F362407

General Info

Members Datasets Scaffolds Average Seq Length
251 136 502 342

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10027459|Ga0157369_100274593
Length 337
Sequence LDLGVVLSEPGRVALEEIVVDEPQAGEVLVRIEATGVCHTDLHVVEEDGWGHQLPVLLGHEGAGVVEQVGEGVASVAHGDRVVIGWKTACGECAPCLRGNPRYCRKPPGAPGRLHRADGADLMPVLRTGTFATRTVVPAIAVAKVPTLAPEEACLLGCAVATGVMSVIETAQIWPGARVAVIGCGAVGLSVIQGAKIAGASEIRAIDLDERKLEQARRFGATDVGTGPADFAFDVVARKATFELALSLAPTVIQIGLSPAGETAEVMLPSLFARRARILVSHGGDHLPEDFPWLAELAMNGKLDLAGMVTRVAPLAEWSEAFDAMRSGDVIRTVLTP

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
59 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.36
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10027459 3300013105 Bacteria 6310
2 rootH1_10152910 3300003323 Bacteria 1986
3 Ga0070658_10071662 3300005327 Bacteria 2838
4 Ga0070658_10253887 3300005327 Unclassified 1492
5 Ga0070658_10284439 3300005327 Unclassified 1408
6 Ga0070680_100033046 3300005336 Bacteria 4167
7 Ga0070680_100075075 3300005336 Bacteria 2783
8 Ga0070660_100000819 3300005339 Bacteria 20620
9 Ga0070660_100010792 3300005339 Bacteria 6466
10 Ga0070660_100015183 3300005339 Bacteria 5555
11 Ga0070661_100063155 3300005344 Bacteria 2719
12 Ga0070661_100063652 3300005344 Bacteria 2709
13 Ga0070671_100173975 3300005355 Bacteria 1821
14 Ga0070714_100176650 3300005435 Bacteria 1941
15 Ga0070714_100229430 3300005435 Bacteria 1710
16 Ga0070714_100315763 3300005435 Bacteria 1460
17 Ga0070711_100113099 3300005439 Bacteria 1996
18 Ga0070708_100372798 3300005445 Bacteria 1346
19 Ga0070663_100154947 3300005455 Bacteria 1760
20 Ga0070681_10006725 3300005458 Bacteria 11187
21 Ga0070681_10017507 3300005458 Bacteria 7163
22 Ga0070681_10040047 3300005458 Bacteria 4698
23 Ga0070681_10060495 3300005458 Bacteria 3764
24 Ga0070681_10100921 3300005458 Bacteria 2831
25 Ga0070681_10120417 3300005458 Bacteria 2560
26 Ga0070679_100028811 3300005530 Bacteria 5477
27 Ga0070679_100066109 3300005530 Bacteria 3604
28 Ga0070679_100079691 3300005530 Bacteria 3264
29 Ga0070679_100110003 3300005530 Bacteria 2742
30 Ga0070684_100169532 3300005535 Bacteria 1983
31 Ga0070684_100226054 3300005535 Bacteria 1708
32 Ga0070684_100295760 3300005535 Bacteria 1485
33 Ga0068853_100120068 3300005539 Bacteria 2344
34 Ga0070696_100055354 3300005546 Bacteria 2766
35 Ga0070665_100006390 3300005548 Bacteria 12006
36 Ga0068855_100105051 3300005563 Bacteria 3248
37 Ga0068855_100260411 3300005563 Bacteria 1932
38 Ga0068857_100108563 3300005577 Bacteria 2493
39 Ga0068856_100288314 3300005614 Bacteria 1658
40 Ga0068852_100116643 3300005616 Bacteria 2437
41 Ga0081539_10008764 3300005985 Bacteria 8681
42 Ga0070712_100050577 3300006175 Bacteria 2892
43 Ga0070712_100084884 3300006175 Bacteria 2303
44 Ga0075431_100079083 3300006847 Bacteria 3395
45 Ga0075433_10085348 3300006852 Bacteria 2787
46 Ga0075434_100012081 3300006871 Bacteria 8176
