F362264

General Info

Members Datasets Scaffolds Average Seq Length
251 177 502 105

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100971212|Ga0070693_1009712122
Length 120
Sequence MCLAVPGRILRMFDADDTLMSDVDFGGVVKQVCLQYIPDAAVGDYVIVHVGFALQKLDEESALATLRNFERLGIMEEEFGDGFALAAKQAGEPVPVGAGFESTSPPAASAGGSPTNGAAR

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
117 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
177 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0
Rhizoplane 12.35
Rhizosphere 80.88
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100971212 3300005547 Bacteria 641
2 Ga0070683_100051647 3300005329 Bacteria 3807
3 Ga0070690_100479537 3300005330 Bacteria 927
4 Ga0068869_100004694 3300005334 Bacteria 8529
5 Ga0070682_100493566 3300005337 Bacteria 947
6 Ga0070682_101071868 3300005337 Bacteria 673
7 Ga0068868_100013401 3300005338 Bacteria 6013
8 Ga0070660_100045781 3300005339 Bacteria 3351
9 Ga0070689_100969854 3300005340 Bacteria 755
10 Ga0070661_100026664 3300005344 Bacteria 4157
11 Ga0070661_101280011 3300005344 Bacteria 615
12 Ga0070692_10011465 3300005345 Bacteria 4072
13 Ga0070668_100587650 3300005347 Bacteria 973
14 Ga0070669_100060460 3300005353 Bacteria 2783
15 Ga0070675_100005587 3300005354 Bacteria 9627
16 Ga0070674_100398597 3300005356 Bacteria 1124
17 Ga0070688_100092618 3300005365 Bacteria 1977
18 Ga0070659_100801911 3300005366 Bacteria 819
19 Ga0070667_100768413 3300005367 Bacteria 894
20 Ga0070701_10092059 3300005438 Bacteria 1663
21 Ga0070700_100140411 3300005441 Bacteria 1641
22 Ga0070663_100079607 3300005455 Bacteria 2405
23 Ga0070663_101898089 3300005455 Bacteria 535
24 Ga0070678_100089424 3300005456 Bacteria 2357
25 Ga0070678_100685687 3300005456 Bacteria 922
26 Ga0070662_100192716 3300005457 Bacteria 1613
27 Ga0068867_100328667 3300005459 Bacteria 1269
28 Ga0070679_100390871 3300005530 Bacteria 1337
29 Ga0070684_100009697 3300005535 Bacteria 7597
30 Ga0070684_100476493 3300005535 Bacteria 1155
31 Ga0070684_100598426 3300005535 Bacteria 1025
32 Ga0070684_100652430 3300005535 Bacteria 980
33 Ga0068853_100633366 3300005539 Bacteria 1017
34 Ga0070686_100667599 3300005544 Bacteria 826
35 Ga0070665_100356813 3300005548 Bacteria 1468
36 Ga0070664_100002196 3300005564 Bacteria 15671
37 Ga0068857_100010068 3300005577 Bacteria 8215
38 Ga0068856_100573075 3300005614 Bacteria 1150
39 Ga0068856_101558638 3300005614 Bacteria 674
40 Ga0070702_100155872 3300005615 Bacteria 1471
41 Ga0068852_100051187 3300005616 Bacteria 3543
42 Ga0068852_100228402 3300005616 Bacteria 1773
43 Ga0068864_100331937 3300005618 Bacteria 1431
44 Ga0068861_102023219 3300005719 Bacteria 575
45 Ga0068851_10301023 3300005834 Bacteria 922
46 Ga0068851_10886347 3300005834 Bacteria 558
47 Ga0068863_101813504 3300005841 Bacteria 620
48 Ga0068860_100687864 3300005843 Bacteria 1032
49 Ga0068862_100161148 3300005844 Bacteria 2002
50 Ga0081540_1006990 3300005983 Bacteria 8121
51 Ga0075363_100030831 3300006048 Bacteria 2778
52 Ga0075364_11259902 3300006051 Bacteria 501
53 Ga0075367_10033332 3300006178 Bacteria 2967
