F362346

General Info

Members Datasets Scaffolds Average Seq Length
251 201 502 392

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10038101|Ga0105244_100381012
Length 428
Sequence MGKTSSIFVSMCILHLTQDRADASETGRGIDMSSIPKIVILGAGYGGILTAQRLQKELNYNEADVTLVNRHDYHYITTHLHMPAAGTDTIEHARVPISKLIDEFKIDLVKSSVKEIRLQDRKIILEDGTLSYDYLIIGLGGEPETFGIPGMLDHAMTIRSINSVRLIREHIEYQFAMYKNDNKRNRIRFVVGGAGFSGVEFVAELADRIPQLCKEFDVNPKHVHIYNVEAAPSALPGFDPELVEHAMNVLKKKGVTFKIGVPIKQCLPDGVIVGEGEKLDAATVVWTGGIRGNSLLEQAGLEVMRGRVKVDDYLRAPGHEHVYVIGDNSLVFNAEGRPYPPTAQIAMQQGVNCAKNVVASIRKKQPQPFVFTSKGTVASLGKGEAIAVVGGKKYKGWKAAQLKKLVDLRYLFIIGGIPLVLKKGRFFG

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
8 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
9 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
11 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
12 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
13 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
15 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
19 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
20 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
21 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
22 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
23 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
24 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
25 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
26 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
27 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
28 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
29 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
30 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
31 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
32 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
33 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
34 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
35 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
36 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
37 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
38 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
39 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
40 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
41 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
42 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
43 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
44 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
45 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
46 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
47 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
55 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
56 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
57 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
58 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
59 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
60 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
61 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
62 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
63 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
64 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
65 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
66 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
67 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
68 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
69 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
70 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
71 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
72 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
73 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
74 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
75 2643221729 Bacillus sp. Root11 Isolate Unclassified
76 2643221730 Bacillus sp. Root131 Isolate Unclassified
77 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
78 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
79 2671180694 Paenibacillus sp. A3 Isolate Unclassified
80 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
81 2684622632 Bacillus cereus 905 Isolate Unclassified
82 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
83 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
84 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
85 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
86 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
87 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
88 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
89 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
90 2738541358 Bacillus sp. OV752 Isolate Unclassified