47 Ga0075434_100085924 3300006871 Bacteria 3145
48 Ga0075435_100002214 3300007076 Bacteria 12830
49 Ga0075435_100006785 3300007076 Bacteria 8124
50 Ga0105240_10125190 3300009093 Bacteria 3090
51 Ga0105240_10278755 3300009093 Bacteria 1921
52 Ga0114129_10094971 3300009147 Bacteria 4129
53 Ga0105248_10298792 3300009177 Bacteria 1813
54 Ga0105238_10028168 3300009551 Bacteria 5723
55 Ga0105239_10298702 3300010375 Bacteria 1813
56 Ga0157370_10006933 3300013104 Bacteria 12382
57 Ga0157369_10001003 3300013105 Bacteria 35669
58 Ga0157369_10060050 3300013105 Bacteria 4100
59 Ga0157369_10182911 3300013105 Bacteria 2205
60 Ga0157378_10350080 3300013297 Bacteria 1443
61 Ga0157372_10021729 3300013307 Bacteria 6936
62 Ga0157372_10031033 3300013307 Bacteria 5849
63 Ga0206354_10427515 3300020081 Bacteria 2450
64 Ga0206353_10130899 3300020082 Bacteria 8536
65 Ga0206353_11239290 3300020082 Bacteria 5475
66 Ga0206353_11265099 3300020082 Bacteria 5219
67 Ga0206353_11550614 3300020082 Bacteria 1646
68 Ga0207707_10009348 3300025912 Bacteria 8502
69 Ga0207707_10012886 3300025912 Bacteria 7277
70 Ga0207707_10032086 3300025912 Bacteria 4598
71 Ga0207707_10101751 3300025912 Bacteria 2511
72 Ga0207671_10074032 3300025914 Bacteria 2545
73 Ga0207693_10057861 3300025915 Bacteria 3037
74 Ga0207693_10168846 3300025915 Bacteria 1723
75 Ga0207663_10146742 3300025916 Bacteria 1650
76 Ga0207660_10043182 3300025917 Bacteria 3167
77 Ga0207660_10184577 3300025917 Bacteria 1622
78 Ga0207660_10258277 3300025917 Bacteria 1377
79 Ga0207657_10000046 3300025919 Bacteria 113887
80 Ga0207657_10001876 3300025919 Bacteria 22733
81 Ga0207657_10010396 3300025919 Bacteria 9289
82 Ga0207657_10018888 3300025919 Bacteria 6563
83 Ga0207657_10108408 3300025919 Bacteria 2296
84 Ga0207649_10047572 3300025920 Bacteria 2641
85 Ga0207652_10024169 3300025921 Bacteria 5040
86 Ga0207646_10359248 3300025922 Unclassified 1316
87 Ga0207664_10029085 3300025929 Bacteria 4206
88 Ga0207711_10264758 3300025941 Bacteria 1581
89 Ga0207661_10089740 3300025944 Bacteria 2558
90 Ga0207667_10085612 3300025949 Bacteria 3263
91 Ga0207667_10448540 3300025949 Bacteria 1311
92 Ga0207639_10080482 3300026041 Bacteria 2577
93 Ga0207639_10096328 3300026041 Bacteria 2380
94 Ga0207639_10291653 3300026041 Bacteria 1439
95 Ga0207678_10076110 3300026067 Bacteria 2875
96 Ga0207702_10082214 3300026078 Bacteria 2800
97 Ga0207674_10076076 3300026116 Bacteria 3366
98 Ga0207674_10144619 3300026116 Bacteria 2336
99 Ga0207698_10080096 3300026142 Bacteria 2630
100 Ga0265319_1008616 3300028563 Bacteria 4446
101 Ga0265340_10061456 3300031247 Bacteria 1797
102 Ga0373944_0007136 3300035089 Bacteria 2987
103 Ga0373936_0048612 3300035113 Bacteria 1712
104 Ga0373943_0002003 3300035170 Bacteria 9228
105 Ga0373943_0027984 3300035170 Bacteria 2653
106 Ga0373946_0006469 3300035171 Bacteria 4247