54 Ga0075367_10801876 3300006178 Bacteria 600
55 Ga0097621_101799863 3300006237 Bacteria 584
56 Ga0097621_102238708 3300006237 Bacteria 523
57 Ga0075370_10549689 3300006353 Bacteria 698
58 Ga0075433_11593975 3300006852 Bacteria 563
59 Ga0075429_100450912 3300006880 Bacteria 1127
60 Ga0068865_100438695 3300006881 Bacteria 1077
61 Ga0068865_100939774 3300006881 Bacteria 754
62 Ga0097620_101099936 3300006931 Bacteria 874
63 Ga0111539_10014994 3300009094 Bacteria 9658
64 Ga0105245_10004632 3300009098 Bacteria 12147
65 Ga0105245_10223926 3300009098 Bacteria 1816
66 Ga0105245_10470544 3300009098 Bacteria 1268
67 Ga0105245_10953632 3300009098 Bacteria 901
68 Ga0105243_10321853 3300009148 Bacteria 1409
69 Ga0105243_10913903 3300009148 Bacteria 874
70 Ga0105243_11283308 3300009148 Bacteria 749
71 Ga0105243_11341799 3300009148 Bacteria 734
72 Ga0105242_12669782 3300009176 Bacteria 549
73 Ga0105248_12770430 3300009177 Bacteria 559
74 Ga0105238_10444945 3300009551 Bacteria 1292
75 Ga0105238_11021143 3300009551 Bacteria 848
76 Ga0105249_11505448 3300009553 Bacteria 745
77 Ga0105239_12194284 3300010375 Unclassified 642
78 Ga0105246_10059311 3300011119 Bacteria 2654
79 Ga0105246_10307371 3300011119 Bacteria 1283
80 Ga0157371_10405141 3300013102 Bacteria 998
81 Ga0157369_11006043 3300013105 Bacteria 853
82 Ga0157374_10764561 3300013296 Bacteria 981
83 Ga0163162_10474600 3300013306 Bacteria 1382
84 Ga0163162_10761603 3300013306 Bacteria 1087
85 Ga0163162_11304257 3300013306 Bacteria 825
86 Ga0163162_12109047 3300013306 Bacteria 647
87 Ga0157372_10151981 3300013307 Bacteria 2672
88 Ga0157375_10165681 3300013308 Bacteria 2355
89 Ga0157375_10258525 3300013308 Bacteria 1903
90 Ga0157375_10307992 3300013308 Bacteria 1748
91 Ga0157375_11124399 3300013308 Bacteria 920
92 Ga0163163_10430436 3300014325 Bacteria 1378
93 Ga0163163_10988144 3300014325 Bacteria 905
94 Ga0163163_13260556 3300014325 Bacteria 506
95 Ga0157380_10462927 3300014326 Bacteria 1221
96 Ga0157380_12229665 3300014326 Bacteria 612
97 Ga0182008_10156572 3300014497 Bacteria 1145
98 Ga0182008_10220317 3300014497 Bacteria 971
99 Ga0157377_10030016 3300014745 Bacteria 2941
100 Ga0157377_10220354 3300014745 Bacteria 1214
101 Ga0157376_12479396 3300014969 Bacteria 558
102 Ga0163161_10403324 3300017792 Bacteria 1097
103 Ga0163161_11717359 3300017792 Bacteria 556
104 Ga0207656_10592483 3300025321 Bacteria 566
105 Ga0207688_10275734 3300025901 Bacteria 1024
106 Ga0207657_10048674 3300025919 Bacteria 3700
107 Ga0207657_10729977 3300025919 Bacteria 768
108 Ga0207649_10501199 3300025920 Bacteria 923
109 Ga0207652_10358250 3300025921 Bacteria 1317
110 Ga0207681_10429249 3300025923 Bacteria 1072
111 Ga0207659_10004786 3300025926 Bacteria 8207
112 Ga0207659_11171791 3300025926 Bacteria 661
113 Ga0207687_10067631 3300025927 Bacteria 2542
114 Ga0207687_10272735 3300025927 Bacteria 1353
115 Ga0207664_10495973 3300025929 Bacteria 1093
116 Ga0207706_10006598 3300025933 Bacteria 10748
117 Ga0207686_11521173 3300025934 Bacteria 552
