234 3300050508 nmdc:mga09592_1450_c1 nmdc:mga09592_1450_c1_11031_11963 304
235 3300050508 nmdc:mga09592_18844_c1 nmdc:mga09592_18844_c1_4430_5359 304
236 3300050508 nmdc:mga09592_342296_c1 nmdc:mga09592_342296_c1_37_978 304
237 3300050509 nmdc:mga0qj67_366_c1 nmdc:mga0qj67_366_c1_17927_18859 304
238 3300050509 nmdc:mga0qj67_41948_c1 nmdc:mga0qj67_41948_c1_695_1636 304
239 3300050509 nmdc:mga0qj67_54358_c1 nmdc:mga0qj67_54358_c1_2160_3089 304
240 3300050510 nmdc:mga06r32_119422_c1 nmdc:mga06r32_119422_c1_733_1674 304
241 3300050510 nmdc:mga06r32_1614_c1 nmdc:mga06r32_1614_c1_7457_8389 304
242 3300050510 nmdc:mga06r32_184422_c1 nmdc:mga06r32_184422_c1_352_1278 304
243 3300050510 nmdc:mga06r32_40416_c1 nmdc:mga06r32_40416_c1_2527_3459 304
244 3300050510 nmdc:mga06r32_5607_c1 nmdc:mga06r32_5607_c1_8045_8974 304
245 3300053077 Ga0495601_0119383 Ga0495601_0119383_534_1457 304
246 3300054114 Ga0501084_0108065 Ga0501084_0108065_326_1267 304
247 3300054114 Ga0501084_0320240 Ga0501084_0320240_253_1185 304
248 3300060353 Ga0501082_0022589 Ga0501082_0022589_3575_4507 304
249 3300061734 Ga0530510_0212029 Ga0530510_0212029_256_1197 304
250 3300003373 JGI25407J50210_10009374 JGI25407J50210_100093743 306
251 3300005981 Ga0081538_10000372 Ga0081538_1000037214 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

110

287

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5unn-assembly1.cif.gz_B crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in apo form 0.8708 87 272
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.8541 93 273
3gvx-assembly1.cif.gz_A crystal structure of glycerate dehydrogenase related protein from thermoplasma acidophilum 0.8448 5 291
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.844 90 283
3gvx-assembly1.cif.gz_A crystal structure of glycerate dehydrogenase related protein from thermoplasma acidophilum 0.8366 5 291
ID Description Score Start End Superfamily
5mhaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9363 92 269 3.40.50.720
af_Q0D7C9_152_341_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9212 91 270 3.40.50.720
af_Q2G281_98_281_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9172 94 272 3.40.50.720
3evtA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.904 91 265 3.40.50.720
af_Q7SZY8_153_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8994 128 267 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6J7H9J6-F1-model_v4 Unannotated protein 0.9165 2 306 GO:0016491
GO:0051287
AF-A0A6J7H9J6-F1-model_v4 Unannotated protein 0.9136 2 306 GO:0016491
GO:0051287
AF-A0A0A1CX71-F1-model_v4 Phosphoglycerate dehydrogenase 0.9121 2 306 GO:0016614
GO:0051287
AF-A0A0Q9NSL4-F1-model_v4 Hydroxyacid dehydrogenase 0.9083 2 306 GO:0016491
GO:0051287
AF-A0A0A1CX71-F1-model_v4 Phosphoglycerate dehydrogenase 0.9065 2 306 GO:0016614
GO:0051287

Feature Viewer

pLDDT pTM Quality
93.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map