107 Ga0373935_0010224 3300035692 Bacteria 5622
108 Ga0373935_0046063 3300035692 Bacteria 2754
109 Ga0373927_0041300 3300035695 Bacteria 2992
110 Ga0373947_0000658 3300035725 Bacteria 20469
111 Ga0373947_0010442 3300035725 Bacteria 5329
112 Ga0373937_0169836 3300036401 Bacteria 2046
113 Ga0373925_0006545 3300037068 Bacteria 8566
114 Ga0373925_0045564 3300037068 Bacteria 3258
115 Ga0395899_0030078 3300037312 Bacteria 4086
116 Ga0395899_0048877 3300037312 Bacteria 3146
117 Ga0395899_0064361 3300037312 Bacteria 2696
118 Ga0395900_0038976 3300037418 Bacteria 4898
119 Ga0395900_0142058 3300037418 Bacteria 2458
120 Ga0395900_0348796 3300037418 Bacteria 1454
121 Ga0395900_0412736 3300037418 Bacteria 1312
122 Ga0395898_0002320 3300037466 Bacteria 22735
123 Ga0395898_0042119 3300037466 Bacteria 4507
124 Ga0395898_0066208 3300037466 Bacteria 3501
125 Ga0395898_0109532 3300037466 Bacteria 2647
126 Ga0395898_0111775 3300037466 Bacteria 2618
127 Ga0395905_0017139 3300037471 Bacteria 6880
128 Ga0395905_0017788 3300037471 Bacteria 6752
129 Ga0395905_0033088 3300037471 Bacteria 4860
130 Ga0395905_0186206 3300037471 Bacteria 1948
131 Ga0395905_0241467 3300037471 Bacteria 1688
132 Ga0395901_0028173 3300038443 Bacteria 5778
133 Ga0395901_0031824 3300038443 Bacteria 5439
134 Ga0395901_0067596 3300038443 Bacteria 3722
135 Ga0395901_0070598 3300038443 Bacteria 3639
136 Ga0395901_0077152 3300038443 Bacteria 3477
137 Ga0395901_0096438 3300038443 Bacteria 3099
138 Ga0466966_0006458 3300044684 Bacteria 7756
139 Ga0466963_0002900 3300044694 Bacteria 9681
140 Ga0466963_0003298 3300044694 Bacteria 9204
141 Ga0466963_0033589 3300044694 Bacteria 3333
142 Ga0466963_0043131 3300044694 Bacteria 2965
143 Ga0466964_0068739 3300044706 Bacteria 1492
144 Ga0466959_0002397 3300045049 Bacteria 11960
145 Ga0466959_0002802 3300045049 Bacteria 11226
146 Ga0466959_0112504 3300045049 Bacteria 1942
147 Ga0466967_0007075 3300045976 Bacteria 8040
148 Ga0466967_0009204 3300045976 Bacteria 7312
149 Ga0466967_0024941 3300045976 Bacteria 4923
150 Ga0466967_0369471 3300045976 Bacteria 1391
151 Ga0495592_0093503 3300046454 Bacteria 2153
152 Ga0495629_0000159 3300046459 Bacteria 59616
153 Ga0495641_0003425 3300046461 Bacteria 11883
154 Ga0495641_0026852 3300046461 Bacteria 2806
155 Ga0495651_0014719 3300046462 Bacteria 6049
156 Ga0495653_0121166 3300046463 Unclassified 1864
157 Ga0495653_0210486 3300046463 Bacteria 1313
158 Ga0495582_0000183 3300046473 Bacteria 34098
159 Ga0495582_0024372 3300046473 Bacteria 3310
160 Ga0495639_0004941 3300046475 Bacteria 5715
161 Ga0495662_0000220 3300046476 Bacteria 23891
162 Ga0495662_0042490 3300046476 Bacteria 2194
163 Ga0495664_0040308 3300046477 Bacteria 2761
164 Ga0495608_0053703 3300046511 Bacteria 2665
165 Ga0495608_0117257 3300046511 Bacteria 1708
166 Ga0495628_0101083 3300046516 Bacteria 2225