118 Ga0207669_10253449 3300025937 Bacteria 1312
119 Ga0207669_11557027 3300025937 Bacteria 564
120 Ga0207704_10188197 3300025938 Bacteria 1499
121 Ga0207691_10859911 3300025940 Bacteria 760
122 Ga0207689_10079874 3300025942 Bacteria 2688
123 Ga0207661_10082216 3300025944 Bacteria 2662
124 Ga0207661_10720557 3300025944 Bacteria 918
125 Ga0207679_10070794 3300025945 Bacteria 2629
126 Ga0207668_10390177 3300025972 Bacteria 1174
127 Ga0207658_10080067 3300025986 Bacteria 2501
128 Ga0207658_10707931 3300025986 Bacteria 910
129 Ga0207677_10041908 3300026023 Bacteria 3030
130 Ga0207678_10099663 3300026067 Bacteria 2482
131 Ga0207678_10764868 3300026067 Bacteria 852
132 Ga0207678_10906797 3300026067 Bacteria 779
133 Ga0207678_11000262 3300026067 Bacteria 740
134 Ga0207708_10172802 3300026075 Bacteria 1712
135 Ga0207702_10806659 3300026078 Bacteria 928
136 Ga0207648_10388646 3300026089 Bacteria 1263
137 Ga0207676_10556815 3300026095 Bacteria 1096
138 Ga0207674_10008513 3300026116 Bacteria 11842
139 Ga0207683_10031879 3300026121 Bacteria 4577
140 Ga0207698_10112559 3300026142 Bacteria 2285
141 Ga0207698_11981629 3300026142 Bacteria 597
142 Ga0207428_10028070 3300027907 Bacteria 4678
143 Ga0268266_10281780 3300028379 Bacteria 1546
144 Ga0268265_10181080 3300028380 Bacteria 1810
145 Ga0268264_11532953 3300028381 Bacteria 677
146 Ga0265323_10069721 3300028653 Bacteria 1204
147 Ga0307515_10518145 3300028794 Bacteria 802
148 Ga0265338_10008465 3300028800 Bacteria 12486
149 Ga0265324_10000488 3300029957 Bacteria 27664
150 Ga0265324_10003658 3300029957 Bacteria 7214
151 Ga0307512_10055832 3300030522 Bacteria 3108
152 Ga0265340_10550628 3300031247 Bacteria 508
153 Ga0265316_11151825 3300031344 Unclassified 537
154 Ga0307508_10124896 3300031616 Bacteria 2175
155 Ga0307405_10564364 3300031731 Bacteria 923
156 Ga0307406_10181285 3300031901 Bacteria 1533
157 Ga0307409_100139257 3300031995 Bacteria 2088
158 Ga0307416_100211382 3300032002 Bacteria 1851
159 Ga0307415_100263844 3300032126 Bacteria 1407
160 Ga0316583_10009757 3300032133 Bacteria 3460
161 Ga0451798_0239339 3300041458 Bacteria 927
162 Ga0451807_2147103 3300041486 Bacteria 882
163 Ga0451835_0061900 3300041492 Unclassified 635
164 Ga0451835_1045299 3300041492 Bacteria 669
165 Ga0451853_3915897 3300041512 Bacteria 810
166 Ga0451577_0002005 3300042876 Bacteria 25323
167 Ga0451577_0009171 3300042876 Bacteria 9545
168 Ga0451577_0011209 3300042876 Bacteria 8499
169 Ga0451577_0024053 3300042876 Bacteria 5545
170 Ga0451577_0125482 3300042876 Bacteria 2300
171 Ga0466969_0005022 3300044656 Bacteria 7041
172 Ga0466972_0052372 3300044658 Bacteria 1967
173 Ga0466966_0002189 3300044684 Bacteria 12688
174 Ga0466961_0018036 3300044693 Bacteria 4538
175 Ga0453684_0011981 3300044712 Bacteria 14423
176 Ga0453684_0052993 3300044712 Bacteria 5299
177 Ga0466959_0008215 3300045049 Bacteria 7364
178 Ga0451576_0777796 3300045051 Bacteria 1005
179 Ga0495592_0123671 3300046454 Bacteria 1817
180 Ga0495629_0022473 3300046459 Bacteria 4497
181 Ga0495629_0162432 3300046459 Bacteria 1551