91 2738543006 Bacillus sp. OK077 Isolate Unclassified
92 2738543010 Bacillus sp. YR335 Isolate Unclassified
93 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
94 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
95 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
96 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
97 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
98 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
99 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
100 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
101 2818991441 Niallia circulans 3243 Isolate Rhizosphere
102 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
103 2818991459 Paenibacillus sp. 597 Isolate Unclassified
104 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
105 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
106 2842682962 Bacillus sp. R-72492 Isolate Unclassified
107 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
108 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
109 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
110 2857472729 Cohnella sp. R-74144 Isolate Unclassified
111 2857581216 Bacillus sp. R-71922 Isolate Unclassified
112 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
113 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
114 2860837431 Bacillus sp. WR11 Isolate Unclassified
115 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
116 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
117 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
118 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
119 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
120 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
121 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
122 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
123 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
124 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
125 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
126 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
127 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
128 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
129 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
130 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
131 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
132 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
133 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
134 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
135 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
136 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
137 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
138 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
139 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
140 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
141 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
142 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
143 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
144 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
145 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
146 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
147 2938917290 Bacillus sp. CR71 Isolate Unclassified
148 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
149 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
150 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
151 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
152 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
153 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
154 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
155 2965761152 Bacillus sp. COPE52 Isolate Unclassified
156 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
157 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
158 2969141011 Bacillus velezensis MH25 Isolate Unclassified
159 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
160 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
161 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
162 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
163 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
164 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
165 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
166 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
167 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
168 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
169 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
170 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
171 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
