F362314

General Info

Members Datasets Scaffolds Average Seq Length
251 168 240 303

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10098866|Ga0075367_100988662
Length 339
Sequence VTFSGLSERPYPAAGVSKRPGPGEFGASSVASLLRVTDQRRGLLLGVAAYGLWGGFPLYWPHLEPAGAIEILAHRVLWSVLTMGLLLVVLRRTQQFRALWAQRRTLVLLTVAAFTITFNWATYIWGVNNDRVVETSLGYFINPLVTVLMGVFILGERLRPLQWVAMGVAATAVVVLTIDYGRLPWVALVLAFSFGTYGLAKKSANVGAVESLTLETTLIAPFAAAYVAWLVLHGSSNFASHGTGHALLLSSTGIVTAIPLICFGAAAIRVSMVTLGLLQYLAPILQFALGVLYFHEDMPAGRWAGFALVWVALVLFTYEANEHRRRQLRLTALASSASG

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221641 Nocardioides sp. Root122 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2643221696 Nocardioides sp. Root140 Isolate Unclassified
6 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
7 2739367898 Nocardioides sp. CF479 Isolate Unclassified
8 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
9 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
10 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
163 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
164 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.22
Metatranscriptomes 0.4
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 16.73
Nodule 0.4
Rhizoplane 7.97
Rhizosphere 70.12
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10035251 3300001990 Bacteria 1548
2 Ga0070658_10006213 3300005327 Bacteria 9684
3 Ga0070683_100002313 3300005329 Bacteria 15113
4 Ga0070683_100017412 3300005329 Bacteria 6351
5 Ga0070670_100155495 3300005331 Bacteria 1980
6 Ga0068869_100103326 3300005334 Bacteria 2159
7 Ga0070682_100054069 3300005337 Bacteria 2518
8 Ga0068868_100122632 3300005338 Bacteria 2121
9 Ga0070689_100067105 3300005340 Bacteria 2796
10 Ga0070687_100019558 3300005343 Bacteria 3153
11 Ga0070692_10008226 3300005345 Bacteria 4644
12 Ga0070675_100103425 3300005354 Bacteria 2401
13 Ga0070674_100012141 3300005356 Bacteria 5280
14 Ga0070673_100110305 3300005364 Bacteria 2281
15 Ga0070659_100101197 3300005366 Bacteria 2320
16 Ga0070659_100141930 3300005366 Bacteria 1956
17 Ga0070667_100114204 3300005367 Bacteria 2344
18 Ga0070710_10000264 3300005437 Bacteria 24986
19 Ga0070700_100000586 3300005441 Bacteria 18251
20 Ga0070662_100138052 3300005457 Bacteria 1887
21 Ga0070681_10305230 3300005458 Bacteria 1501
22 Ga0068867_100031459 3300005459 Bacteria 3832
23 Ga0070685_10048114 3300005466 Bacteria 2455
24 Ga0070684_100003265 3300005535 Bacteria 12144
25 Ga0070684_100148038 3300005535 Bacteria 2126
26 Ga0068853_100250157 3300005539 Bacteria 1626
27 Ga0070672_100001971 3300005543 Bacteria 12854
28 Ga0070686_100072526 3300005544 Bacteria 2258
29 Ga0070686_100144192 3300005544 Bacteria 1661
30 Ga0068855_100132079 3300005563 Bacteria 2851
31 Ga0070664_100157557 3300005564 Bacteria 2007
32 Ga0068857_100004259 3300005577 Bacteria 12059
33 Ga0068854_100036853 3300005578 Bacteria 3430
34 Ga0068856_100061974 3300005614 Bacteria 3695
35 Ga0068856_100642079 3300005614 Bacteria 1082
36 Ga0070702_100001374 3300005615 Bacteria 9926
37 Ga0070702_100148976 3300005615 Bacteria 1499
38 Ga0068852_100018487 3300005616 Bacteria 5492
39 Ga0068852_100106602 3300005616 Bacteria 2541
40 Ga0068864_100042749 3300005618 Bacteria 3878
41 Ga0068864_100217470 3300005618 Bacteria 1762
42 Ga0068866_10029290 3300005718 Bacteria 2632
43 Ga0068861_100245080 3300005719 Bacteria 1526
44 Ga0068870_10006653 3300005840 Bacteria 5108
45 Ga0068858_100027417 3300005842 Bacteria 5292
46 Ga0068860_100019971 3300005843 Bacteria 6494
47 Ga0068862_100034842 3300005844 Bacteria 4261
48 Ga0075365_10005018 3300006038 Bacteria 7094
49 Ga0075365_10009273 3300006038 Bacteria 5646