182 Ga0495629_0793692 3300046459 Bacteria 625
183 Ga0495629_1001701 3300046459 Bacteria 544
184 Ga0495641_0089336 3300046461 Bacteria 1377
185 Ga0495651_0305982 3300046462 Bacteria 1065
186 Ga0495580_0100247 3300046472 Bacteria 2015
187 Ga0495608_0054629 3300046511 Bacteria 2640
188 Ga0495608_0138061 3300046511 Bacteria 1557
189 Ga0495620_0022004 3300046515 Bacteria 3082
190 Ga0495644_0058813 3300046523 Bacteria 1445
191 Ga0495652_0638621 3300046529 Bacteria 722
192 Ga0495640_0416036 3300046533 Bacteria 824
193 Ga0495587_0185388 3300046536 Bacteria 1179
194 Ga0495645_0440123 3300046543 Bacteria 824
195 Ga0495667_0730963 3300046559 Bacteria 612
196 Ga0495634_0829590 3300046642 Bacteria 526
197 Ga0495623_0156598 3300046679 Bacteria 1342
198 Ga0495600_0071533 3300046809 Bacteria 2266
199 Ga0495581_0311831 3300047315 Bacteria 919
200 Ga0495581_0489096 3300047315 Bacteria 716
201 Ga0495676_0920295 3300047321 Bacteria 560
202 Ga0495680_0019638 3300047322 Bacteria 5701
203 Ga0495685_018006 3300047447 Bacteria 2421
204 Ga0495684_0218190 3300047471 Bacteria 1400
205 Ga0495602_0490721 3300048088 Bacteria 860
206 Ga0496100_0528435 3300048903 Bacteria 911
207 Ga0496100_0808541 3300048903 Bacteria 735
208 Ga0496102_0498095 3300048905 Bacteria 1140
209 Ga0496104_0846342 3300048907 Bacteria 820
210 Ga0496104_1069287 3300048907 Bacteria 710
211 Ga0496104_1124542 3300048907 Bacteria 689
212 Ga0496105_0147082 3300048908 Bacteria 1937
213 Ga0496105_1252162 3300048908 Bacteria 544
214 Ga0496107_0667642 3300048910 Bacteria 766
215 Ga0496108_0360981 3300048911 Bacteria 1268
216 Ga0496108_0538445 3300048911 Bacteria 1019
217 Ga0496108_0923062 3300048911 Bacteria 748
218 Ga0496109_0000752 3300048912 Bacteria 26970
219 Ga0496109_0219050 3300048912 Bacteria 1790
220 Ga0496109_1258374 3300048912 Bacteria 676
221 Ga0496109_1765364 3300048912 Bacteria 552
222 Ga0496110_0000832 3300048913 Bacteria 21674
223 Ga0496110_0209764 3300048913 Bacteria 1771
224 Ga0496110_0227352 3300048913 Bacteria 1697
225 Ga0496110_1186007 3300048913 Bacteria 672
226 Ga0496111_0082169 3300048914 Bacteria 2352
227 Ga0496111_0851233 3300048914 Bacteria 658
228 Ga0496112_0115719 3300048915 Bacteria 2652
229 Ga0496112_1154861 3300048915 Bacteria 692
230 Ga0496113_0083921 3300048916 Bacteria 2445
231 Ga0496114_0118172 3300048917 Bacteria 2278
232 Ga0496114_0252155 3300048917 Bacteria 1553
233 Ga0496114_0420064 3300048917 Bacteria 1184
234 Ga0496114_0756216 3300048917 Bacteria 849
235 Ga0496124_0211099 3300048927 Bacteria 1469
236 Ga0495682_0221105 3300049460 Bacteria 671
237 Ga0501040_0361288 3300049576 Bacteria 1041
238 Ga0501046_0674308 3300049580 Bacteria 730
239 Ga0501048_0062991 3300049582 Bacteria 2624
240 Ga0501079_0580658 3300049741 Bacteria 882
241 Ga0501045_0627823 3300049824 Bacteria 795
242 nmdc:mga03n38_105891_c1 3300050490 Bacteria 1363
243 nmdc:mga03n38_72667_c1 3300050490 Bacteria 1595
244 nmdc:mga00v17_76523_c1 3300050491 Bacteria 2082
245 nmdc:mga06z11_16636_c1 3300050494 Bacteria 3317
246 nmdc:mga06z11_700198_c1 3300050494 Bacteria 617