172 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
173 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
174 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
175 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
176 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
177 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
178 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
179 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
180 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
181 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
182 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
183 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
184 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
185 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
186 8022653035 Bacillus sp. Rc4 Isolate Unclassified
187 8022792930 Bacillus sp. Xin Isolate Rhizosphere
188 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
189 8023438354 Bacillus sp. BH2 Isolate Unclassified
190 8023444577 Bacillus sp. BH32 Isolate Unclassified
191 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
192 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
193 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
194 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
195 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
196 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
197 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
198 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
199 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
200 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
201 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 29.08
Metatranscriptomes 2.79
Isolates 68.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 7.97
Nodule 0.8
Rhizoplane 1.99
Rhizosphere 48.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10038101 3300009036 Bacteria 2509
2 JGI25159J45721_1003037 3300002987 Bacteria 6072
3 JGI25159J45721_1007574 3300002987 Bacteria 3093
4 Ga0055532_1000657 3300003758 Bacteria 13288
5 Ga0055535_1005361 3300003761 Bacteria 2835
6 Ga0055541_1000999 3300003841 Bacteria 6606
7 Ga0055541_1006498 3300003841 Bacteria 1977
8 Ga0070669_100033234 3300005353 Bacteria 3730
9 Ga0105244_10034686 3300009036 Bacteria 2655
10 Ga0105246_10003894 3300011119 Bacteria 9045
11 Ga0209566_100130 3300025225 Bacteria 91966
12 Ga0209566_100319 3300025225 Bacteria 43567
13 Ga0209566_100363 3300025225 Bacteria 38102
14 Ga0209147_100131 3300025229 Bacteria 120381
15 Ga0209147_106305 3300025229 Bacteria 1658
16 Ga0209437_100703 3300025233 Bacteria 17455
17 Ga0209130_1000320 3300025284 Bacteria 56333
18 Ga0209675_1013520 3300025291 Bacteria 2545
19 Ga0209676_1009176 3300025292 Bacteria 4302
20 Ga0209025_1000433 3300025294 Bacteria 82715
21 Ga0209025_1002061 3300025294 Bacteria 22834
22 Ga0209025_1002789 3300025294 Bacteria 17632
23 Ga0209025_1003327 3300025294 Bacteria 15448
24 Ga0209025_1048254 3300025294 Bacteria 1728
25 Ga0207696_1000998 3300025711 Bacteria 17023
26 Ga0207655_1001350 3300025728 Bacteria 23047
27 Ga0207681_10053449 3300025923 Bacteria 2742
28 Ga0307409_100371052 3300031995 Bacteria 1357
29 Ga0395899_0013860 3300037312 Bacteria 6158
30 Ga0395899_0063324 3300037312 Bacteria 2721
31 Ga0237819_00571 3300038705 Bacteria 12394
32 Ga0439436_0008751 3300041404 Bacteria 3109
33 Ga0439439_0000236 3300041406 Bacteria 8657
34 Ga0439433_0000314 3300041999 Bacteria 8431
35 Ga0439449_0036094 3300042007 Bacteria 1838
36 Ga0439462_0019445 3300042015 Bacteria 1768
37 Ga0466969_0002580 3300044656 Bacteria 9676
38 Ga0466968_0008183 3300044735 Bacteria 4000
39 Ga0466959_0003973 3300045049 Bacteria 9831
40 Ga0466967_0001334 3300045976 Bacteria 14141
41 Ga0466967_0259364 3300045976 Bacteria 1663
42 Ga0495603_0102797 3300046455 Bacteria 1668
43 Ga0495590_0033435 3300046457 Bacteria 1798
44 Ga0495661_0076372 3300046665 Bacteria 1944
45 Ga0495636_0053388 3300047318 Bacteria 1697
46 Ga0496104_0137862 3300048907 Bacteria 2344
47 Ga0496110_0000735 3300048913 Bacteria 22638
48 Ga0496113_0135338 3300048916 Bacteria 1936
49 Ga0496116_0001854 3300048919 Bacteria 22868
50 Ga0496116_0024637 3300048919 Bacteria 4444
51 Ga0496116_0060755 3300048919 Bacteria 2449
52 Ga0496116_0107900 3300048919 Bacteria 1645
53 Ga0496117_0022092 3300048920 Bacteria 5112
54 Ga0496119_0002406 3300048922 Bacteria 20551
55 Ga0496119_0014723 3300048922 Bacteria 6092
56 Ga0496119_0068753 3300048922 Bacteria 2084
57 Ga0496120_0000212 3300048923 Bacteria 99961
58 Ga0496121_0040328 3300048924 Bacteria 4098
59 Ga0496122_0005811 3300048925 Bacteria 14503
60 Ga0496122_0015508 3300048925 Bacteria 7280