167 Ga0495628_0182071 3300046516 Bacteria 1589
168 Ga0495630_0004113 3300046517 Bacteria 10186
169 Ga0495630_0005932 3300046517 Bacteria 8638
170 Ga0495630_0017737 3300046517 Bacteria 5220
171 Ga0495665_0003082 3300046531 Bacteria 9020
172 Ga0495587_0022855 3300046536 Bacteria 3847
173 Ga0495667_0040787 3300046559 Bacteria 3080
174 Ga0495667_0091064 3300046559 Bacteria 1975
175 Ga0495634_0006252 3300046642 Bacteria 9068
176 Ga0495634_0045633 3300046642 Bacteria 2961
177 Ga0495634_0116781 3300046642 Unclassified 1711
178 Ga0495659_0036282 3300046664 Bacteria 1741
179 Ga0495599_0087853 3300046678 Bacteria 1940
180 Ga0495623_0017587 3300046679 Bacteria 4616
181 Ga0495658_0003714 3300046683 Bacteria 7549
182 Ga0495658_0008827 3300046683 Bacteria 5011
183 Ga0495613_0001702 3300046689 Bacteria 16745
184 Ga0495613_0016817 3300046689 Bacteria 5447
185 Ga0495613_0140077 3300046689 Bacteria 1729
186 Ga0495624_0127297 3300046690 Bacteria 1563
187 Ga0495600_0074592 3300046809 Bacteria 2215
188 Ga0495581_0002281 3300047315 Bacteria 10800
189 Ga0495604_0021242 3300047317 Bacteria 5182
190 Ga0495604_0046127 3300047317 Bacteria 3398
191 Ga0495674_0003066 3300047319 Bacteria 16232
192 Ga0495674_0057105 3300047319 Bacteria 3417
193 Ga0495674_0059473 3300047319 Bacteria 3337
194 Ga0495676_0008530 3300047321 Bacteria 9392
195 Ga0495680_0004997 3300047322 Bacteria 12543
196 Ga0495680_0015775 3300047322 Bacteria 6505
197 Ga0495680_0020576 3300047322 Bacteria 5546
198 Ga0495680_0043126 3300047322 Bacteria 3574
199 Ga0495680_0071468 3300047322 Bacteria 2642
200 Ga0495684_0006694 3300047471 Bacteria 8942
201 Ga0495593_0004600 3300047673 Bacteria 8205
202 Ga0495602_0016803 3300048088 Bacteria 7345
203 Ga0496100_0003593 3300048903 Bacteria 8103
204 Ga0496100_0031095 3300048903 Bacteria 3316
205 Ga0496100_0059249 3300048903 Bacteria 2515
206 Ga0496101_0007288 3300048904 Bacteria 7156
207 Ga0496101_0023650 3300048904 Bacteria 4246
208 Ga0496102_0023997 3300048905 Bacteria 5421
209 Ga0496102_0212788 3300048905 Bacteria 1822
210 Ga0496103_0029869 3300048906 Bacteria 3314
211 Ga0496103_0231424 3300048906 Bacteria 1189
212 Ga0496104_0045910 3300048907 Bacteria 4110
213 Ga0496104_0142552 3300048907 Bacteria 2302
214 Ga0496105_0000598 3300048908 Bacteria 24057
215 Ga0496106_0020345 3300048909 Bacteria 4924
216 Ga0496107_0007426 3300048910 Bacteria 7557
217 Ga0496107_0015723 3300048910 Bacteria 5306
218 Ga0496108_0002695 3300048911 Bacteria 14211
219 Ga0496109_0022202 3300048912 Bacteria 5619
220 Ga0496111_0037237 3300048914 Bacteria 3482
221 Ga0496112_0002299 3300048915 Bacteria 15308
222 Ga0496112_0071007 3300048915 Bacteria 3441
223 Ga0496112_0305448 3300048915 Bacteria 1536
224 Ga0496114_0001233 3300048917 Bacteria 19345
225 Ga0496114_0018810 3300048917 Bacteria 5591
226 Ga0496114_0037957 3300048917 Bacteria 3985
227 Ga0496115_0023121 3300048918 Bacteria 4822