247 nmdc:mga09592_75889_c1 3300050508 Bacteria 2858
248 nmdc:mga08y16_2866_c1 3300050511 Bacteria 17738
249 Ga0495601_0007020 3300053077 Bacteria 6600
250 2919719716 2919713450 Bacteria 7431245
251 3001121421 3001119090 Bacteria 3449530
252 Ga0070693_100971212
253 Ga0070683_100051647
254 Ga0070690_100479537
255 Ga0068869_100004694
256 Ga0070682_100493566
257 Ga0070682_101071868
258 Ga0068868_100013401
259 Ga0070660_100045781
260 Ga0070689_100969854
261 Ga0070661_100026664
262 Ga0070661_101280011
263 Ga0070692_10011465
264 Ga0070668_100587650
265 Ga0070669_100060460
266 Ga0070675_100005587
267 Ga0070674_100398597
268 Ga0070688_100092618
269 Ga0070659_100801911
270 Ga0070667_100768413
271 Ga0070701_10092059
272 Ga0070700_100140411
273 Ga0070663_100079607
274 Ga0070663_101898089
275 Ga0070678_100089424
276 Ga0070678_100685687
277 Ga0070662_100192716
278 Ga0068867_100328667
279 Ga0070679_100390871
280 Ga0070684_100009697
281 Ga0070684_100476493
282 Ga0070684_100598426
283 Ga0070684_100652430
284 Ga0068853_100633366
285 Ga0070686_100667599
286 Ga0070665_100356813
287 Ga0070664_100002196
288 Ga0068857_100010068
289 Ga0068856_100573075
290 Ga0068856_101558638
291 Ga0070702_100155872
292 Ga0068852_100051187
293 Ga0068852_100228402
294 Ga0068864_100331937
295 Ga0068861_102023219
296 Ga0068851_10301023
297 Ga0068851_10886347
298 Ga0068863_101813504
299 Ga0068860_100687864
300 Ga0068862_100161148
301 Ga0081540_1006990
302 Ga0075363_100030831
303 Ga0075364_11259902
304 Ga0075367_10033332
305 Ga0075367_10801876
306 Ga0097621_101799863
307 Ga0097621_102238708
308 Ga0075370_10549689
309 Ga0075433_11593975
310 Ga0075429_100450912
311 Ga0068865_100438695
312 Ga0068865_100939774
313 Ga0097620_101099936
314 Ga0111539_10014994
315 Ga0105245_10004632
316 Ga0105245_10223926
317 Ga0105245_10470544
318 Ga0105245_10953632
319 Ga0105243_10321853
320 Ga0105243_10913903
321 Ga0105243_11283308
322 Ga0105243_11341799
323 Ga0105242_12669782
324 Ga0105248_12770430
325 Ga0105238_10444945
326 Ga0105238_11021143
327 Ga0105249_11505448
328 Ga0105239_12194284
329 Ga0105246_10059311
330 Ga0105246_10307371
331 Ga0157371_10405141
332 Ga0157369_11006043
333 Ga0157374_10764561
334 Ga0163162_10474600
335 Ga0163162_10761603
336 Ga0163162_11304257
337 Ga0163162_12109047
338 Ga0157372_10151981
339 Ga0157375_10165681
340 Ga0157375_10258525
341 Ga0157375_10307992
342 Ga0157375_11124399
343 Ga0163163_10430436
344 Ga0163163_10988144
345 Ga0163163_13260556
346 Ga0157380_10462927
347 Ga0157380_12229665
348 Ga0182008_10156572
349 Ga0182008_10220317
350 Ga0157377_10030016
351 Ga0157377_10220354
352 Ga0157376_12479396
353 Ga0163161_10403324
354 Ga0163161_11717359
355 Ga0207656_10592483
356 Ga0207688_10275734
357 Ga0207657_10048674
358 Ga0207657_10729977
359 Ga0207649_10501199
360 Ga0207652_10358250
361 Ga0207681_10429249
362 Ga0207659_10004786
363 Ga0207659_11171791
364 Ga0207687_10067631
365 Ga0207687_10272735
366 Ga0207664_10495973
367 Ga0207706_10006598
368 Ga0207686_11521173
369 Ga0207669_10253449
370 Ga0207669_11557027
371 Ga0207704_10188197