61 Ga0496122_0037464 3300048925 Bacteria 3903
62 Ga0496122_0054714 3300048925 Bacteria 2994
63 Ga0496123_0004407 3300048926 Bacteria 14836
64 Ga0496123_0097152 3300048926 Bacteria 1727
65 Ga0496124_0000170 3300048927 Bacteria 131603
66 Ga0496124_0000998 3300048927 Bacteria 44860
67 Ga0496124_0136169 3300048927 Bacteria 1944
68 Ga0496125_0000620 3300048928 Bacteria 59641
69 Ga0496125_0001530 3300048928 Bacteria 33186
70 Ga0496125_0022744 3300048928 Bacteria 5811
71 Ga0496126_0002583 3300048929 Bacteria 24153
72 Ga0496126_0003050 3300048929 Bacteria 21710
73 Ga0496126_0024747 3300048929 Bacteria 5790
74 Ga0501306_003593 3300049127 Bacteria 1681
75 Ga0501316_002084 3300049532 Bacteria 1811
76 Ga0501319_000646 3300049535 Bacteria 1753
77 Ga0587080_009592 3300059503 Bacteria 1411
78 Ga0587083_0010935 3300059505 Bacteria 1485
79 Ga0587067_006500 3300059640 Bacteria 1632
80 Ga0587079_000243 3300059647 Bacteria 4215
81 2511180139 2510917027 Bacteria 5287437
82 2511699135 2511231119 Bacteria 4019861
83 2512635962 2512564013 Bacteria 6286191
84 2512730636 2512564039 Bacteria 8739048
85 2524189083 2524023129 Bacteria 6762600
86 2524191846 2524023129 Bacteria 6762600
87 2540606365 2540341094 Bacteria 4061186
88 2545559538 2545555800 Bacteria 4222588
89 2553394439 2551306519 Bacteria 5465154
90 2563928551 2563366752 Bacteria 4961801
91 2571532045 2571042143 Bacteria 6986194
92 2573037994 2571042588 Bacteria 5045676
93 2578338403 2576861424 Bacteria 5270569
94 2578930495 2576861599 Bacteria 4217202
95 2580934327 2579778775 Bacteria 5360914
96 2587741544 2585428059 Bacteria 8696589
97 2587743234 2585428059 Bacteria 8696589
98 2595319578 2593339198 Bacteria 7267884
99 2601638355 2600255286 Bacteria 5390125
100 2601640731 2600255286 Bacteria 5390125
101 2621276937 2619619294 Bacteria 5575484
102 2631986012 2630968484 Bacteria 3876276
103 2643740917 2643221543 Bacteria 6628015
104 2644424272 2643221676 Bacteria 8119172
105 2644428128 2643221676 Bacteria 8119172
106 2644707341 2643221729 Bacteria 6621700
107 2644714298 2643221730 Bacteria 6523787
108 2651529939 2648501850 Bacteria 3975476
109 2672335212 2671180330 Bacteria 5521719
110 2672337894 2671180330 Bacteria 5521719
111 2673818110 2671180694 Bacteria 7506943
112 2674419996 2671180844 Bacteria 4164150
113 2685153038 2684622632 Bacteria 5380049
114 2695627068 2695420354 Bacteria 3922431
115 2698320141 2695420987 Bacteria 6152737
116 2705996966 2703719227 Bacteria 5631989
117 2717917123 2716884898 Bacteria 3928789
118 2721508186 2718218445 Bacteria 5113413
119 2723605750 2721755693 Bacteria 6126117
120 2728532148 2728368933 Bacteria 7044283
121 2728532388 2728368933 Bacteria 7044283
122 2730136424 2728369359 Bacteria 5621728
123 2739157188 2738541358 Bacteria 5932299
124 2739209062 2738543006 Bacteria 5904091
125 2739233491 2738543010 Bacteria 5583595
126 2745170050 2744054657 Bacteria 5016802
127 2753810379 2751185905 Bacteria 6142767
128 2793185138 2791355222 Bacteria 5898266
129 2802438652 2802428803 Bacteria 5806948
130 2809054581 2808606399 Bacteria 4021018
131 2816861715 2816332186 Bacteria 5331395
132 2816864061 2816332186 Bacteria 5331395
133 2817480213 2816332295 Bacteria 4352468
134 2817620468 2816332336 Bacteria 5207640
135 2819567844 2818991441 Bacteria 5062707
136 2819582464 2818991443 Bacteria 6598732
137 2819671567 2818991459 Bacteria 8736032
138 2819674856 2818991459 Bacteria 8736032
139 2821117355 2821111986 Bacteria 6894338
140 2831908440 2831905167 Bacteria 3319172
141 2842688620 2842682962 Bacteria 5589973
142 2857458013 2857453340 Bacteria 8090534
143 2857458919 2857453340 Bacteria 8090534
144 2857462307 2857460504 Bacteria 5194327
145 2857467998 2857465823 Bacteria 6772595
146 2857475971 2857472729 Bacteria 6568124
147 2857586846 2857581216 Bacteria 5522813
148 2857594512 2857591370 Bacteria 6569758
149 2857608235 2857604169 Bacteria 5111450
150 2860838760 2860837431 Bacteria 4202080
151 2864735606 2864733723 Bacteria 6770668
152 2865001293 2864997549 Bacteria 5139696
153 2865005654 2865002811 Bacteria 6333767
154 2877769893 2877768649 Bacteria 3957164
155 2880170887 2880169592 Bacteria 3900066
156 2881640158 2881636855 Bacteria 5205297
157 2885533032 2885526491 Bacteria 7164189
158 2888580571 2888578766 Bacteria 6743310
159 2889047627 2889042446 Bacteria 7618936
160 2889050775 2889049205 Bacteria 7524325
161 2889276263 2889276214 Bacteria 5979355
162 2889300499 2889295896 Bacteria 4704906
163 2897110904 2897109615 Bacteria 4009619
164 2898908693 2898907183 Bacteria 4067722
165 2904116615 2904113452 Bacteria 7796941
166 2904162424 2904162308 Bacteria 7086713
167 2904495581 2904490793 Bacteria 7046938