228 Ga0496115_0118947 3300048918 Bacteria 2173
229 Ga0501047_0004868 3300049581 Bacteria 12610
230 Ga0501067_0002721 3300049583 Bacteria 9723
231 Ga0501069_0005303 3300049585 Bacteria 6698
232 Ga0501074_0151804 3300049590 Bacteria 1656
233 Ga0501080_0049994 3300049742 Bacteria 3892
234 Ga0501080_0087341 3300049742 Bacteria 2897
235 Ga0501044_0180227 3300049823 Bacteria 2080
236 nmdc:mga05p37_24026_c1 3300050507 Bacteria 7404
237 nmdc:mga0n895_11759_c1 3300050512 Bacteria 7824
238 nmdc:mga0n895_4658_c1 3300050512 Bacteria 11312
239 nmdc:mga0rr50_14134_c1 3300050513 Bacteria 5226
240 nmdc:mga0rr50_46701_c1 3300050513 Bacteria 3189
241 nmdc:mga08x19_9240_c1 3300050514 Bacteria 5891
242 nmdc:mga0a205_78983_c1 3300050515 Bacteria 3179
243 nmdc:mga0a205_9890_c1 3300050515 Bacteria 8748
244 Ga0495601_0053733 3300053077 Bacteria 2547
245 Ga0495612_0099733 3300053078 Bacteria 1236
246 Ga0495595_0011232 3300053084 Bacteria 3740
247 Ga0495595_0012682 3300053084 Bacteria 3549
248 Ga0495619_0005539 3300053085 Bacteria 8009
249 Ga0495619_0031768 3300053085 Bacteria 3422
250 Ga0495619_0083938 3300053085 Bacteria 2149
251 Ga0495619_0095316 3300053085 Bacteria 2019
252 Ga0157369_10027459
253 rootH1_10152910
254 Ga0070658_10071662
255 Ga0070658_10253887
256 Ga0070658_10284439
257 Ga0070680_100033046
258 Ga0070680_100075075
259 Ga0070660_100000819
260 Ga0070660_100010792
261 Ga0070660_100015183
262 Ga0070661_100063155
263 Ga0070661_100063652
264 Ga0070671_100173975
265 Ga0070714_100176650
266 Ga0070714_100229430
267 Ga0070714_100315763
268 Ga0070711_100113099
269 Ga0070708_100372798
270 Ga0070663_100154947
271 Ga0070681_10006725
272 Ga0070681_10017507
273 Ga0070681_10040047
274 Ga0070681_10060495
275 Ga0070681_10100921
276 Ga0070681_10120417
277 Ga0070679_100028811
278 Ga0070679_100066109
279 Ga0070679_100079691
280 Ga0070679_100110003
281 Ga0070684_100169532
282 Ga0070684_100226054
283 Ga0070684_100295760
284 Ga0068853_100120068
285 Ga0070696_100055354
286 Ga0070665_100006390
287 Ga0068855_100105051
288 Ga0068855_100260411
289 Ga0068857_100108563
290 Ga0068856_100288314
291 Ga0068852_100116643
292 Ga0081539_10008764
293 Ga0070712_100050577
294 Ga0070712_100084884
295 Ga0075431_100079083
296 Ga0075433_10085348
297 Ga0075434_100012081
298 Ga0075434_100085924
299 Ga0075435_100002214
300 Ga0075435_100006785
301 Ga0105240_10125190
302 Ga0105240_10278755
303 Ga0114129_10094971
304 Ga0105248_10298792
305 Ga0105238_10028168
306 Ga0105239_10298702
307 Ga0157370_10006933
308 Ga0157369_10001003
309 Ga0157369_10060050
310 Ga0157369_10182911
311 Ga0157378_10350080
312 Ga0157372_10021729
313 Ga0157372_10031033
314 Ga0206354_10427515
315 Ga0206353_10130899
316 Ga0206353_11239290
317 Ga0206353_11265099
318 Ga0206353_11550614
319 Ga0207707_10009348
320 Ga0207707_10012886
321 Ga0207707_10032086
322 Ga0207707_10101751
323 Ga0207671_10074032