50 Ga0075365_10024462 3300006038 Bacteria 3811
51 Ga0075365_10045424 3300006038 Bacteria 2881
52 Ga0075365_10045868 3300006038 Bacteria 2869
53 Ga0075365_10053808 3300006038 Bacteria 2667
54 Ga0075365_10106140 3300006038 Bacteria 1927
55 Ga0075365_10204314 3300006038 Bacteria 1384
56 Ga0075368_10008099 3300006042 Bacteria 3731
57 Ga0075363_100010203 3300006048 Bacteria 4446
58 Ga0075364_10005604 3300006051 Bacteria 7320
59 Ga0075364_10039163 3300006051 Bacteria 3072
60 Ga0075364_10040464 3300006051 Bacteria 3023
61 Ga0075364_10068120 3300006051 Bacteria 2340
62 Ga0075367_10013902 3300006178 Bacteria 4343
63 Ga0075367_10057620 3300006178 Bacteria 2310
64 Ga0075367_10098866 3300006178 Bacteria 1782
65 Ga0075367_10292790 3300006178 Bacteria 1024
66 Ga0075370_10004357 3300006353 Bacteria 6861
67 Ga0105245_10032710 3300009098 Bacteria 4605
68 Ga0105245_10080526 3300009098 Bacteria 2975
69 Ga0105243_10014970 3300009148 Bacteria 5871
70 Ga0105243_10133828 3300009148 Bacteria 2107
71 Ga0105243_10466274 3300009148 Bacteria 1189
72 Ga0105242_10008336 3300009176 Bacteria 7963
73 Ga0105242_10481286 3300009176 Bacteria 1176
74 Ga0105248_10001541 3300009177 Bacteria 25652
75 Ga0105248_10054690 3300009177 Bacteria 4477
76 Ga0105237_10452529 3300009545 Bacteria 1290
77 Ga0105249_10040201 3300009553 Bacteria 4247
78 Ga0105249_10115966 3300009553 Bacteria 2538
79 Ga0105239_10002756 3300010375 Bacteria 22055
80 Ga0105246_10000900 3300011119 Bacteria 17053
81 Ga0105246_10303154 3300011119 Bacteria 1291
82 Ga0157371_10067709 3300013102 Bacteria 2527
83 Ga0157369_10148021 3300013105 Bacteria 2482
84 Ga0157372_10027175 3300013307 Bacteria 6229
85 Ga0157372_10029674 3300013307 Bacteria 5974
86 Ga0157375_10107408 3300013308 Bacteria 2884
87 Ga0157375_10268244 3300013308 Bacteria 1869
88 Ga0157375_10520123 3300013308 Bacteria 1353
89 Ga0163163_10063146 3300014325 Bacteria 3671
90 Ga0163163_10343814 3300014325 Bacteria 1547
91 Ga0157380_10016273 3300014326 Bacteria 5480
92 Ga0157377_10009803 3300014745 Bacteria 4719
93 Ga0157377_10049863 3300014745 Bacteria 2355
94 Ga0163161_10058429 3300017792 Bacteria 2803
95 Ga0206353_11448644 3300020082 Bacteria 1711
96 Ga0207692_10000049 3300025898 Bacteria 35853
97 Ga0207642_10145682 3300025899 Bacteria 1254
98 Ga0207688_10010887 3300025901 Bacteria 4948
99 Ga0207647_10070101 3300025904 Bacteria 2118
100 Ga0207643_10000909 3300025908 Bacteria 17706
101 Ga0207662_10008632 3300025918 Bacteria 5589
102 Ga0207662_10025958 3300025918 Bacteria 3377
103 Ga0207652_10222693 3300025921 Bacteria 1700
104 Ga0207650_10301649 3300025925 Bacteria 1308
105 Ga0207687_10045298 3300025927 Bacteria 3040
106 Ga0207687_10113132 3300025927 Bacteria 2018
107 Ga0207690_10151727 3300025932 Bacteria 1718
108 Ga0207706_10112467 3300025933 Bacteria 2395
109 Ga0207686_10418674 3300025934 Bacteria 1024
110 Ga0207669_10046221 3300025937 Bacteria 2571
111 Ga0207691_10000365 3300025940 Bacteria 45542
112 Ga0207711_10042893 3300025941 Bacteria 3856
113 Ga0207711_10074993 3300025941 Bacteria 2943
114 Ga0207689_10099772 3300025942 Bacteria 2386
115 Ga0207661_10003041 3300025944 Bacteria 11601
116 Ga0207667_10039613 3300025949 Bacteria 5022
117 Ga0207712_10018500 3300025961 Bacteria 4539
118 Ga0207712_10249107 3300025961 Bacteria 1435
119 Ga0207640_10009291 3300025981 Bacteria 5500
120 Ga0207658_10122545 3300025986 Bacteria 2075
121 Ga0207677_10149717 3300026023 Bacteria 1799
122 Ga0207703_10253836 3300026035 Bacteria 1586
123 Ga0207639_10018146 3300026041 Bacteria 4996
124 Ga0207708_10000208 3300026075 Bacteria 46487
125 Ga0207702_10050609 3300026078 Bacteria 3508
126 Ga0207648_10033440 3300026089 Bacteria 4535