372 Ga0207691_10859911
373 Ga0207689_10079874
374 Ga0207661_10082216
375 Ga0207661_10720557
376 Ga0207679_10070794
377 Ga0207668_10390177
378 Ga0207658_10080067
379 Ga0207658_10707931
380 Ga0207677_10041908
381 Ga0207678_10099663
382 Ga0207678_10764868
383 Ga0207678_10906797
384 Ga0207678_11000262
385 Ga0207708_10172802
386 Ga0207702_10806659
387 Ga0207648_10388646
388 Ga0207676_10556815
389 Ga0207674_10008513
390 Ga0207683_10031879
391 Ga0207698_10112559
392 Ga0207698_11981629
393 Ga0207428_10028070
394 Ga0268266_10281780
395 Ga0268265_10181080
396 Ga0268264_11532953
397 Ga0265323_10069721
398 Ga0307515_10518145
399 Ga0265338_10008465
400 Ga0265324_10000488
401 Ga0265324_10003658
402 Ga0307512_10055832
403 Ga0265340_10550628
404 Ga0265316_11151825
405 Ga0307508_10124896
406 Ga0307405_10564364
407 Ga0307406_10181285
408 Ga0307409_100139257
409 Ga0307416_100211382
410 Ga0307415_100263844
411 Ga0316583_10009757
412 Ga0451798_0239339
413 Ga0451807_2147103
414 Ga0451835_0061900
415 Ga0451835_1045299
416 Ga0451853_3915897
417 Ga0451577_0002005
418 Ga0451577_0009171
419 Ga0451577_0011209
420 Ga0451577_0024053
421 Ga0451577_0125482
422 Ga0466969_0005022
423 Ga0466972_0052372
424 Ga0466966_0002189
425 Ga0466961_0018036
426 Ga0453684_0011981
427 Ga0453684_0052993
428 Ga0466959_0008215
429 Ga0451576_0777796
430 Ga0495592_0123671
431 Ga0495629_0022473
432 Ga0495629_0162432
433 Ga0495629_0793692
434 Ga0495629_1001701
435 Ga0495641_0089336
436 Ga0495651_0305982
437 Ga0495580_0100247
438 Ga0495608_0054629
439 Ga0495608_0138061
440 Ga0495620_0022004
441 Ga0495644_0058813
442 Ga0495652_0638621
443 Ga0495640_0416036
444 Ga0495587_0185388
445 Ga0495645_0440123
446 Ga0495667_0730963
447 Ga0495634_0829590
448 Ga0495623_0156598
449 Ga0495600_0071533
450 Ga0495581_0311831
451 Ga0495581_0489096
452 Ga0495676_0920295
453 Ga0495680_0019638
454 Ga0495685_018006
455 Ga0495684_0218190
456 Ga0495602_0490721
457 Ga0496100_0528435
458 Ga0496100_0808541
459 Ga0496102_0498095
460 Ga0496104_0846342
461 Ga0496104_1069287
462 Ga0496104_1124542
463 Ga0496105_0147082
464 Ga0496105_1252162
465 Ga0496107_0667642
466 Ga0496108_0360981
467 Ga0496108_0538445
468 Ga0496108_0923062
469 Ga0496109_0000752
470 Ga0496109_0219050
471 Ga0496109_1258374
472 Ga0496109_1765364
473 Ga0496110_0000832
474 Ga0496110_0209764
475 Ga0496110_0227352
476 Ga0496110_1186007
477 Ga0496111_0082169
478 Ga0496111_0851233
479 Ga0496112_0115719
480 Ga0496112_1154861
481 Ga0496113_0083921
482 Ga0496114_0118172
483 Ga0496114_0252155
484 Ga0496114_0420064
485 Ga0496114_0756216
486 Ga0496124_0211099
487 Ga0495682_0221105
488 Ga0501040_0361288
489 Ga0501046_0674308
490 Ga0501048_0062991
491 Ga0501079_0580658
492 Ga0501045_0627823
493 nmdc:mga03n38_105891_c1
494 nmdc:mga03n38_72667_c1
495 nmdc:mga00v17_76523_c1
496 nmdc:mga06z11_16636_c1
497 nmdc:mga06z11_700198_c1
498 nmdc:mga09592_75889_c1
499 nmdc:mga08y16_2866_c1
500 Ga0495601_0007020
501 2919719716
502 3001121421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01455

HupF_HypC

HupF/HypC family

1

69

0.94

Map