324 Ga0207693_10057861
325 Ga0207693_10168846
326 Ga0207663_10146742
327 Ga0207660_10043182
328 Ga0207660_10184577
329 Ga0207660_10258277
330 Ga0207657_10000046
331 Ga0207657_10001876
332 Ga0207657_10010396
333 Ga0207657_10018888
334 Ga0207657_10108408
335 Ga0207649_10047572
336 Ga0207652_10024169
337 Ga0207646_10359248
338 Ga0207664_10029085
339 Ga0207711_10264758
340 Ga0207661_10089740
341 Ga0207667_10085612
342 Ga0207667_10448540
343 Ga0207639_10080482
344 Ga0207639_10096328
345 Ga0207639_10291653
346 Ga0207678_10076110
347 Ga0207702_10082214
348 Ga0207674_10076076
349 Ga0207674_10144619
350 Ga0207698_10080096
351 Ga0265319_1008616
352 Ga0265340_10061456
353 Ga0373944_0007136
354 Ga0373936_0048612
355 Ga0373943_0002003
356 Ga0373943_0027984
357 Ga0373946_0006469
358 Ga0373935_0010224
359 Ga0373935_0046063
360 Ga0373927_0041300
361 Ga0373947_0000658
362 Ga0373947_0010442
363 Ga0373937_0169836
364 Ga0373925_0006545
365 Ga0373925_0045564
366 Ga0395899_0030078
367 Ga0395899_0048877
368 Ga0395899_0064361
369 Ga0395900_0038976
370 Ga0395900_0142058
371 Ga0395900_0348796
372 Ga0395900_0412736
373 Ga0395898_0002320
374 Ga0395898_0042119
375 Ga0395898_0066208
376 Ga0395898_0109532
377 Ga0395898_0111775
378 Ga0395905_0017139
379 Ga0395905_0017788
380 Ga0395905_0033088
381 Ga0395905_0186206
382 Ga0395905_0241467
383 Ga0395901_0028173
384 Ga0395901_0031824
385 Ga0395901_0067596
386 Ga0395901_0070598
387 Ga0395901_0077152
388 Ga0395901_0096438
389 Ga0466966_0006458
390 Ga0466963_0002900
391 Ga0466963_0003298
392 Ga0466963_0033589
393 Ga0466963_0043131
394 Ga0466964_0068739
395 Ga0466959_0002397
396 Ga0466959_0002802
397 Ga0466959_0112504
398 Ga0466967_0007075
399 Ga0466967_0009204
400 Ga0466967_0024941
401 Ga0466967_0369471
402 Ga0495592_0093503
403 Ga0495629_0000159
404 Ga0495641_0003425
405 Ga0495641_0026852
406 Ga0495651_0014719
407 Ga0495653_0121166
408 Ga0495653_0210486
409 Ga0495582_0000183
410 Ga0495582_0024372
411 Ga0495639_0004941
412 Ga0495662_0000220
413 Ga0495662_0042490
414 Ga0495664_0040308
415 Ga0495608_0053703
416 Ga0495608_0117257
417 Ga0495628_0101083
418 Ga0495628_0182071
419 Ga0495630_0004113
420 Ga0495630_0005932
421 Ga0495630_0017737
422 Ga0495665_0003082
423 Ga0495587_0022855
424 Ga0495667_0040787
425 Ga0495667_0091064
426 Ga0495634_0006252
427 Ga0495634_0045633
428 Ga0495634_0116781
429 Ga0495659_0036282
430 Ga0495599_0087853
431 Ga0495623_0017587
432 Ga0495658_0003714
433 Ga0495658_0008827
434 Ga0495613_0001702
435 Ga0495613_0016817
436 Ga0495613_0140077
437 Ga0495624_0127297
438 Ga0495600_0074592
439 Ga0495581_0002281
440 Ga0495604_0021242
441 Ga0495604_0046127
442 Ga0495674_0003066
443 Ga0495674_0057105
444 Ga0495674_0059473
445 Ga0495676_0008530
446 Ga0495680_0004997
447 Ga0495680_0015775
448 Ga0495680_0020576
449 Ga0495680_0043126
450 Ga0495680_0071468
451 Ga0495684_0006694