127 Ga0207676_10244655 3300026095 Bacteria 1611
128 Ga0207674_10092354 3300026116 Bacteria 3016
129 Ga0207674_10238923 3300026116 Bacteria 1764
130 Ga0207675_100001103 3300026118 Bacteria 26696
131 Ga0207675_100047210 3300026118 Bacteria 4021
132 Ga0207675_100311270 3300026118 Bacteria 1536
133 Ga0209813_10001272 3300027866 Bacteria 5634
134 Ga0209813_10001926 3300027866 Bacteria 4680
135 Ga0209813_10077111 3300027866 Bacteria 1095
136 Ga0268264_10000371 3300028381 Bacteria 66158
137 Ga0268264_10133076 3300028381 Bacteria 2207
138 Ga0307509_10251786 3300031507 Bacteria 1549
139 Ga0307405_10163673 3300031731 Bacteria 1579
140 Ga0307410_10016071 3300031852 Bacteria 4453
141 Ga0307410_10272077 3300031852 Bacteria 1325
142 Ga0307412_10174334 3300031911 Bacteria 1611
143 Ga0307409_100107436 3300031995 Bacteria 2331
144 Ga0307409_100195099 3300031995 Bacteria 1806
145 Ga0307409_100212562 3300031995 Bacteria 1739
146 Ga0307409_100452045 3300031995 Bacteria 1240
147 Ga0307409_100494136 3300031995 Bacteria 1190
148 Ga0307416_100004438 3300032002 Bacteria 8456
149 Ga0307416_100266146 3300032002 Bacteria 1679
150 Ga0307411_10004770 3300032005 Bacteria 6561
151 Ga0307411_10175014 3300032005 Bacteria 1623
152 Ga0307415_100001607 3300032126 Bacteria 10918
153 Ga0307415_100315343 3300032126 Bacteria 1301
154 Ga0451791_0812205 3300041451 Bacteria 1735
155 Ga0451802_2069412 3300041460 Bacteria 1418
156 Ga0451837_0568438 3300041494 Bacteria 994
157 Ga0466972_0090465 3300044658 Bacteria 1452
158 Ga0466972_0161687 3300044658 Bacteria 1052
159 Ga0466965_0015592 3300044683 Bacteria 3610
160 Ga0466965_0071616 3300044683 Bacteria 1744
161 Ga0466965_0072396 3300044683 Bacteria 1734
162 Ga0466961_0257588 3300044693 Bacteria 1070
163 Ga0466961_0318740 3300044693 Bacteria 948
164 Ga0466964_0114676 3300044706 Bacteria 1206
165 Ga0466970_0057494 3300044765 Bacteria 2080
166 Ga0466970_0086387 3300044765 Bacteria 1700
167 Ga0466957_0042781 3300044842 Bacteria 2741
168 Ga0466957_0130493 3300044842 Bacteria 1610
169 Ga0466960_0001858 3300044901 Bacteria 7753
170 Ga0466960_0028143 3300044901 Bacteria 2570
171 Ga0466960_0090904 3300044901 Bacteria 1556
172 Ga0466960_0093489 3300044901 Bacteria 1537
173 Ga0466958_0042751 3300045836 Bacteria 2729
174 Ga0466967_0055592 3300045976 Bacteria 3486
175 Ga0466967_0238792 3300045976 Bacteria 1733
176 Ga0466967_0318393 3300045976 Bacteria 1499
177 Ga0495629_0135289 3300046459 Bacteria 1716
178 Ga0496100_0175263 3300048903 Bacteria 1548
179 Ga0496102_0093576 3300048905 Bacteria 2784
180 Ga0496102_0100981 3300048905 Bacteria 2680
181 Ga0496102_0167907 3300048905 Bacteria 2065
182 Ga0496106_0048600 3300048909 Bacteria 3195
183 Ga0496107_0239491 3300048910 Bacteria 1350
184 Ga0496108_0082022 3300048911 Bacteria 2734
185 Ga0496109_0051368 3300048912 Bacteria 3755
186 Ga0496110_0045309 3300048913 Bacteria 3844
187 Ga0496110_0337960 3300048913 Bacteria 1372
188 Ga0496110_0506168 3300048913 Bacteria 1099
189 Ga0496111_0005297 3300048914 Bacteria 8236
190 Ga0496111_0316677 3300048914 Bacteria 1156
191 Ga0496112_0473230 3300048915 Bacteria 1190
192 Ga0496114_0129966 3300048917 Bacteria 2174
193 Ga0496114_0204141 3300048917 Bacteria 1732
194 Ga0496114_0596095 3300048917 Bacteria 974
195 Ga0496115_0033143 3300048918 Bacteria 4077
196 Ga0501032_0069677 3300049569 Bacteria 2347
197 Ga0501033_0160116 3300049570 Bacteria 1620
198 Ga0501034_0096497 3300049571 Bacteria 2952
199 Ga0501036_0010303 3300049572 Bacteria 7711
200 Ga0501036_0110957 3300049572 Bacteria 2318
201 Ga0501036_0254646 3300049572 Bacteria 1471
202 Ga0501037_0058624 3300049573 Bacteria 2809
203 Ga0501038_0012718 3300049574 Bacteria 7689