168 2904562761 2904560550 Bacteria 4029838
169 2904598948 2904595352 Bacteria 6124848
170 2904759381 2904755435 Bacteria 7986759
171 2904761040 2904755435 Bacteria 7986759
172 2907206435 2907202186 Bacteria 6632024
173 2907207586 2907202186 Bacteria 6632024
174 2915603504 2915597211 Bacteria 6475886
175 2915608189 2915606848 Bacteria 6032732
176 2919164534 2919160200 Bacteria 6929020
177 2919416453 2919414237 Bacteria 5429133
178 2919428130 2919425241 Bacteria 8055701
179 2919428601 2919425241 Bacteria 8055701
180 2925328906 2925326138 Bacteria 9652120
181 2929188627 2929183550 Bacteria 6377511
182 2929211115 2929206907 Bacteria 5918291
183 2929238758 2929233124 Bacteria 5948380
184 2931384678 2931384279 Bacteria 7299545
185 2938652871 2938649242 Bacteria 7118381
186 2938653148 2938649242 Bacteria 7118381
187 2938922964 2938917290 Bacteria 5914775
188 2939683951 2939679117 Bacteria 6921672
189 2939704272 2939702853 Bacteria 5139229
190 2945996666 2945991243 Bacteria 7008369
191 2946059344 2946053406 Bacteria 6978655
192 2947431840 2947426588 Bacteria 5357194
193 2956897532 2956897341 Bacteria 5447711
194 2956899766 2956897341 Bacteria 5447711
195 2962292177 2962290636 Bacteria 4072939
196 2965766366 2965761152 Bacteria 5806513
197 2968559421 2968558590 Bacteria 6956864
198 2968563659 2968558590 Bacteria 6956864
199 2969138156 2969136845 Bacteria 3923176
200 2969142340 2969141011 Bacteria 4118468
201 2969768060 2969765954 Bacteria 4216713
202 2969771949 2969770375 Bacteria 4271280
203 2971405678 2971403814 Bacteria 7370929
204 2971408793 2971403814 Bacteria 7370929
205 2971413486 2971410472 Bacteria 8311090
206 2971416510 2971410472 Bacteria 8311090
207 2971516038 2971511577 Bacteria 5404012
208 2971894645 2971893375 Bacteria 3929648
209 2979088747 2979083700 Bacteria 5894929
210 2980126818 2980125574 Bacteria 5567337
211 2980177750 2980176882 Bacteria 5397533
212 2980185941 2980182181 Bacteria 9454109
213 2980493950 2980492589 Bacteria 4072961
214 2981287586 2981284811 Bacteria 4641497
215 2981292781 2981289755 Bacteria 4641509
216 2981983005 2981980479 Bacteria 4641628
217 2981987915 2981985349 Bacteria 4641497
218 2984530880 2984527788 Bacteria 5288478
219 2984536987 2984532647 Bacteria 5288506
220 2988226003 2988225383 Bacteria 7221625
221 2988230836 2988225383 Bacteria 7221625
222 2996634011 2996632988 Bacteria 6921523
223 2996638942 2996632988 Bacteria 6921523
224 2996706840 2996706504 Bacteria 5757485
225 3006860551 3006858327 Bacteria 4317835
226 3006880401 3006879489 Bacteria 4064221
227 3006978922 3006978542 Bacteria 5328100
228 648171795 648028048 Bacteria 5394884
229 8002321261 8002317523 Bacteria 8051857
230 8022626550 8022621104 Bacteria 5241040
231 8022634502 8022630665 Bacteria 3886130
232 8022653763 8022653035 Bacteria 4035078
233 8022797794 8022792930 Bacteria 5693794
234 8022953214 8022948649 Bacteria 5366783
235 8022953223 8022948649 Bacteria 5366783
236 8023441188 8023438354 Bacteria 5779374
237 8023448737 8023444577 Bacteria 5661597
238 8046995578 8046991243 Bacteria 8497463
239 8051953211 8051952484 Bacteria 3926774
240 8052174309 8052174270 Bacteria 3881265
241 8054468053 8054465665 Bacteria 7323556
242 8054470717 8054465665 Bacteria 7323556
243 8054797975 8054795415 Bacteria 9785225
244 8055633445 8055632911 Bacteria 5283357
245 8056534537 8056533031 Bacteria 8964429
246 8056535766 8056533031 Bacteria 8964429
247 8057475426 8057473075 Bacteria 5892720
248 8057477371 8057473075 Bacteria 5892720
249 8057587496 8057582654 Bacteria 5218944
250 8057737111 8057733483 Bacteria 6578323
251 8057978062 8057977335 Bacteria 5694872
252 Ga0105244_10038101
253 JGI25159J45721_1003037
254 JGI25159J45721_1007574
255 Ga0055532_1000657
256 Ga0055535_1005361
257 Ga0055541_1000999
258 Ga0055541_1006498
259 Ga0070669_100033234
260 Ga0105244_10034686
261 Ga0105246_10003894
262 Ga0209566_100130
263 Ga0209566_100319
264 Ga0209566_100363
265 Ga0209147_100131
266 Ga0209147_106305
267 Ga0209437_100703
268 Ga0209130_1000320
269 Ga0209675_1013520
270 Ga0209676_1009176
271 Ga0209025_1000433
272 Ga0209025_1002061
273 Ga0209025_1002789
274 Ga0209025_1003327
275 Ga0209025_1048254
276 Ga0207696_1000998
277 Ga0207655_1001350
278 Ga0207681_10053449
279 Ga0307409_100371052
280 Ga0395899_0013860
281 Ga0395899_0063324
282 Ga0237819_00571
283 Ga0439436_0008751
284 Ga0439439_0000236
285 Ga0439433_0000314
286 Ga0439449_0036094
287 Ga0439462_0019445
288 Ga0466969_0002580
289 Ga0466968_0008183
290 Ga0466959_0003973
291 Ga0466967_0001334
292 Ga0466967_0259364
293 Ga0495603_0102797
294 Ga0495590_0033435
295 Ga0495661_0076372
296 Ga0495636_0053388
297 Ga0496104_0137862
298 Ga0496110_0000735
299 Ga0496113_0135338
300 Ga0496116_0001854