452 Ga0495593_0004600
453 Ga0495602_0016803
454 Ga0496100_0003593
455 Ga0496100_0031095
456 Ga0496100_0059249
457 Ga0496101_0007288
458 Ga0496101_0023650
459 Ga0496102_0023997
460 Ga0496102_0212788
461 Ga0496103_0029869
462 Ga0496103_0231424
463 Ga0496104_0045910
464 Ga0496104_0142552
465 Ga0496105_0000598
466 Ga0496106_0020345
467 Ga0496107_0007426
468 Ga0496107_0015723
469 Ga0496108_0002695
470 Ga0496109_0022202
471 Ga0496111_0037237
472 Ga0496112_0002299
473 Ga0496112_0071007
474 Ga0496112_0305448
475 Ga0496114_0001233
476 Ga0496114_0018810
477 Ga0496114_0037957
478 Ga0496115_0023121
479 Ga0496115_0118947
480 Ga0501047_0004868
481 Ga0501067_0002721
482 Ga0501069_0005303
483 Ga0501074_0151804
484 Ga0501080_0049994
485 Ga0501080_0087341
486 Ga0501044_0180227
487 nmdc:mga05p37_24026_c1
488 nmdc:mga0n895_11759_c1
489 nmdc:mga0n895_4658_c1
490 nmdc:mga0rr50_14134_c1
491 nmdc:mga0rr50_46701_c1
492 nmdc:mga08x19_9240_c1
493 nmdc:mga0a205_78983_c1
494 nmdc:mga0a205_9890_c1
495 Ga0495601_0053733
496 Ga0495612_0099733
497 Ga0495595_0011232
498 Ga0495595_0012682
499 Ga0495619_0005539
500 Ga0495619_0031768
501 Ga0495619_0083938
502 Ga0495619_0095316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

186

300

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

24

147

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tnx-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria 0.9307 2 329
5tnx-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria 0.9226 2 329
8h2a-assembly2.cif.gz_F crystal structure of alcohol dehydrogenase from formosa agariphila 0.9212 2 330
8h2b-assembly1.cif.gz_B crystal structure of alcohol dehydrogenase from zobellia galactanivorans 0.9196 2 330
8h2a-assembly1.cif.gz_C crystal structure of alcohol dehydrogenase from formosa agariphila 0.9179 2 330
ID Description Score Start End Superfamily
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 160 269 3.40.50.720
5tnxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 152 272 3.40.50.720
af_O53533_167_304_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9546 152 273 3.90.180.10
af_K7MH10_157_229_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9521 152 212 3.90.180.10
4ejmA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9474 157 273 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3EIU9-F1-model_v4 Zinc-binding dehydrogenase 0.9905 142 212 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A7W1JYU3-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9744 2 330 GO:0008270
GO:0016491
AF-A0A7W1JYU3-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9686 2 330 GO:0008270
GO:0016491
AF-A0A3M1GX83-F1-model_v4 Zinc-binding dehydrogenase 0.9668 119 330 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A536QW18-F1-model_v4 Zinc-binding dehydrogenase 0.963 1 239 GO:0005829
GO:0008270
GO:0046294
GO:0051903

Map