204 Ga0501039_0072720 3300049575 Bacteria 2672
205 Ga0501039_0209190 3300049575 Bacteria 1534
206 Ga0501042_0100621 3300049578 Bacteria 2078
207 Ga0501043_0058509 3300049579 Bacteria 3025
208 Ga0501046_0052921 3300049580 Bacteria 3199
209 Ga0501047_0021999 3300049581 Bacteria 6124
210 Ga0501069_0147707 3300049585 Bacteria 1350
211 Ga0501070_0453931 3300049586 Bacteria 1033
212 Ga0501071_0135310 3300049587 Bacteria 1833
213 Ga0501072_0352456 3300049588 Bacteria 1168
214 Ga0501073_0042726 3300049589 Bacteria 3198
215 Ga0501076_0129072 3300049592 Bacteria 2050
216 Ga0501035_0036562 3300049822 Bacteria 4450
217 Ga0501044_0008287 3300049823 Bacteria 11395
218 nmdc:mga03683_7126_c1 3300050489 Bacteria 3866
219 nmdc:mga00v17_16386_c1 3300050491 Bacteria 4177
220 nmdc:mga00v17_300147_c1 3300050491 Bacteria 1043
221 nmdc:mga00v17_69886_c1 3300050491 Bacteria 2174
222 nmdc:mga0yw44_11336_c1 3300050492 Bacteria 4595
223 nmdc:mga0yw44_41324_c1 3300050492 Bacteria 2745
224 nmdc:mga0yw44_6786_c1 3300050492 Bacteria 5564
225 nmdc:mga0yw44_7922_c1 3300050492 Bacteria 5263
226 nmdc:mga0yw44_99836_c1 3300050492 Bacteria 1847
227 nmdc:mga06z11_112251_c1 3300050494 Bacteria 1511
228 nmdc:mga06z11_186810_c1 3300050494 Bacteria 1198
229 nmdc:mga06z11_25805_c1 3300050494 Bacteria 2790
230 nmdc:mga04h51_4027_c1 3300050495 Bacteria 3622
231 nmdc:mga04h51_46418_c1 3300050495 Bacteria 1440
232 nmdc:mga07m45_9579_c1 3300050496 Bacteria 5032
233 Ga0500635_0001314 3300053080 Bacteria 5939
234 Ga0500593_000316 3300053117 Bacteria 19389
235 Ga0500652_001153 3300053131 Bacteria 8461
236 Ga0500573_0031806 3300053140 Bacteria 3045
237 Ga0500573_0117394 3300053140 Bacteria 1484
238 Ga0501084_0144746 3300054114 Bacteria 2002
239 Ga0501084_0162218 3300054114 Bacteria 1886
240 Ga0466962_0122132 3300061719 Bacteria 1257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032005 Ga0307411_10004770 Ga0307411_100047705 270
2 3300053080 Ga0500635_0001314 Ga0500635_0001314_1371_2270 271
3 3300053131 Ga0500652_001153 Ga0500652_001153_3633_4532 271
4 3300027866 Ga0209813_10001926 Ga0209813_100019264 273
5 3300049572 Ga0501036_0254646 Ga0501036_0254646_245_1135 273
6 3300054114 Ga0501084_0162218 Ga0501084_0162218_937_1827 273
7 3300053140 Ga0500573_0031806 Ga0500573_0031806_1407_2327 274
8 3300006051 Ga0075364_10040464 Ga0075364_100404644 277
9 3300005437 Ga0070710_10000264 Ga0070710_1000026416 278
10 3300005843 Ga0068860_100019971 Ga0068860_1000199713 278
11 3300025898 Ga0207692_10000049 Ga0207692_1000004930 278
12 3300028381 Ga0268264_10000371 Ga0268264_1000037172 278
13 3300053140 Ga0500573_0117394 Ga0500573_0117394_40_948 279
14 3300031507 Ga0307509_10251786 Ga0307509_102517861 282
15 3300044683 Ga0466965_0015592 Ga0466965_0015592_524_1447 282
16 3300006038 Ga0075365_10045868 Ga0075365_100458683 283
17 3300041451 Ga0451791_0812205 Ga0451791_0812205_273_1181 284
18 3300041460 Ga0451802_2069412 Ga0451802_2069412_61_969 284
19 3300041494 Ga0451837_0568438 Ga0451837_0568438_72_980 284
20 3300054114 Ga0501084_0144746 Ga0501084_0144746_1021_1932 285
21 3300031731 Ga0307405_10163673 Ga0307405_101636731 286
22 3300031852 Ga0307410_10016071 Ga0307410_100160712 286
23 3300031995 Ga0307409_100195099 Ga0307409_1001950991 286
24 3300032002 Ga0307416_100266146 Ga0307416_1002661461 286
25 3300032005 Ga0307411_10175014 Ga0307411_101750142 286
26 3300044693 Ga0466961_0257588 Ga0466961_0257588_47_910 286
27 3300044706 Ga0466964_0114676 Ga0466964_0114676_125_988 286
28 3300044765 Ga0466970_0057494 Ga0466970_0057494_19_882 286
29 3300044842 Ga0466957_0042781 Ga0466957_0042781_979_1842 286
30 3300045836 Ga0466958_0042751 Ga0466958_0042751_645_1508 286