301 Ga0496116_0024637
302 Ga0496116_0060755
303 Ga0496116_0107900
304 Ga0496117_0022092
305 Ga0496119_0002406
306 Ga0496119_0014723
307 Ga0496119_0068753
308 Ga0496120_0000212
309 Ga0496121_0040328
310 Ga0496122_0005811
311 Ga0496122_0015508
312 Ga0496122_0037464
313 Ga0496122_0054714
314 Ga0496123_0004407
315 Ga0496123_0097152
316 Ga0496124_0000170
317 Ga0496124_0000998
318 Ga0496124_0136169
319 Ga0496125_0000620
320 Ga0496125_0001530
321 Ga0496125_0022744
322 Ga0496126_0002583
323 Ga0496126_0003050
324 Ga0496126_0024747
325 Ga0501306_003593
326 Ga0501316_002084
327 Ga0501319_000646
328 Ga0587080_009592
329 Ga0587083_0010935
330 Ga0587067_006500
331 Ga0587079_000243
332 2511180139
333 2511699135
334 2512635962
335 2512730636
336 2524189083
337 2524191846
338 2540606365
339 2545559538
340 2553394439
341 2563928551
342 2571532045
343 2573037994
344 2578338403
345 2578930495
346 2580934327
347 2587741544
348 2587743234
349 2595319578
350 2601638355
351 2601640731
352 2621276937
353 2631986012
354 2643740917
355 2644424272
356 2644428128
357 2644707341
358 2644714298
359 2651529939
360 2672335212
361 2672337894
362 2673818110
363 2674419996
364 2685153038
365 2695627068
366 2698320141
367 2705996966
368 2717917123
369 2721508186
370 2723605750
371 2728532148
372 2728532388
373 2730136424
374 2739157188
375 2739209062
376 2739233491
377 2745170050
378 2753810379
379 2793185138
380 2802438652
381 2809054581
382 2816861715
383 2816864061
384 2817480213
385 2817620468
386 2819567844
387 2819582464
388 2819671567
389 2819674856
390 2821117355
391 2831908440
392 2842688620
393 2857458013
394 2857458919
395 2857462307
396 2857467998
397 2857475971
398 2857586846
399 2857594512
400 2857608235
401 2860838760
402 2864735606
403 2865001293
404 2865005654
405 2877769893
406 2880170887
407 2881640158
408 2885533032
409 2888580571
410 2889047627
411 2889050775
412 2889276263
413 2889300499
414 2897110904
415 2898908693
416 2904116615
417 2904162424
418 2904495581
419 2904562761
420 2904598948
421 2904759381
422 2904761040
423 2907206435
424 2907207586
425 2915603504
426 2915608189
427 2919164534
428 2919416453
429 2919428130
430 2919428601
431 2925328906
432 2929188627
433 2929211115
434 2929238758
435 2931384678
436 2938652871
437 2938653148
438 2938922964
439 2939683951
440 2939704272
441 2945996666
442 2946059344
443 2947431840
444 2956897532
445 2956899766
446 2962292177
447 2965766366
448 2968559421
449 2968563659
450 2969138156
451 2969142340
452 2969768060
453 2969771949
454 2971405678
455 2971408793
456 2971413486
457 2971416510
458 2971516038
459 2971894645
460 2979088747
461 2980126818
462 2980177750
463 2980185941
464 2980493950
465 2981287586
466 2981292781
467 2981983005
468 2981987915
469 2984530880
470 2984536987
471 2988226003
472 2988230836
473 2996634011
474 2996638942
475 2996706840
476 3006860551
477 3006880401
478 3006978922
479 648171795
480 8002321261
481 8022626550
482 8022634502
483 8022653763
484 8022797794
485 8022953214
486 8022953223
487 8023441188
488 8023448737
489 8046995578
490 8051953211
491 8052174309
492 8054468053
493 8054470717
494 8054797975
495 8055633445
496 8056534537
497 8056535766
498 8057475426
499 8057477371
500 8057587496
501 8057737111
502 8057978062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

36

350

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kmq-assembly1.cif.gz_B the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.9605 2 390
4nwz-assembly1.cif.gz_A structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution 0.9578 2 389
5kmp-assembly1.cif.gz_A the structure of g164e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.957 2 390
5na1-assembly1.cif.gz_A nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - holoprotein structure - 2.32 a resolution 0.957 3 387
5kmq-assembly1.cif.gz_B the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.9557 2 390
ID Description Score Start End Superfamily
5kmpB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9595 2 389 3.50.50.100
4xdbD00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9533 3 385 3.50.50.100
5kmpB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9523 2 389 3.50.50.100
af_P00393_5_413_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9362 3 384 3.50.50.100
4xdbD00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9343 3 385 3.50.50.100
ID Description Score Start End GO Terms
AF-C2XIZ2-F1-model_v4 deleted 0.994 1 199
AF-A0A658JKF7-F1-model_v4 deleted 0.9841 1 138
AF-A0A2R4MZ59-F1-model_v4 NADH dehydrogenase 0.9692 1 389 GO:0003955
GO:0019646
AF-K0ACK9-F1-model_v4 deleted 0.9684 2 387
AF-A0A0B0D384-F1-model_v4 NADH dehydrogenase 0.968 2 317 GO:0003955
GO:0019646

Map