31 3300045976 Ga0466967_0055592 Ga0466967_0055592_57_920 286
32 3300045976 Ga0466967_0238792 Ga0466967_0238792_848_1711 286
33 3300045976 Ga0466967_0318393 Ga0466967_0318393_543_1403 286
34 3300049586 Ga0501070_0453931 Ga0501070_0453931_157_1020 286
35 3300061719 Ga0466962_0122132 Ga0466962_0122132_225_1088 286
36 3300049569 Ga0501032_0069677 Ga0501032_0069677_897_1760 287
37 3300049570 Ga0501033_0160116 Ga0501033_0160116_555_1418 287
38 3300049571 Ga0501034_0096497 Ga0501034_0096497_1463_2326 287
39 3300049572 Ga0501036_0010303 Ga0501036_0010303_4948_5811 287
40 3300049573 Ga0501037_0058624 Ga0501037_0058624_449_1312 287
41 3300049574 Ga0501038_0012718 Ga0501038_0012718_1873_2736 287
42 3300049575 Ga0501039_0209190 Ga0501039_0209190_360_1223 287
43 3300049578 Ga0501042_0100621 Ga0501042_0100621_288_1151 287
44 3300049579 Ga0501043_0058509 Ga0501043_0058509_1278_2141 287
45 3300049580 Ga0501046_0052921 Ga0501046_0052921_1441_2304 287
46 3300049581 Ga0501047_0021999 Ga0501047_0021999_3753_4616 287
47 3300049589 Ga0501073_0042726 Ga0501073_0042726_1550_2413 287
48 3300049822 Ga0501035_0036562 Ga0501035_0036562_2251_3114 287
49 3300049823 Ga0501044_0008287 Ga0501044_0008287_8011_8874 287
50 3300046459 Ga0495629_0135289 Ga0495629_0135289_393_1346 288
51 3300044683 Ga0466965_0072396 Ga0466965_0072396_293_1201 289
52 3300031995 Ga0307409_100452045 Ga0307409_1004520452 291
53 3300044658 Ga0466972_0090465 Ga0466972_0090465_138_1052 294
54 3300044658 Ga0466972_0161687 Ga0466972_0161687_80_967 294
55 3300044683 Ga0466965_0071616 Ga0466965_0071616_24_911 294
56 3300044693 Ga0466961_0318740 Ga0466961_0318740_17_904 294
57 3300044901 Ga0466960_0093489 Ga0466960_0093489_509_1396 294
58 3300048913 Ga0496110_0506168 Ga0496110_0506168_20_910 294
59 3300013308 Ga0157375_10107408 Ga0157375_101074082 295
60 3300048917 Ga0496114_0596095 Ga0496114_0596095_16_903 295
61 3300050492 nmdc:mga0yw44_99836_c1 nmdc:mga0yw44_99836_c1_921_1811 295
62 iso_pu_bacteria 2738541308 2738886946 296
63 3300031852 Ga0307410_10272077 Ga0307410_102720772 297
64 3300031995 Ga0307409_100107436 Ga0307409_1001074362 297
65 3300031995 Ga0307409_100212562 Ga0307409_1002125622 297
66 3300032002 Ga0307416_100004438 Ga0307416_1000044382 297
67 3300032126 Ga0307415_100001607 Ga0307415_1000016075 297
68 3300032126 Ga0307415_100315343 Ga0307415_1003153432 297
69 iso_pu_bacteria 2643221561 2643827324 298
70 iso_pu_bacteria 2643221615 2644093086 298
71 iso_pu_bacteria 2643221641 2644229708 298
72 iso_pu_bacteria 2643221657 2644322697 298
73 iso_pu_bacteria 2643221696 2644533849 298
74 iso_pu_bacteria 2739367898 2740168259 298
75 iso_pu_bacteria 2855386786 2855388138 298
76 iso_pu_bacteria 8054609563 8054614339 298
77 iso_pu_bacteria 2974315732 2974317108 300
78 iso_pu_bacteria 2984523437 2984525314 300
79 3300009148 Ga0105243_10133828 Ga0105243_101338281 301
80 3300026118 Ga0207675_100047210 Ga0207675_1000472103 301
81 3300044765 Ga0466970_0086387 Ga0466970_0086387_494_1408 301
82 3300044842 Ga0466957_0130493 Ga0466957_0130493_318_1232 301
83 3300044901 Ga0466960_0090904 Ga0466960_0090904_64_978 301
84 3300048905 Ga0496102_0100981 Ga0496102_0100981_673_1602 301
85 3300001990 JGI24737J22298_10035251 JGI24737J22298_100352512 302
86 3300005327 Ga0070658_10006213 Ga0070658_100062135 302
87 3300005329 Ga0070683_100002313 Ga0070683_10000231313 302
88 3300005329 Ga0070683_100017412 Ga0070683_1000174125 302
89 3300005331 Ga0070670_100155495 Ga0070670_1001554953 302
90 3300005334 Ga0068869_100103326 Ga0068869_1001033262 302
91 3300005337 Ga0070682_100054069 Ga0070682_1000540693 302
92 3300005338 Ga0068868_100122632 Ga0068868_1001226323 302
93 3300005340 Ga0070689_100067105 Ga0070689_1000671054 302
94 3300005343 Ga0070687_100019558 Ga0070687_1000195583 302
95 3300005345 Ga0070692_10008226 Ga0070692_100082263 302
96 3300005354 Ga0070675_100103425 Ga0070675_1001034253 302
97 3300005356 Ga0070674_100012141 Ga0070674_1000121415 302
98 3300005364 Ga0070673_100110305 Ga0070673_1001103052 302
99 3300005366 Ga0070659_100101197 Ga0070659_1001011972 302
100 3300005366 Ga0070659_100141930 Ga0070659_1001419302 302
101 3300005367 Ga0070667_100114204 Ga0070667_1001142043 302
102 3300005441 Ga0070700_100000586 Ga0070700_10000058612 302
103 3300005457 Ga0070662_100138052 Ga0070662_1001380522 302
104 3300005458 Ga0070681_10305230 Ga0070681_103052301 302
105 3300005459 Ga0068867_100031459 Ga0068867_1000314594 302
106 3300005466 Ga0070685_10048114 Ga0070685_100481141 302
107 3300005535 Ga0070684_100003265 Ga0070684_1000032653 302
108 3300005535 Ga0070684_100148038 Ga0070684_1001480382 302
109 3300005539 Ga0068853_100250157 Ga0068853_1002501572 302
110 3300005543 Ga0070672_100001971 Ga0070672_1000019717 302
111 3300005544 Ga0070686_100072526 Ga0070686_1000725261 302
112 3300005544 Ga0070686_100144192 Ga0070686_1001441922 302
113 3300005563 Ga0068855_100132079 Ga0068855_1001320793 302
114 3300005564 Ga0070664_100157557 Ga0070664_1001575573 302
115 3300005577 Ga0068857_100004259 Ga0068857_10000425910 302
116 3300005578 Ga0068854_100036853 Ga0068854_1000368534 302
117 3300005614 Ga0068856_100061974 Ga0068856_1000619743 302
118 3300005614 Ga0068856_100642079 Ga0068856_1006420792 302
119 3300005615 Ga0070702_100001374 Ga0070702_1000013748 302
120 3300005615 Ga0070702_100148976 Ga0070702_1001489762 302
121 3300005616 Ga0068852_100018487 Ga0068852_1000184875 302
122 3300005616 Ga0068852_100106602 Ga0068852_1001066023 302
123 3300005618 Ga0068864_100042749 Ga0068864_1000427494 302
124 3300005618 Ga0068864_100217470 Ga0068864_1002174703 302
125 3300005718 Ga0068866_10029290 Ga0068866_100292904 302
126 3300005719 Ga0068861_100245080 Ga0068861_1002450802 302
127 3300005840 Ga0068870_10006653 Ga0068870_100066532 302
128 3300005842 Ga0068858_100027417 Ga0068858_1000274172 302
129 3300005844 Ga0068862_100034842 Ga0068862_1000348424 302
130 3300006038 Ga0075365_10005018 Ga0075365_100050184 302
131 3300006038 Ga0075365_10009273 Ga0075365_100092733 302
132 3300006038 Ga0075365_10024462 Ga0075365_100244621 302
133 3300006038 Ga0075365_10045424 Ga0075365_100454243 302
134 3300006038 Ga0075365_10053808 Ga0075365_100538083 302
135 3300006038 Ga0075365_10106140 Ga0075365_101061402 302
136 3300006038 Ga0075365_10204314 Ga0075365_102043141 302
137 3300006042 Ga0075368_10008099 Ga0075368_100080993 302
138 3300006048 Ga0075363_100010203 Ga0075363_1000102033 302
139 3300006051 Ga0075364_10005604 Ga0075364_100056045 302
140 3300006051 Ga0075364_10039163 Ga0075364_100391632 302
141 3300006051 Ga0075364_10068120 Ga0075364_100681202 302
142 3300006178 Ga0075367_10013902 Ga0075367_100139021 302
143 3300006178 Ga0075367_10057620 Ga0075367_100576203 302
144 3300006178 Ga0075367_10098866 Ga0075367_100988662 302
145 3300006178 Ga0075367_10292790 Ga0075367_102927901 302
146 3300006353 Ga0075370_10004357 Ga0075370_100043574 302
147 3300009098 Ga0105245_10032710 Ga0105245_100327104 302
148 3300009098 Ga0105245_10080526 Ga0105245_100805262 302
149 3300009148 Ga0105243_10014970 Ga0105243_100149705 302
150 3300009148 Ga0105243_10466274 Ga0105243_104662742 302
151 3300009176 Ga0105242_10008336 Ga0105242_100083364 302
152 3300009176 Ga0105242_10481286 Ga0105242_104812861 302
153 3300009177 Ga0105248_10001541 Ga0105248_1000154121 302
154 3300009177 Ga0105248_10054690 Ga0105248_100546902 302
155 3300009545 Ga0105237_10452529 Ga0105237_104525292 302
156 3300009553 Ga0105249_10040201 Ga0105249_100402014 302
157 3300009553 Ga0105249_10115966 Ga0105249_101159663 302
158 3300010375 Ga0105239_10002756 Ga0105239_1000275611 302
159 3300011119 Ga0105246_10000900 Ga0105246_100009005 302
160 3300011119 Ga0105246_10303154 Ga0105246_103031542 302
161 3300013102 Ga0157371_10067709 Ga0157371_100677092 302
162 3300013105 Ga0157369_10148021 Ga0157369_101480212 302
163 3300013307 Ga0157372_10027175 Ga0157372_100271751 302
164 3300013307 Ga0157372_10029674 Ga0157372_100296743 302
165 3300013308 Ga0157375_10268244 Ga0157375_102682442 302
166 3300013308 Ga0157375_10520123 Ga0157375_105201231 302
167 3300014325 Ga0163163_10063146 Ga0163163_100631462 302
168 3300014325 Ga0163163_10343814 Ga0163163_103438142 302
169 3300014326 Ga0157380_10016273 Ga0157380_100162734 302
170 3300014745 Ga0157377_10009803 Ga0157377_100098032 302
171 3300014745 Ga0157377_10049863 Ga0157377_100498633 302
172 3300017792 Ga0163161_10058429 Ga0163161_100584292 302
173 3300020082 Ga0206353_11448644 Ga0206353_114486442 302
174 3300025899 Ga0207642_10145682 Ga0207642_101456822 302
175 3300025901 Ga0207688_10010887 Ga0207688_100108873 302
176 3300025904 Ga0207647_10070101 Ga0207647_100701012 302
177 3300025908 Ga0207643_10000909 Ga0207643_100009098 302
178 3300025918 Ga0207662_10008632 Ga0207662_100086326 302
179 3300025918 Ga0207662_10025958 Ga0207662_100259583 302
180 3300025921 Ga0207652_10222693 Ga0207652_102226932 302
181 3300025925 Ga0207650_10301649 Ga0207650_103016492 302
182 3300025927 Ga0207687_10045298 Ga0207687_100452983 302
183 3300025927 Ga0207687_10113132 Ga0207687_101131323 302
184 3300025932 Ga0207690_10151727 Ga0207690_101517271 302
185 3300025933 Ga0207706_10112467 Ga0207706_101124671 302
186 3300025934 Ga0207686_10418674 Ga0207686_104186741 302
187 3300025937 Ga0207669_10046221 Ga0207669_100462211 302
188 3300025940 Ga0207691_10000365 Ga0207691_1000036522 302
189 3300025941 Ga0207711_10042893 Ga0207711_100428933 302
190 3300025941 Ga0207711_10074993 Ga0207711_100749933 302
191 3300025942 Ga0207689_10099772 Ga0207689_100997723 302
192 3300025944 Ga0207661_10003041 Ga0207661_100030415 302
193 3300025949 Ga0207667_10039613 Ga0207667_100396134 302
194 3300025961 Ga0207712_10018500 Ga0207712_100185003 302
195 3300025961 Ga0207712_10249107 Ga0207712_102491072 302
196 3300025981 Ga0207640_10009291 Ga0207640_100092914 302
197 3300025986 Ga0207658_10122545 Ga0207658_101225452 302
198 3300026023 Ga0207677_10149717 Ga0207677_101497172 302
199 3300026035 Ga0207703_10253836 Ga0207703_102538362 302
200 3300026041 Ga0207639_10018146 Ga0207639_100181463 302
201 3300026075 Ga0207708_10000208 Ga0207708_1000020826 302
202 3300026078 Ga0207702_10050609 Ga0207702_100506093 302
203 3300026089 Ga0207648_10033440 Ga0207648_100334404 302
204 3300026095 Ga0207676_10244655 Ga0207676_102446552 302
205 3300026116 Ga0207674_10092354 Ga0207674_100923542 302
206 3300026116 Ga0207674_10238923 Ga0207674_102389232 302
207 3300026118 Ga0207675_100001103 Ga0207675_10000110312 302
208 3300026118 Ga0207675_100311270 Ga0207675_1003112702 302
209 3300027866 Ga0209813_10001272 Ga0209813_100012724 302
210 3300027866 Ga0209813_10077111 Ga0209813_100771111 302
211 3300028381 Ga0268264_10133076 Ga0268264_101330762 302
212 3300031911 Ga0307412_10174334 Ga0307412_101743342 302
213 3300031995 Ga0307409_100494136 Ga0307409_1004941362 302
214 3300044901 Ga0466960_0001858 Ga0466960_0001858_6572_7489 302
215 3300044901 Ga0466960_0028143 Ga0466960_0028143_640_1548 302
216 3300048903 Ga0496100_0175263 Ga0496100_0175263_476_1384 302
217 3300048905 Ga0496102_0093576 Ga0496102_0093576_297_1205 302
218 3300048905 Ga0496102_0167907 Ga0496102_0167907_306_1244 302
219 3300048909 Ga0496106_0048600 Ga0496106_0048600_1404_2312 302
220 3300048910 Ga0496107_0239491 Ga0496107_0239491_374_1333 302
221 3300048911 Ga0496108_0082022 Ga0496108_0082022_1754_2713 302
222 3300048912 Ga0496109_0051368 Ga0496109_0051368_561_1499 302
223 3300048913 Ga0496110_0045309 Ga0496110_0045309_823_1782 302
224 3300048913 Ga0496110_0337960 Ga0496110_0337960_322_1230 302
225 3300048914 Ga0496111_0005297 Ga0496111_0005297_406_1314 302
226 3300048914 Ga0496111_0316677 Ga0496111_0316677_37_996 302
227 3300048915 Ga0496112_0473230 Ga0496112_0473230_243_1151 302
228 3300048917 Ga0496114_0129966 Ga0496114_0129966_708_1667 302
229 3300048917 Ga0496114_0204141 Ga0496114_0204141_202_1161 302
230 3300048918 Ga0496115_0033143 Ga0496115_0033143_1585_2523 302
231 3300049572 Ga0501036_0110957 Ga0501036_0110957_813_1724 302
232 3300049575 Ga0501039_0072720 Ga0501039_0072720_821_1729 302
233 3300049585 Ga0501069_0147707 Ga0501069_0147707_306_1214 302
234 3300049587 Ga0501071_0135310 Ga0501071_0135310_133_1041 302
235 3300049588 Ga0501072_0352456 Ga0501072_0352456_83_991 302
236 3300049592 Ga0501076_0129072 Ga0501076_0129072_227_1180 302
237 3300050489 nmdc:mga03683_7126_c1 nmdc:mga03683_7126_c1_1955_2866 302
238 3300050491 nmdc:mga00v17_16386_c1 nmdc:mga00v17_16386_c1_2569_3477 302
239 3300050491 nmdc:mga00v17_300147_c1 nmdc:mga00v17_300147_c1_16_924 302
240 3300050491 nmdc:mga00v17_69886_c1 nmdc:mga00v17_69886_c1_1213_2124 302
241 3300050492 nmdc:mga0yw44_11336_c1 nmdc:mga0yw44_11336_c1_975_1883 302
242 3300050492 nmdc:mga0yw44_41324_c1 nmdc:mga0yw44_41324_c1_743_1654 302
243 3300050492 nmdc:mga0yw44_6786_c1 nmdc:mga0yw44_6786_c1_1575_2486 302
244 3300050492 nmdc:mga0yw44_7922_c1 nmdc:mga0yw44_7922_c1_4322_5230 302
245 3300050494 nmdc:mga06z11_112251_c1 nmdc:mga06z11_112251_c1_505_1413 302
246 3300050494 nmdc:mga06z11_186810_c1 nmdc:mga06z11_186810_c1_222_1133 302
247 3300050494 nmdc:mga06z11_25805_c1 nmdc:mga06z11_25805_c1_157_1068 302
248 3300050495 nmdc:mga04h51_4027_c1 nmdc:mga04h51_4027_c1_1409_2320 302
249 3300050495 nmdc:mga04h51_46418_c1 nmdc:mga04h51_46418_c1_432_1343 302
250 3300050496 nmdc:mga07m45_9579_c1 nmdc:mga07m45_9579_c1_2673_3584 302
251 3300053117 Ga0500593_000316 Ga0500593_000316_2790_3701 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

40

178

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly2.cif.gz_B crystal structure of protein 0.7767 7 283
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.774 4 280
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7643 4 280
5i20-assembly1.cif.gz_A crystal structure of protein 0.7638 7 287
5i20-assembly3.cif.gz_C crystal structure of protein 0.7622 4 283
ID Description Score Start End Superfamily
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9341 147 282 1.25.10.10
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9147 147 282 1.25.10.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6857 6 283 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6395 3 286 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6387 6 283 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A6I3CI25-F1-model_v4 EamA family transporter RarD 0.986 7 300 GO:0005886
AF-A0A6J7QWV9-F1-model_v4 Unannotated protein 0.9855 27 300 GO:0005886
AF-A0A0G3H745-F1-model_v4 RarD protein 0.9849 9 298 GO:0005886
AF-A0A7X7D998-F1-model_v4 EamA family transporter RarD 0.9835 10 285 GO:0005886
AF-A0A7X3U1I7-F1-model_v4 EamA family transporter RarD 0.9832 2 290 GO:0005886

Feature Viewer

pLDDT pTM Quality
90.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map